Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0G02222g5.423ON37837820240.0
Suva_15.3085.423ON37837615450.0
Skud_8.1735.423ON37837615430.0
Smik_8.1905.423ON42037615470.0
YHR112C5.423ON37837615400.0
NCAS0F032905.423ON40437515290.0
NDAI0B055905.423ON38037715110.0
CAGL0I01276g5.423ON38037214420.0
KAFR0E038605.423ON37837614340.0
Kpol_1031.235.423ON37937714280.0
KLLA0E21319g5.423ON38037614120.0
TBLA0A036805.423ON38437214010.0
KNAG0C049905.423ON38037913790.0
ZYRO0F09768g5.423ON37337413400.0
ZYRO0F15664gsingletonON37337413370.0
TBLA0B03020singletonON37937413110.0
CAGL0K05665gsingletonON37937713100.0
NDAI0F00140singletonON37838013001e-179
KNAG0F01580singletonON37937812851e-177
AER250C5.423ON37437412611e-174
Ecym_55235.423ON38137912611e-173
TDEL0G00140singletonON38137612471e-171
TDEL0G04970singletonON38137711981e-164
NDAI0B00595singletonON37838011751e-160
Kwal_55.222215.423ON38037311521e-157
KLTH0E16566g5.423ON38137011451e-156
TPHA0A06070na 1ON37336211131e-151
CAGL0H06369g7.97ON3914043551e-37
KAFR0K007607.97ON3923993374e-35
NDAI0H024007.97ON3934033341e-34
Ecym_26297.97ON3924043313e-34
Skud_1.497.97ON3944023313e-34
Smik_1.557.97ON3944023314e-34
Suva_1.567.97ON3953993289e-34
TPHA0L005707.97ON3913973252e-33
TBLA0E022407.97ON3874083252e-33
YAL012W (CYS3)7.97ON3943973252e-33
NCAS0F015207.97ON4294003263e-33
Kpol_1044.107.97ON3914013243e-33
ZYRO0D05742g7.97ON3913933191e-32
KLLA0F07909g7.97ON3914023173e-32
AEL341W7.97ON3933913131e-31
SAKL0B09614g7.97ON3924073121e-31
KNAG0D047407.97ON3903983051e-30
KLTH0D02728g7.97ON3924113006e-30
TDEL0H035307.97ON3913922962e-29
CAGL0L06094g8.145ON4503922754e-26
Smik_7.898.145ON4654132711e-25
YGL184C (STR3)8.145ON4654122712e-25
Skud_7.888.145ON4654132651e-24
Suva_7.798.145ON4654132561e-23
ACL059C8.145ON4532572526e-23
ZYRO0G19162g8.145ON4554012491e-22
Ecym_84058.145ON4724162446e-22
TDEL0B046608.145ON4643932331e-20
SAKL0H24882g8.145ON4594082332e-20
KLTH0E06644g8.145ON4602582332e-20
Kwal_47.172218.145ON4632572295e-20
KLLA0C17028g8.145ON4604142261e-19
TDEL0D06630singletonON4023442215e-19
NCAS0A058104.53ON4474522128e-18
Skud_19.6singletonON4013422091e-17
Smik_7.375na 1ON4013411951e-15
ADL031W4.53ON4673061914e-15
TBLA0C044004.53ON4452941881e-14
Suva_17.6singletonON4013411833e-14
ZYRO0G22198g4.53ON4454471834e-14
NDAI0D028804.53ON4474461834e-14
KLTH0D03652g4.53ON4443861772e-13
TPHA0F004204.53ON4424381754e-13
Smik_10.4234.354ON6392581755e-13
KNAG0I029204.53ON4452931737e-13
Kpol_1041.444.53ON4443861738e-13
Suva_12.2214.354ON6392571731e-12
Skud_10.3534.354ON6402741721e-12
SAKL0H23892g4.53ON4423101711e-12
SAKL0G18172g4.354ON6733111721e-12
YJR130C (STR2)4.354ON6392541702e-12
YFR055W (IRC7)na 1ON3402961673e-12
KAFR0F030704.53ON4452901693e-12
Ecym_83654.53ON4444241666e-12
Kpol_1028.804.354ON6892691613e-11
KLLA0D04037g4.53ON4443841595e-11
TPHA0L003304.354ON7172711595e-11
KLTH0G00418gsingletonON5682591561e-10
KLTH0D17930g4.354ON6522711542e-10
Suva_13.684.354ON6882541542e-10
AER164C4.354ON6453141533e-10
Ecym_51694.354ON6812401524e-10
CAGL0D06402g4.53ON4422971514e-10
Smik_13.554.354ON6992541516e-10
YML082W4.354ON6492391507e-10
Skud_12.10na 2ON5712601507e-10
TDEL0D006104.354ON6522601507e-10
CAGL0M00550g4.354ON5692431507e-10
Kwal_26.74374.53ON4442901497e-10
Skud_12.3844.53ON4444341481e-09
YLR303W (MET17)4.53ON4444341481e-09
Smik_12.3834.53ON4444341471e-09
Suva_10.3974.53ON4444341471e-09
Kwal_14.791na 2ON5712531472e-09
YLL058Wna 2ON5752561462e-09
Skud_13.594.354ON6492541435e-09
NCAS0A062704.354ON6592441418e-09
ZYRO0B08338g4.354ON6402511401e-08
TDEL0E056204.53ON4462971363e-08
Suva_10.8na 2ON5722591355e-08
TDEL0E05710singletonON5562521346e-08
KLLA0B04378g4.354ON6882591338e-08
NDAI0D032604.354ON6963601302e-07
KAFR0B068304.354ON6672611241e-06
Kwal_47.166444.354ON6522711222e-06
Smik_12.3na 2ON5662501213e-06
KNAG0M003304.354ON6312491089e-05
Kwal_26.7197singletonOFF8761830.011
Kwal_33.143655.327ON437114760.58
TPHA0P010403.93ON1038178731.6
Kpol_1025.172.414ON82993731.6
CAGL0I06853g8.182ON54576694.5
TPHA0I005408.810ON55692677.8
CAGL0H03355g6.202ON203132659.3
TDEL0D00190singletonON552946610.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0G02222g
         (378 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0G02222g Chr7 complement(186449..187585) [1137 bp, 378 aa] {...   784   0.0  
Suva_15.308 Chr15 complement(536926..538062) [1137 bp, 378 aa] {...   599   0.0  
Skud_8.173 Chr8 complement(308322..309458) [1137 bp, 378 aa] {ON...   598   0.0  
Smik_8.190 Chr8 complement(310892..312154) [1263 bp, 420 aa] {ON...   600   0.0  
YHR112C Chr8 complement(334527..335663) [1137 bp, 378 aa] {ON} P...   597   0.0  
NCAS0F03290 Chr6 complement(667618..668832) [1215 bp, 404 aa] {O...   593   0.0  
NDAI0B05590 Chr2 complement(1367293..1368435) [1143 bp, 380 aa] ...   586   0.0  
CAGL0I01276g Chr9 complement(104391..105533) [1143 bp, 380 aa] {...   560   0.0  
KAFR0E03860 Chr5 complement(766029..767165) [1137 bp, 378 aa] {O...   556   0.0  
Kpol_1031.23 s1031 complement(55637..56776) [1140 bp, 379 aa] {O...   554   0.0  
KLLA0E21319g Chr5 (1904841..1905983) [1143 bp, 380 aa] {ON} high...   548   0.0  
TBLA0A03680 Chr1 complement(919740..920894) [1155 bp, 384 aa] {O...   544   0.0  
KNAG0C04990 Chr3 (960378..961520) [1143 bp, 380 aa] {ON} Anc_5.4...   535   0.0  
ZYRO0F09768g Chr6 complement(793824..794945) [1122 bp, 373 aa] {...   520   0.0  
ZYRO0F15664g Chr6 (1286078..1287199) [1122 bp, 373 aa] {ON} high...   519   0.0  
TBLA0B03020 Chr2 complement(700483..701622) [1140 bp, 379 aa] {O...   509   0.0  
CAGL0K05665g Chr11 complement(552804..553943) [1140 bp, 379 aa] ...   509   0.0  
NDAI0F00140 Chr6 (15124..16260) [1137 bp, 378 aa] {ON}                505   e-179
KNAG0F01580 Chr6 complement(282872..284011) [1140 bp, 379 aa] {O...   499   e-177
AER250C Chr5 complement(1098456..1099580) [1125 bp, 374 aa] {ON}...   490   e-174
Ecym_5523 Chr5 complement(1060537..1061682) [1146 bp, 381 aa] {O...   490   e-173
TDEL0G00140 Chr7 complement(20315..21460) [1146 bp, 381 aa] {ON}      484   e-171
TDEL0G04970 Chr7 complement(925785..926930) [1146 bp, 381 aa] {O...   466   e-164
NDAI0B00595 Chr2 (131225..132361) [1137 bp, 378 aa] {ON}              457   e-160
Kwal_55.22221 s55 (1160724..1161866) [1143 bp, 380 aa] {ON} YHR1...   448   e-157
KLTH0E16566g Chr5 (1468783..1469928) [1146 bp, 381 aa] {ON} simi...   445   e-156
TPHA0A06070 Chr1 complement(1370008..1371129) [1122 bp, 373 aa] ...   433   e-151
CAGL0H06369g Chr8 (627708..628883) [1176 bp, 391 aa] {ON} highly...   141   1e-37
KAFR0K00760 Chr11 (171591..172769) [1179 bp, 392 aa] {ON} Anc_7....   134   4e-35
NDAI0H02400 Chr8 complement(582916..584097) [1182 bp, 393 aa] {O...   133   1e-34
Ecym_2629 Chr2 complement(1216179..1217357) [1179 bp, 392 aa] {O...   132   3e-34
Skud_1.49 Chr1 (106029..107213) [1185 bp, 394 aa] {ON} YAL012W (...   132   3e-34
Smik_1.55 Chr1 (113765..114949) [1185 bp, 394 aa] {ON} YAL012W (...   132   4e-34
Suva_1.56 Chr1 (107030..108217) [1188 bp, 395 aa] {ON} YAL012W (...   130   9e-34
TPHA0L00570 Chr12 (97933..99108) [1176 bp, 391 aa] {ON} Anc_7.97...   129   2e-33
TBLA0E02240 Chr5 (554046..555209) [1164 bp, 387 aa] {ON} Anc_7.9...   129   2e-33
YAL012W Chr1 (130799..131983) [1185 bp, 394 aa] {ON}  CYS3Cystat...   129   2e-33
NCAS0F01520 Chr6 complement(303410..304699) [1290 bp, 429 aa] {O...   130   3e-33
Kpol_1044.10 s1044 (19232..20407) [1176 bp, 391 aa] {ON} (19232....   129   3e-33
ZYRO0D05742g Chr4 (489953..491128) [1176 bp, 391 aa] {ON} highly...   127   1e-32
KLLA0F07909g Chr6 (742468..743643) [1176 bp, 391 aa] {ON} highly...   126   3e-32
AEL341W Chr5 (9428..10609) [1182 bp, 393 aa] {ON} Syntenic homol...   125   1e-31
SAKL0B09614g Chr2 complement(813507..814685) [1179 bp, 392 aa] {...   124   1e-31
KNAG0D04740 Chr4 complement(851405..852577) [1173 bp, 390 aa] {O...   122   1e-30
KLTH0D02728g Chr4 (267019..268197) [1179 bp, 392 aa] {ON} highly...   120   6e-30
TDEL0H03530 Chr8 complement(586031..587206) [1176 bp, 391 aa] {O...   118   2e-29
CAGL0L06094g Chr12 (693250..694602) [1353 bp, 450 aa] {ON} simil...   110   4e-26
Smik_7.89 Chr7 complement(149314..150711) [1398 bp, 465 aa] {ON}...   108   1e-25
YGL184C Chr7 complement(154615..156012) [1398 bp, 465 aa] {ON}  ...   108   2e-25
Skud_7.88 Chr7 complement(160235..161632) [1398 bp, 465 aa] {ON}...   106   1e-24
Suva_7.79 Chr7 complement(150082..151479) [1398 bp, 465 aa] {ON}...   103   1e-23
ACL059C Chr3 complement(259732..261093) [1362 bp, 453 aa] {ON} S...   101   6e-23
ZYRO0G19162g Chr7 (1590120..1591487) [1368 bp, 455 aa] {ON} simi...   100   1e-22
Ecym_8405 Chr8 (839466..840884) [1419 bp, 472 aa] {ON} similar t...    99   6e-22
TDEL0B04660 Chr2 complement(828468..829862) [1395 bp, 464 aa] {O...    94   1e-20
SAKL0H24882g Chr8 (2167623..2169002) [1380 bp, 459 aa] {ON} high...    94   2e-20
KLTH0E06644g Chr5 complement(608116..609498) [1383 bp, 460 aa] {...    94   2e-20
Kwal_47.17221 s47 complement(306099..307490) [1392 bp, 463 aa] {...    93   5e-20
KLLA0C17028g Chr3 complement(1487806..1489188) [1383 bp, 460 aa]...    92   1e-19
TDEL0D06630 Chr4 complement(1200459..1201667) [1209 bp, 402 aa] ...    90   5e-19
NCAS0A05810 Chr1 (1143717..1145060) [1344 bp, 447 aa] {ON} Anc_4...    86   8e-18
Skud_19.6 Chr19 complement(5562..6767) [1206 bp, 401 aa] {ON} YF...    85   1e-17
Smik_7.375 Chr7 (620194..621399) [1206 bp, 401 aa] {ON} YFR055W ...    80   1e-15
ADL031W Chr4 (645776..647179) [1404 bp, 467 aa] {ON} Syntenic ho...    78   4e-15
TBLA0C04400 Chr3 (1062021..1063358) [1338 bp, 445 aa] {ON} Anc_4...    77   1e-14
Suva_17.6 Chr17 (9922..11127) [1206 bp, 401 aa] {ON} YFR055W (REAL)    75   3e-14
ZYRO0G22198g Chr7 complement(1827527..1828864) [1338 bp, 445 aa]...    75   4e-14
NDAI0D02880 Chr4 (669487..670830) [1344 bp, 447 aa] {ON} Anc_4.53      75   4e-14
KLTH0D03652g Chr4 complement(358612..359946) [1335 bp, 444 aa] {...    73   2e-13
TPHA0F00420 Chr6 complement(103419..104747) [1329 bp, 442 aa] {O...    72   4e-13
Smik_10.423 Chr10 complement(654265..656184) [1920 bp, 639 aa] {...    72   5e-13
KNAG0I02920 Chr9 (573008..574345) [1338 bp, 445 aa] {ON} Anc_4.5...    71   7e-13
Kpol_1041.44 s1041 (117344..118678) [1335 bp, 444 aa] {ON} (1173...    71   8e-13
Suva_12.221 Chr12 complement(344667..346586) [1920 bp, 639 aa] {...    71   1e-12
Skud_10.353 Chr10 complement(623771..625693) [1923 bp, 640 aa] {...    71   1e-12
SAKL0H23892g Chr8 (2059083..2060411) [1329 bp, 442 aa] {ON} high...    70   1e-12
SAKL0G18172g Chr7 complement(1572652..1574673) [2022 bp, 673 aa]...    71   1e-12
YJR130C Chr10 complement(665218..667137) [1920 bp, 639 aa] {ON} ...    70   2e-12
YFR055W Chr6 (264204..265226) [1023 bp, 340 aa] {ON}  IRC7Beta-l...    69   3e-12
KAFR0F03070 Chr6 (610571..611908) [1338 bp, 445 aa] {ON} Anc_4.5...    70   3e-12
Ecym_8365 Chr8 complement(732418..733752) [1335 bp, 444 aa] {ON}...    69   6e-12
Kpol_1028.80 s1028 (179685..181754) [2070 bp, 689 aa] {ON} (1796...    67   3e-11
KLLA0D04037g Chr4 (336499..337833) [1335 bp, 444 aa] {ON} highly...    66   5e-11
TPHA0L00330 Chr12 (43495..45648) [2154 bp, 717 aa] {ON} Anc_4.35...    66   5e-11
KLTH0G00418g Chr7 complement(23130..24836) [1707 bp, 568 aa] {ON...    65   1e-10
KLTH0D17930g Chr4 (1486259..1488217) [1959 bp, 652 aa] {ON} simi...    64   2e-10
Suva_13.68 Chr13 (103103..105169) [2067 bp, 688 aa] {ON} YML082W...    64   2e-10
AER164C Chr5 complement(944867..946804) [1938 bp, 645 aa] {ON} S...    64   3e-10
Ecym_5169 Chr5 complement(353237..355282) [2046 bp, 681 aa] {ON}...    63   4e-10
CAGL0D06402g Chr4 (602973..604301) [1329 bp, 442 aa] {ON} highly...    63   4e-10
Smik_13.55 Chr13 (99421..101520) [2100 bp, 699 aa] {ON} YJR130C ...    63   6e-10
YML082W Chr13 (101862..103811) [1950 bp, 649 aa] {ON} Putative p...    62   7e-10
Skud_12.10 Chr12 (10565..12280) [1716 bp, 571 aa] {ON} YLL058W (...    62   7e-10
TDEL0D00610 Chr4 (109396..111354) [1959 bp, 652 aa] {ON} Anc_4.3...    62   7e-10
CAGL0M00550g Chr13 (66078..67787) [1710 bp, 569 aa] {ON} similar...    62   7e-10
Kwal_26.7437 s26 complement(365889..367223) [1335 bp, 444 aa] {O...    62   7e-10
Skud_12.384 Chr12 (673748..675082) [1335 bp, 444 aa] {ON} YLR303...    62   1e-09
YLR303W Chr12 (732542..733876) [1335 bp, 444 aa] {ON}  MET17Meth...    62   1e-09
Smik_12.383 Chr12 (670676..672010) [1335 bp, 444 aa] {ON} YLR303...    61   1e-09
Suva_10.397 Chr10 (693647..694981) [1335 bp, 444 aa] {ON} YLR303...    61   1e-09
Kwal_14.791 s14 complement(49074..50789) [1716 bp, 571 aa] {ON} ...    61   2e-09
YLL058W Chr12 (23569..25296) [1728 bp, 575 aa] {ON} Putative pro...    61   2e-09
Skud_13.59 Chr13 (101194..103143) [1950 bp, 649 aa] {ON} YML082W...    60   5e-09
NCAS0A06270 Chr1 complement(1239445..1241424) [1980 bp, 659 aa] ...    59   8e-09
ZYRO0B08338g Chr2 complement(649933..651855) [1923 bp, 640 aa] {...    59   1e-08
TDEL0E05620 Chr5 complement(1043585..1044925) [1341 bp, 446 aa] ...    57   3e-08
Suva_10.8 Chr10 (9213..10931) [1719 bp, 572 aa] {ON} YLL058W (REAL)    57   5e-08
TDEL0E05710 Chr5 complement(1062353..1064023) [1671 bp, 556 aa] ...    56   6e-08
KLLA0B04378g Chr2 (390701..392767) [2067 bp, 688 aa] {ON} simila...    56   8e-08
NDAI0D03260 Chr4 complement(774579..776669) [2091 bp, 696 aa] {O...    55   2e-07
KAFR0B06830 Chr2 complement(1421910..1423913) [2004 bp, 667 aa] ...    52   1e-06
Kwal_47.16644 s47 complement(41349..43307) [1959 bp, 652 aa] {ON...    52   2e-06
Smik_12.3 Chr12 (6081..7781) [1701 bp, 566 aa] {ON} YLL058W (REAL)     51   3e-06
KNAG0M00330 Chr13 (48427..50322) [1896 bp, 631 aa] {ON} Anc_4.35...    46   9e-05
Kwal_26.7197 s26 (258929..259192) [264 bp, 87 aa] {OFF} YAL012W ...    37   0.011
Kwal_33.14365 s33 (640933..642246) [1314 bp, 437 aa] {ON} YDR306...    34   0.58 
TPHA0P01040 Chr16 (208875..211991) [3117 bp, 1038 aa] {ON} Anc_3...    33   1.6  
Kpol_1025.17 s1025 (46552..49041) [2490 bp, 829 aa] {ON} (46552....    33   1.6  
CAGL0I06853g Chr9 complement(664381..666018) [1638 bp, 545 aa] {...    31   4.5  
TPHA0I00540 Chr9 (107264..108934) [1671 bp, 556 aa] {ON} Anc_8.8...    30   7.8  
CAGL0H03355g Chr8 (312934..313545) [612 bp, 203 aa] {ON} similar...    30   9.3  
TDEL0D00190 Chr4 (29971..31629) [1659 bp, 552 aa] {ON}                 30   10.0 

>SAKL0G02222g Chr7 complement(186449..187585) [1137 bp, 378 aa] {ON}
           highly similar to uniprot|P38716 Saccharomyces
           cerevisiae YHR112C Hypothetical ORF
          Length = 378

 Score =  784 bits (2024), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/378 (100%), Positives = 378/378 (100%)

Query: 1   MVSLPTTLIHADDKDNRVTDIVSPINVATTFRYDNNNLIAWNDRENYDFLETTPVYSRLA 60
           MVSLPTTLIHADDKDNRVTDIVSPINVATTFRYDNNNLIAWNDRENYDFLETTPVYSRLA
Sbjct: 1   MVSLPTTLIHADDKDNRVTDIVSPINVATTFRYDNNNLIAWNDRENYDFLETTPVYSRLA 60

Query: 61  HPNATRLESIFSEILGGHAVIYSSGLAAYFATLTHYNPKKLFIGQSYHGCHGIADIFTRN 120
           HPNATRLESIFSEILGGHAVIYSSGLAAYFATLTHYNPKKLFIGQSYHGCHGIADIFTRN
Sbjct: 61  HPNATRLESIFSEILGGHAVIYSSGLAAYFATLTHYNPKKLFIGQSYHGCHGIADIFTRN 120

Query: 121 NGMKQYPLDRIEELASEGDIVHLETPVNPFGTSYDIEDFARKAHAKGALLVIDSTFAPPP 180
           NGMKQYPLDRIEELASEGDIVHLETPVNPFGTSYDIEDFARKAHAKGALLVIDSTFAPPP
Sbjct: 121 NGMKQYPLDRIEELASEGDIVHLETPVNPFGTSYDIEDFARKAHAKGALLVIDSTFAPPP 180

Query: 181 LQDVWKFGADVVIHSCTKYFGGHSDLLSGVVVVKSLEVAKKMKNDRIYLGTNIANLESYL 240
           LQDVWKFGADVVIHSCTKYFGGHSDLLSGVVVVKSLEVAKKMKNDRIYLGTNIANLESYL
Sbjct: 181 LQDVWKFGADVVIHSCTKYFGGHSDLLSGVVVVKSLEVAKKMKNDRIYLGTNIANLESYL 240

Query: 241 LLRSLRTFEMRVRKQSENATALVKYLDDHKSEFNKVLDKIYHSSLQTEDFVKKQLEGGYG 300
           LLRSLRTFEMRVRKQSENATALVKYLDDHKSEFNKVLDKIYHSSLQTEDFVKKQLEGGYG
Sbjct: 241 LLRSLRTFEMRVRKQSENATALVKYLDDHKSEFNKVLDKIYHSSLQTEDFVKKQLEGGYG 300

Query: 301 PVFSIVLKSKVQCKKLPGKLELFQHATSLGGVESLVEWRALTDPYIEQTLIRVSVGCEGV 360
           PVFSIVLKSKVQCKKLPGKLELFQHATSLGGVESLVEWRALTDPYIEQTLIRVSVGCEGV
Sbjct: 301 PVFSIVLKSKVQCKKLPGKLELFQHATSLGGVESLVEWRALTDPYIEQTLIRVSVGCEGV 360

Query: 361 EDLIKDLAGALKQLQDEE 378
           EDLIKDLAGALKQLQDEE
Sbjct: 361 EDLIKDLAGALKQLQDEE 378

>Suva_15.308 Chr15 complement(536926..538062) [1137 bp, 378 aa] {ON}
           YHR112C (REAL)
          Length = 378

 Score =  599 bits (1545), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/376 (72%), Positives = 329/376 (87%)

Query: 1   MVSLPTTLIHADDKDNRVTDIVSPINVATTFRYDNNNLIAWNDRENYDFLETTPVYSRLA 60
           MV L T LIHADDKDNRVTD+  PINV+TTFRYD+++LI W +REN DF+E  PVYSRLA
Sbjct: 1   MVDLSTALIHADDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKRPVYSRLA 60

Query: 61  HPNATRLESIFSEILGGHAVIYSSGLAAYFATLTHYNPKKLFIGQSYHGCHGIADIFTRN 120
           HPN+TRLES+FS+IL G+AV+YSSGLAA+FA + HYNPKK+FIGQSYHG   IA+I TRN
Sbjct: 61  HPNSTRLESVFSDILDGYAVVYSSGLAAFFAAMVHYNPKKIFIGQSYHGVRAIANILTRN 120

Query: 121 NGMKQYPLDRIEELASEGDIVHLETPVNPFGTSYDIEDFARKAHAKGALLVIDSTFAPPP 180
             +KQ+PL+ IE  A+EGDIVHLE+PVNP+GTSYDIE FAR+AHAKGALL++DSTFA PP
Sbjct: 121 YDIKQHPLEDIERYAAEGDIVHLESPVNPYGTSYDIESFARRAHAKGALLILDSTFASPP 180

Query: 181 LQDVWKFGADVVIHSCTKYFGGHSDLLSGVVVVKSLEVAKKMKNDRIYLGTNIANLESYL 240
           LQ  W FGAD+V++S TKYFGGHSDLLSGV+VVK   V++++K+DRIYLGTN+ANLES++
Sbjct: 181 LQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKDEAVSRRLKDDRIYLGTNVANLESFM 240

Query: 241 LLRSLRTFEMRVRKQSENATALVKYLDDHKSEFNKVLDKIYHSSLQTEDFVKKQLEGGYG 300
           LLRSLRT+E+R+ KQSENAT +VK+L DH+SEF+KVL  IYHSSLQTE+FVKKQL GGYG
Sbjct: 241 LLRSLRTYELRINKQSENATKIVKFLSDHQSEFDKVLKTIYHSSLQTEEFVKKQLVGGYG 300

Query: 301 PVFSIVLKSKVQCKKLPGKLELFQHATSLGGVESLVEWRALTDPYIEQTLIRVSVGCEGV 360
           PVF+I L++K QCK  P KL+ F HATSLGG+ESLVEWRA+TDPYI+QTLIRVSVGCE  
Sbjct: 301 PVFAITLRTKEQCKVFPLKLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRVSVGCESA 360

Query: 361 EDLIKDLAGALKQLQD 376
           +DLI+DLA ALK+LQD
Sbjct: 361 DDLIRDLASALKELQD 376

>Skud_8.173 Chr8 complement(308322..309458) [1137 bp, 378 aa] {ON}
           YHR112C (REAL)
          Length = 378

 Score =  598 bits (1543), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/376 (73%), Positives = 327/376 (86%)

Query: 1   MVSLPTTLIHADDKDNRVTDIVSPINVATTFRYDNNNLIAWNDRENYDFLETTPVYSRLA 60
           MV+L T LIH DDKDNRVTD+  PINV+TTFRYD+++LI W +REN DF+E  PVYSRLA
Sbjct: 1   MVNLSTVLIHGDDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKKPVYSRLA 60

Query: 61  HPNATRLESIFSEILGGHAVIYSSGLAAYFATLTHYNPKKLFIGQSYHGCHGIADIFTRN 120
           HPN+TRLES+FSEIL G+AVIYSSGLAA++A + HYNPKK+FIGQSYHG   I +I  RN
Sbjct: 61  HPNSTRLESVFSEILDGYAVIYSSGLAAFYAAMVHYNPKKIFIGQSYHGVRAITNILARN 120

Query: 121 NGMKQYPLDRIEELASEGDIVHLETPVNPFGTSYDIEDFARKAHAKGALLVIDSTFAPPP 180
             +KQYPL+ IE+ ASEGDIVHLE+PVNP+GTSYDIE  A +AH KGALL++DSTFA PP
Sbjct: 121 YDVKQYPLEDIEKYASEGDIVHLESPVNPYGTSYDIESLAHRAHTKGALLIVDSTFASPP 180

Query: 181 LQDVWKFGADVVIHSCTKYFGGHSDLLSGVVVVKSLEVAKKMKNDRIYLGTNIANLESYL 240
           LQ  W FGADVV++S TKYFGGHSDLLSGV+VVK   V++++K+DRIYLGTN+ANLES++
Sbjct: 181 LQYAWNFGADVVLYSATKYFGGHSDLLSGVLVVKDEAVSRQLKDDRIYLGTNVANLESFM 240

Query: 241 LLRSLRTFEMRVRKQSENATALVKYLDDHKSEFNKVLDKIYHSSLQTEDFVKKQLEGGYG 300
           LLRSLRT+EMR+ KQSENAT LVK+L DH+SEF+KVL  IYHSSLQTE+FVKKQL GGYG
Sbjct: 241 LLRSLRTYEMRITKQSENATKLVKFLSDHQSEFDKVLKTIYHSSLQTEEFVKKQLVGGYG 300

Query: 301 PVFSIVLKSKVQCKKLPGKLELFQHATSLGGVESLVEWRALTDPYIEQTLIRVSVGCEGV 360
           PVF+I+L +K QCK+LP KL+ F HATSLGG+ESLVEWRA+TDPYI+QTLIRVSVGCE  
Sbjct: 301 PVFAIILHNKEQCKQLPLKLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRVSVGCESA 360

Query: 361 EDLIKDLAGALKQLQD 376
           EDLIKDL+ ALK+LQD
Sbjct: 361 EDLIKDLSSALKELQD 376

>Smik_8.190 Chr8 complement(310892..312154) [1263 bp, 420 aa] {ON}
           YHR112C (REAL)
          Length = 420

 Score =  600 bits (1547), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/376 (73%), Positives = 328/376 (87%)

Query: 1   MVSLPTTLIHADDKDNRVTDIVSPINVATTFRYDNNNLIAWNDRENYDFLETTPVYSRLA 60
           MV L T+LIH DDKDNRVTD+  PINV+TTFRYD+++L+ W +REN DF+E  P+YSRLA
Sbjct: 43  MVDLSTSLIHGDDKDNRVTDVAPPINVSTTFRYDDDDLVPWTERENLDFMEKKPIYSRLA 102

Query: 61  HPNATRLESIFSEILGGHAVIYSSGLAAYFATLTHYNPKKLFIGQSYHGCHGIADIFTRN 120
           HPN+TRLESIFSEIL G+AVIYSSGLAA++A + HYNPK++FIGQSYHG   IA+I +RN
Sbjct: 103 HPNSTRLESIFSEILDGYAVIYSSGLAAFYAAMVHYNPKRIFIGQSYHGVRAIANILSRN 162

Query: 121 NGMKQYPLDRIEELASEGDIVHLETPVNPFGTSYDIEDFARKAHAKGALLVIDSTFAPPP 180
             +KQYPL+ IE+ ASEGDIVHLETPVNP+GTS DIE  A +AHAKGALL++DSTFA PP
Sbjct: 163 YDIKQYPLEDIEKYASEGDIVHLETPVNPYGTSSDIESLAHRAHAKGALLIVDSTFASPP 222

Query: 181 LQDVWKFGADVVIHSCTKYFGGHSDLLSGVVVVKSLEVAKKMKNDRIYLGTNIANLESYL 240
           LQ VW FGAD+V++S TKYFGGHSDLLSGV+VVK  E ++++K+DRIYLGTN+ANLES++
Sbjct: 223 LQYVWNFGADIVLYSATKYFGGHSDLLSGVLVVKEEETSRQLKDDRIYLGTNVANLESFM 282

Query: 241 LLRSLRTFEMRVRKQSENATALVKYLDDHKSEFNKVLDKIYHSSLQTEDFVKKQLEGGYG 300
           LLRSLRT+EMR+ KQSENAT LVK+L DH+SEF KVL KIYHSSLQ E+FVKKQL GGYG
Sbjct: 283 LLRSLRTYEMRITKQSENATKLVKFLSDHQSEFGKVLKKIYHSSLQREEFVKKQLVGGYG 342

Query: 301 PVFSIVLKSKVQCKKLPGKLELFQHATSLGGVESLVEWRALTDPYIEQTLIRVSVGCEGV 360
           PVF+I L++K QCK+LP KL+ F HATSLGG+ESLVEWRA+TDPYI+QTLIRVSVGCE  
Sbjct: 343 PVFAITLQTKEQCKQLPLKLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRVSVGCESA 402

Query: 361 EDLIKDLAGALKQLQD 376
            DLIKDLA ALK+LQD
Sbjct: 403 NDLIKDLASALKELQD 418

>YHR112C Chr8 complement(334527..335663) [1137 bp, 378 aa] {ON}
           Protein of unknown function; localizes to the cytoplasm
           and nucleus; overexpression affects protein trafficking
           through the endocytic pathway
          Length = 378

 Score =  597 bits (1540), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/376 (73%), Positives = 327/376 (86%)

Query: 1   MVSLPTTLIHADDKDNRVTDIVSPINVATTFRYDNNNLIAWNDRENYDFLETTPVYSRLA 60
           MV L T LIH DDKDNRVTD+  PINV+TTFRYD+++LI W +REN DF+E  PVYSRLA
Sbjct: 1   MVDLSTALIHGDDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKKPVYSRLA 60

Query: 61  HPNATRLESIFSEILGGHAVIYSSGLAAYFATLTHYNPKKLFIGQSYHGCHGIADIFTRN 120
           HPN+TRLESIFSEIL G+AVIYSSGLAA++A + HYNPKK+FIGQSYHG   IA+I TRN
Sbjct: 61  HPNSTRLESIFSEILDGYAVIYSSGLAAFYAAMVHYNPKKIFIGQSYHGVRAIANILTRN 120

Query: 121 NGMKQYPLDRIEELASEGDIVHLETPVNPFGTSYDIEDFARKAHAKGALLVIDSTFAPPP 180
            G++Q+PL+ IE+ ASEGDIVHLE+PVNP+GTS DIE  AR+AHAKGALL++DSTFA PP
Sbjct: 121 YGIEQHPLEDIEKCASEGDIVHLESPVNPYGTSSDIESLARRAHAKGALLIVDSTFASPP 180

Query: 181 LQDVWKFGADVVIHSCTKYFGGHSDLLSGVVVVKSLEVAKKMKNDRIYLGTNIANLESYL 240
           LQ  W FGAD+V++S TKYFGGHSDLLSGV+VVK    ++++K+DRIYLGTN+ANLES++
Sbjct: 181 LQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKEEATSRQLKDDRIYLGTNVANLESFM 240

Query: 241 LLRSLRTFEMRVRKQSENATALVKYLDDHKSEFNKVLDKIYHSSLQTEDFVKKQLEGGYG 300
           LLRSLRT+EMR+ KQSENAT LV++L DH+SEF+KVL  IYHSSLQTE+FVKKQL GGYG
Sbjct: 241 LLRSLRTYEMRITKQSENATKLVRFLSDHQSEFDKVLKTIYHSSLQTEEFVKKQLVGGYG 300

Query: 301 PVFSIVLKSKVQCKKLPGKLELFQHATSLGGVESLVEWRALTDPYIEQTLIRVSVGCEGV 360
           PVF+I L +K QCK+LP KL+ F HATSLGG+ESLVEWRA+TDPYI+QTLIRVSVGCE  
Sbjct: 301 PVFAITLYTKEQCKQLPLKLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRVSVGCESA 360

Query: 361 EDLIKDLAGALKQLQD 376
            DLIKDLA ALK+LQD
Sbjct: 361 NDLIKDLASALKELQD 376

>NCAS0F03290 Chr6 complement(667618..668832) [1215 bp, 404 aa] {ON}
           Anc_5.423 YHR112C
          Length = 404

 Score =  593 bits (1529), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 269/375 (71%), Positives = 327/375 (87%)

Query: 2   VSLPTTLIHADDKDNRVTDIVSPINVATTFRYDNNNLIAWNDRENYDFLETTPVYSRLAH 61
           + L TTLIH DDKDNRV+D+  PINV TTFRYD N+LI W++REN DF++ TP+YSRL H
Sbjct: 28  IHLSTTLIHGDDKDNRVSDVAPPINVTTTFRYDPNDLIPWSERENLDFMDKTPIYSRLGH 87

Query: 62  PNATRLESIFSEILGGHAVIYSSGLAAYFATLTHYNPKKLFIGQSYHGCHGIADIFTRNN 121
           PN+TRLESIFSE+L GHAVIYSSG++A+FA + HYNPK+LF+GQSYHGC  IA+I TRN 
Sbjct: 88  PNSTRLESIFSEVLNGHAVIYSSGVSAFFAAMVHYNPKRLFMGQSYHGCRAIANILTRNY 147

Query: 122 GMKQYPLDRIEELASEGDIVHLETPVNPFGTSYDIEDFARKAHAKGALLVIDSTFAPPPL 181
            ++Q+PL+ IE+ A +GDIVHLETPVNP+GTS DI +FAR+AHAKGALL +DSTFAPPPL
Sbjct: 148 NVEQHPLEDIEKYAQKGDIVHLETPVNPYGTSLDISEFARRAHAKGALLCVDSTFAPPPL 207

Query: 182 QDVWKFGADVVIHSCTKYFGGHSDLLSGVVVVKSLEVAKKMKNDRIYLGTNIANLESYLL 241
           QDVW+F AD+V+HS TKYFGGHSDLLSGV+VVK  +VA+++++DRIYLGTN+ANLESYLL
Sbjct: 208 QDVWEFDADIVMHSATKYFGGHSDLLSGVLVVKDEDVARQLRDDRIYLGTNVANLESYLL 267

Query: 242 LRSLRTFEMRVRKQSENATALVKYLDDHKSEFNKVLDKIYHSSLQTEDFVKKQLEGGYGP 301
           LRSLRTF+MR+ +QSENAT +VK+L+D+K +F  VLDKIYHSSLQTE FVKKQL+GGY P
Sbjct: 268 LRSLRTFKMRIERQSENATKVVKFLNDNKGKFGNVLDKIYHSSLQTEPFVKKQLKGGYDP 327

Query: 302 VFSIVLKSKVQCKKLPGKLELFQHATSLGGVESLVEWRALTDPYIEQTLIRVSVGCEGVE 361
           VFSI LK+K QCKK P  L+ F HATSLGG+ESLVEWRA+TDPYI+QTLIR+S+GCE  +
Sbjct: 328 VFSITLKNKEQCKKFPLLLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRISIGCEDAD 387

Query: 362 DLIKDLAGALKQLQD 376
           DLI DL+ AL +LQD
Sbjct: 388 DLINDLSAALNKLQD 402

>NDAI0B05590 Chr2 complement(1367293..1368435) [1143 bp, 380 aa]
           {ON} Anc_5.423
          Length = 380

 Score =  586 bits (1511), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 268/377 (71%), Positives = 319/377 (84%)

Query: 1   MVSLPTTLIHADDKDNRVTDIVSPINVATTFRYDNNNLIAWNDRENYDFLETTPVYSRLA 60
           M  L T LIH+DDKDNRV+D+  PINV TTFRYDN++L+ W +REN DF+E TP+YSRLA
Sbjct: 1   MAHLSTALIHSDDKDNRVSDVAPPINVTTTFRYDNDDLVPWTERENLDFMEKTPIYSRLA 60

Query: 61  HPNATRLESIFSEILGGHAVIYSSGLAAYFATLTHYNPKKLFIGQSYHGCHGIADIFTRN 120
           HPN+TRLESIFSEIL GHAVIYSSGLAA+FA + HYNPK++FIGQSYHG   IA+I TRN
Sbjct: 61  HPNSTRLESIFSEILDGHAVIYSSGLAAFFAAMIHYNPKRIFIGQSYHGVRAIANILTRN 120

Query: 121 NGMKQYPLDRIEELASEGDIVHLETPVNPFGTSYDIEDFARKAHAKGALLVIDSTFAPPP 180
              KQ+ LD IE+ A  GDIVHLETPVNPFGTS D+EDFA+KAH KGALL++DSTFAPPP
Sbjct: 121 FQTKQHTLDEIEQFAQPGDIVHLETPVNPFGTSLDLEDFAKKAHEKGALLLVDSTFAPPP 180

Query: 181 LQDVWKFGADVVIHSCTKYFGGHSDLLSGVVVVKSLEVAKKMKNDRIYLGTNIANLESYL 240
           LQ+VW F  D+++HS TKYFGGHSDLLSGV+VVK   VA+++++DRIYLGTN+ANLES++
Sbjct: 181 LQNVWDFNVDIIMHSATKYFGGHSDLLSGVLVVKEEAVARQLRDDRIYLGTNVANLESFM 240

Query: 241 LLRSLRTFEMRVRKQSENATALVKYLDDHKSEFNKVLDKIYHSSLQTEDFVKKQLEGGYG 300
           LLRSLRTFEMR+ KQSENAT +V +LD ++ +++KVL  I HSSLQ E FVKKQL+GGYG
Sbjct: 241 LLRSLRTFEMRMLKQSENATKIVSFLDSNRDKYDKVLKSITHSSLQKESFVKKQLKGGYG 300

Query: 301 PVFSIVLKSKVQCKKLPGKLELFQHATSLGGVESLVEWRALTDPYIEQTLIRVSVGCEGV 360
           PVFSI L +K QCKK P  L+ F HATSLGG+ESLVEWRA+TDPYIEQTLIRVS+GCE  
Sbjct: 301 PVFSISLMNKEQCKKFPPMLKYFHHATSLGGIESLVEWRAMTDPYIEQTLIRVSIGCENA 360

Query: 361 EDLIKDLAGALKQLQDE 377
           +DLI+DLA AL+ LQ E
Sbjct: 361 DDLIQDLANALETLQKE 377

>CAGL0I01276g Chr9 complement(104391..105533) [1143 bp, 380 aa] {ON}
           highly similar to uniprot|P38716 Saccharomyces
           cerevisiae YHR112c
          Length = 380

 Score =  560 bits (1442), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 257/372 (69%), Positives = 314/372 (84%)

Query: 4   LPTTLIHADDKDNRVTDIVSPINVATTFRYDNNNLIAWNDRENYDFLETTPVYSRLAHPN 63
           L TTLIH DD  NRV D+  PINVATTFRYD N+L+ WN+RE+ +F++ TP+YSRL HPN
Sbjct: 6   LATTLIHGDDIKNRVPDVAPPINVATTFRYDENDLVPWNEREDLEFMDRTPIYSRLGHPN 65

Query: 64  ATRLESIFSEILGGHAVIYSSGLAAYFATLTHYNPKKLFIGQSYHGCHGIADIFTRNNGM 123
           ATRLESIFSEIL GHAVIYSSGLAA+ A +TH+NPK+LFIGQSYHG HGIADI +RN G+
Sbjct: 66  ATRLESIFSEILEGHAVIYSSGLAAFHAAMTHFNPKQLFIGQSYHGVHGIADILSRNYGL 125

Query: 124 KQYPLDRIEELASEGDIVHLETPVNPFGTSYDIEDFARKAHAKGALLVIDSTFAPPPLQD 183
            Q  LD IEE A +GDIVH+ETPVNPFGTSYD++ FA KAH++GALL++DSTFAPPPLQ 
Sbjct: 126 IQRSLDDIEEYAQKGDIVHIETPVNPFGTSYDLQSFADKAHSRGALLMVDSTFAPPPLQY 185

Query: 184 VWKFGADVVIHSCTKYFGGHSDLLSGVVVVKSLEVAKKMKNDRIYLGTNIANLESYLLLR 243
            W FGAD+++HS TK+FGGHSDLLSGV+V K  EV+K++K+DRIYLGTN+ANLES+LLLR
Sbjct: 186 AWNFGADIIMHSATKFFGGHSDLLSGVLVTKDEEVSKRLKDDRIYLGTNVANLESHLLLR 245

Query: 244 SLRTFEMRVRKQSENATALVKYLDDHKSEFNKVLDKIYHSSLQTEDFVKKQLEGGYGPVF 303
           SLRTFEMR+ KQS+N T +V++L  ++ +++KVL +++HSSLQ E FVKKQL GGY PVF
Sbjct: 246 SLRTFEMRILKQSQNVTKIVEHLVSNRDKYSKVLRQVFHSSLQDESFVKKQLIGGYTPVF 305

Query: 304 SIVLKSKVQCKKLPGKLELFQHATSLGGVESLVEWRALTDPYIEQTLIRVSVGCEGVEDL 363
           SI L +K QCK+LP KL+ F HATSLGGVESL+EWRA+TDPYI+QTLIR S+GCE  +DL
Sbjct: 306 SITLMNKEQCKQLPLKLKYFHHATSLGGVESLIEWRAMTDPYIDQTLIRFSIGCESADDL 365

Query: 364 IKDLAGALKQLQ 375
           I DL  A  +L+
Sbjct: 366 IADLDAAFIELE 377

>KAFR0E03860 Chr5 complement(766029..767165) [1137 bp, 378 aa] {ON}
           Anc_5.423 YHR112C
          Length = 378

 Score =  556 bits (1434), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 257/376 (68%), Positives = 315/376 (83%)

Query: 1   MVSLPTTLIHADDKDNRVTDIVSPINVATTFRYDNNNLIAWNDRENYDFLETTPVYSRLA 60
           M  L T+LIHADDKDNRV+D+  PINV+TT+RYD  +LI W +REN DF+E  PVYSRLA
Sbjct: 1   MTHLGTSLIHADDKDNRVSDVAPPINVSTTYRYDETDLIPWRERENLDFMEKKPVYSRLA 60

Query: 61  HPNATRLESIFSEILGGHAVIYSSGLAAYFATLTHYNPKKLFIGQSYHGCHGIADIFTRN 120
           HPNATRLES+FSEIL GHAVIYSSG AA++A + HYNPKK+F+GQ YHG   IA+I TRN
Sbjct: 61  HPNATRLESLFSEILEGHAVIYSSGCAAFYAAMVHYNPKKIFMGQCYHGLRAIANIMTRN 120

Query: 121 NGMKQYPLDRIEELASEGDIVHLETPVNPFGTSYDIEDFARKAHAKGALLVIDSTFAPPP 180
            G++QY LD IE+ A EGDIV +E+P+NP+GTS DI+  A KAH+KGA++++DSTFAPPP
Sbjct: 121 YGVEQYTLDDIEKYAQEGDIVEVESPMNPYGTSIDIKSIAEKAHSKGAIVLVDSTFAPPP 180

Query: 181 LQDVWKFGADVVIHSCTKYFGGHSDLLSGVVVVKSLEVAKKMKNDRIYLGTNIANLESYL 240
           LQ  W  GADVV+HS TKYFGGHSDLLSGV+VVK  EV KK+++DRIYLGTN+ NLESY+
Sbjct: 181 LQYAWDLGADVVLHSATKYFGGHSDLLSGVIVVKDEEVCKKLRDDRIYLGTNVGNLESYM 240

Query: 241 LLRSLRTFEMRVRKQSENATALVKYLDDHKSEFNKVLDKIYHSSLQTEDFVKKQLEGGYG 300
           LLRSLR++E+R+ KQSENAT +V++L+ +K  F+KVL ++YHSSLQ E FVKKQL GGYG
Sbjct: 241 LLRSLRSYELRILKQSENATKVVEFLNLNKERFDKVLKEVYHSSLQKEAFVKKQLVGGYG 300

Query: 301 PVFSIVLKSKVQCKKLPGKLELFQHATSLGGVESLVEWRALTDPYIEQTLIRVSVGCEGV 360
           PVFS+ L++  QCKK PGKL+ F HATSLGGVESLVEWRA+TDPYI+QTLIRVS+G E  
Sbjct: 301 PVFSMSLQTIDQCKKFPGKLKYFHHATSLGGVESLVEWRAMTDPYIDQTLIRVSIGVENA 360

Query: 361 EDLIKDLAGALKQLQD 376
           +DLIKDL  AL++L +
Sbjct: 361 DDLIKDLETALQELHN 376

>Kpol_1031.23 s1031 complement(55637..56776) [1140 bp, 379 aa] {ON}
           complement(55637..56776) [1140 nt, 380 aa]
          Length = 379

 Score =  554 bits (1428), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 260/377 (68%), Positives = 310/377 (82%)

Query: 1   MVSLPTTLIHADDKDNRVTDIVSPINVATTFRYDNNNLIAWNDRENYDFLETTPVYSRLA 60
           MV L T LIHADDK+NRVTD+  PINV TTFRY+  +LI   +RE+  FL+  PVYSR  
Sbjct: 1   MVELSTLLIHADDKNNRVTDVAPPINVTTTFRYEEQDLIPIIEREDMSFLDERPVYSREG 60

Query: 61  HPNATRLESIFSEILGGHAVIYSSGLAAYFATLTHYNPKKLFIGQSYHGCHGIADIFTRN 120
           HPN TRLE++FSE LGGHAVIYSSGL+AYFA +  +NPK++F+ Q+YHGC  IA++F RN
Sbjct: 61  HPNGTRLETLFSEYLGGHAVIYSSGLSAYFAAIMSFNPKRIFMSQNYHGCIAIAEMFQRN 120

Query: 121 NGMKQYPLDRIEELASEGDIVHLETPVNPFGTSYDIEDFARKAHAKGALLVIDSTFAPPP 180
             +K+Y LD IE+ A +GDIVHLE+PVNPFGTSYDIE FA++AHAKGALL++D TFAPPP
Sbjct: 121 GMVKKYTLDEIEQYAEKGDIVHLESPVNPFGTSYDIEAFAKRAHAKGALLLVDGTFAPPP 180

Query: 181 LQDVWKFGADVVIHSCTKYFGGHSDLLSGVVVVKSLEVAKKMKNDRIYLGTNIANLESYL 240
           LQ+VW FGAD+V+HS TKYFGGHSDLL GV+VVK  +  + +K DRI LGTNIANLESYL
Sbjct: 181 LQNVWDFGADIVMHSATKYFGGHSDLLGGVLVVKDKKRQELLKEDRINLGTNIANLESYL 240

Query: 241 LLRSLRTFEMRVRKQSENATALVKYLDDHKSEFNKVLDKIYHSSLQTEDFVKKQLEGGYG 300
           LLRSLRTFEMR+ KQSEN T +VKYLD++K ++ KVL  I HSSLQ EDFVKKQL+GGY 
Sbjct: 241 LLRSLRTFEMRIMKQSENVTKIVKYLDENKGKYGKVLRDITHSSLQKEDFVKKQLKGGYN 300

Query: 301 PVFSIVLKSKVQCKKLPGKLELFQHATSLGGVESLVEWRALTDPYIEQTLIRVSVGCEGV 360
           PVFSI L +  QCK    +L+ FQHATSLGGVESLVEWRAL+DP+I+QTL+RVSVGCE  
Sbjct: 301 PVFSITLNTVEQCKSFASQLKYFQHATSLGGVESLVEWRALSDPHIDQTLVRVSVGCESA 360

Query: 361 EDLIKDLAGALKQLQDE 377
           +DLIKDLA AL+ LQDE
Sbjct: 361 DDLIKDLASALQNLQDE 377

>KLLA0E21319g Chr5 (1904841..1905983) [1143 bp, 380 aa] {ON} highly
           similar to uniprot|P38716 Saccharomyces cerevisiae
           YHR112C Hypothetical ORF
          Length = 380

 Score =  548 bits (1412), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 259/376 (68%), Positives = 312/376 (82%), Gaps = 2/376 (0%)

Query: 2   VSLPTTLIHADDKDNRVTDIVSPINVATTFRYDNNNLIAWNDRENYDFLETTPVYSRLAH 61
           +SL T L+HADDK NRVTDIVSPINVATTFRY+  +LI WN+RE++  LE  P+YSRLAH
Sbjct: 1   MSLSTELVHADDKHNRVTDIVSPINVATTFRYEEVDLIPWNEREDFSVLEKKPIYSRLAH 60

Query: 62  PNATRLESIFSEILGGHAVIYSSGLAAYFATLTHYNPKKLFIGQSYHGCHGIADIFTRNN 121
           PN+ R+ES+ S++L G AV+Y++GLAAYFA LT+YNPK+LFIG+ YHGC  IADI TRN 
Sbjct: 61  PNSLRVESVLSKVLEGEAVVYANGLAAYFAMLTYYNPKRLFIGEGYHGCRSIADIHTRNW 120

Query: 122 GMKQYPL--DRIEELASEGDIVHLETPVNPFGTSYDIEDFARKAHAKGALLVIDSTFAPP 179
            ++Q+ L  D I + A +GD+VH+ETPVNP+GTS+DI+ FA   H+KGA+LVIDSTFAPP
Sbjct: 121 NLEQHKLEIDEILQHAGKGDVVHIETPVNPYGTSFDIKAFADATHSKGAILVIDSTFAPP 180

Query: 180 PLQDVWKFGADVVIHSCTKYFGGHSDLLSGVVVVKSLEVAKKMKNDRIYLGTNIANLESY 239
           PLQ+ W FG DV++HS TKYFGGHSDLL+GV+ VK  EVA K++ DRIYLGTNIANLE++
Sbjct: 181 PLQNPWDFGVDVILHSATKYFGGHSDLLAGVLAVKDKEVASKLRTDRIYLGTNIANLEAF 240

Query: 240 LLLRSLRTFEMRVRKQSENATALVKYLDDHKSEFNKVLDKIYHSSLQTEDFVKKQLEGGY 299
           LLLRSLRTFEMR++ QSENAT LV YL +HKS+F  VL+ ++HSSLQTE FVK+QL+GGY
Sbjct: 241 LLLRSLRTFEMRIQTQSENATKLVSYLIEHKSDFEGVLEGVFHSSLQTEPFVKEQLKGGY 300

Query: 300 GPVFSIVLKSKVQCKKLPGKLELFQHATSLGGVESLVEWRALTDPYIEQTLIRVSVGCEG 359
           GPVF++ L SK QC+K P  L  FQHATSLGGVESLVEWRALTDPYI  TLIRVSVG E 
Sbjct: 301 GPVFAVTLNSKEQCRKFPQLLTCFQHATSLGGVESLVEWRALTDPYIIPTLIRVSVGVEN 360

Query: 360 VEDLIKDLAGALKQLQ 375
           V+DLIKD A ALK LQ
Sbjct: 361 VDDLIKDFANALKTLQ 376

>TBLA0A03680 Chr1 complement(919740..920894) [1155 bp, 384 aa] {ON}
           Anc_5.423 YHR112C
          Length = 384

 Score =  544 bits (1401), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 251/372 (67%), Positives = 310/372 (83%)

Query: 4   LPTTLIHADDKDNRVTDIVSPINVATTFRYDNNNLIAWNDRENYDFLETTPVYSRLAHPN 63
           L T LIH DD +NRVTD+  PIN+ATTFRYDN +LI WN+R +  F+ET P+YSRLAHPN
Sbjct: 9   LETLLIHGDDVNNRVTDVAPPINIATTFRYDNEDLIPWNERGDLSFMETKPIYSRLAHPN 68

Query: 64  ATRLESIFSEILGGHAVIYSSGLAAYFATLTHYNPKKLFIGQSYHGCHGIADIFTRNNGM 123
           ++RLE++FS+IL G+AVIY+SG++A+FA +T++NPK++F+GQ+YHGC    +I  RN  +
Sbjct: 69  SSRLETLFSKILDGNAVIYNSGVSAFFAAMTYFNPKRVFLGQNYHGCTAAVNILERNGTL 128

Query: 124 KQYPLDRIEELASEGDIVHLETPVNPFGTSYDIEDFARKAHAKGALLVIDSTFAPPPLQD 183
           K++    IEE A +GDIVHLE+PVNP+GTSYDIE+F +KAH+KG L++IDSTFAPPPLQ 
Sbjct: 129 KKHTHKEIEEFAQKGDIVHLESPVNPYGTSYDIEEFVKKAHSKGVLVMIDSTFAPPPLQY 188

Query: 184 VWKFGADVVIHSCTKYFGGHSDLLSGVVVVKSLEVAKKMKNDRIYLGTNIANLESYLLLR 243
           VW F  D+V+HS TK+FGGHSDLLSGV+VVK   +AK ++ DRIYLGTNIANLESYLLLR
Sbjct: 189 VWDFDVDIVMHSATKFFGGHSDLLSGVLVVKDENIAKDLREDRIYLGTNIANLESYLLLR 248

Query: 244 SLRTFEMRVRKQSENATALVKYLDDHKSEFNKVLDKIYHSSLQTEDFVKKQLEGGYGPVF 303
           SLRTFEMR+ KQS +AT +VK+L+D++ +FNKVL +IYHSSLQ EDFVKKQL+GGY PVF
Sbjct: 249 SLRTFEMRILKQSTSATQIVKFLNDNRHKFNKVLKEIYHSSLQKEDFVKKQLKGGYTPVF 308

Query: 304 SIVLKSKVQCKKLPGKLELFQHATSLGGVESLVEWRALTDPYIEQTLIRVSVGCEGVEDL 363
           SIVL +K QCK LP  L+ F HATSLGGVESL+EWRALTDPYI QTLIRVSVGCE  +DL
Sbjct: 309 SIVLHNKEQCKALPNLLKYFIHATSLGGVESLIEWRALTDPYIIQTLIRVSVGCENTQDL 368

Query: 364 IKDLAGALKQLQ 375
           I DL  AL  +Q
Sbjct: 369 INDLDQALTVIQ 380

>KNAG0C04990 Chr3 (960378..961520) [1143 bp, 380 aa] {ON} Anc_5.423
           YHR112C
          Length = 380

 Score =  535 bits (1379), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 244/379 (64%), Positives = 308/379 (81%), Gaps = 2/379 (0%)

Query: 1   MVSLPTTLIHADDKDNRVTDIVSPINVATTFRYDNNNLIAWNDRENYDFLETTPVYSRLA 60
           M  L TTLIHADD+DNRV D+  PINV+TT+RYD ++L+ W DRE+ +F++  P+YSRLA
Sbjct: 1   MEHLATTLIHADDRDNRVPDVAPPINVSTTYRYDKDDLVPWRDRESLEFMDKRPIYSRLA 60

Query: 61  HPNATRLESIFSEILGGHAVIYSSGLAAYFATLTHYNPKKLFIGQSYHGCHGIADIFTRN 120
           HPN+TRLES+FS+ILGGHAV+Y+SGLAA+FA L HYNPK+LFI QSYHGC  IA I TR 
Sbjct: 61  HPNSTRLESLFSQILGGHAVVYNSGLAAFFAALIHYNPKRLFIDQSYHGCRAIAHILTRT 120

Query: 121 NGMKQYPLDRIEELASEGDIVHLETPVNPFGT-SYDIEDFARKAHAKGALLVIDSTFAPP 179
            GM+Q  LD + ++A  GD+VHLE+PVNP GT   D+   A +AH +GA+L++DSTFAPP
Sbjct: 121 TGMQQCSLDDVPQMAQPGDVVHLESPVNPLGTVPRDMSLLAEQAHERGAVLIVDSTFAPP 180

Query: 180 PLQDVWKFGADVVIHSCTKYFGGHSDLLSGVVVVKSLEVAKKMKNDRIYLGTNIANLESY 239
           PLQD W+FG D+V+HS TKYFGGHSDLLSGV+V +  + A  +++DRIYLGTN+ANLE+Y
Sbjct: 181 PLQDPWRFGCDMVMHSATKYFGGHSDLLSGVLVTRDQQTAGALRDDRIYLGTNVANLEAY 240

Query: 240 LLLRSLRTFEMRVRKQSENATALVKYLDDHKSEFNKVLDKIYHSSLQT-EDFVKKQLEGG 298
           LLLRSLRTFE+R+++QS N TA+V YL+DH+ ++  VLDK+YHSSLQT E +V +QLEGG
Sbjct: 241 LLLRSLRTFELRIQRQSTNCTAVVAYLNDHRGDWPLVLDKLYHSSLQTGEPWVAEQLEGG 300

Query: 299 YGPVFSIVLKSKVQCKKLPGKLELFQHATSLGGVESLVEWRALTDPYIEQTLIRVSVGCE 358
           + PVF++ L+S  QCK+ P  L  FQHATSLGGVESLVEWRA+TDP+I+QTL+RVSVGCE
Sbjct: 301 HPPVFALTLRSIDQCKRFPQLLHYFQHATSLGGVESLVEWRAMTDPHIDQTLVRVSVGCE 360

Query: 359 GVEDLIKDLAGALKQLQDE 377
             EDLI DL  AL  LQ +
Sbjct: 361 NAEDLIADLTTALNALQSD 379

>ZYRO0F09768g Chr6 complement(793824..794945) [1122 bp, 373 aa] {ON}
           highly similar to uniprot|P38716 Saccharomyces
           cerevisiae YHR112C Hypothetical ORF
          Length = 373

 Score =  520 bits (1340), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 239/374 (63%), Positives = 297/374 (79%), Gaps = 1/374 (0%)

Query: 1   MVSLPTTLIHADDKDNRVTDIVSPINVATTFRYDNNNLIAWNDRENYDFLETTPVYSRLA 60
           MV L T L+H DD+ NRVTD+  PINVA+TFRYDN+NLI W D+ N DFL+  PVYSR  
Sbjct: 1   MVDLETLLLHGDDEHNRVTDVAPPINVASTFRYDNDNLIPWRDQPNLDFLDENPVYSREG 60

Query: 61  HPNATRLESIFSEILGGHAVIYSSGLAAYFATLTHYNPKKLFIGQSYHGCHGIADIFTRN 120
           HPN  RLE++FS  LGGHA+ YS GL  +   + H+NPK++F+ Q YHG  GI  I  RN
Sbjct: 61  HPNGVRLEALFSRFLGGHAICYSCGLGGFLGVMVHFNPKRVFMDQCYHGVQGIVGILKRN 120

Query: 121 NGMKQYPLDRIEELASEGDIVHLETPVNPFGTSYDIEDFARKAHAKGALLVIDSTFAPPP 180
            G+++Y L  IE+ A +GDIVH+ETP+NPFGTS DI + AR+AH+KGALL++DSTFAPPP
Sbjct: 121 YGVERYGLADIEKHAQKGDIVHVETPINPFGTSLDISELARRAHSKGALLMVDSTFAPPP 180

Query: 181 LQDVWKFGADVVIHSCTKYFGGHSDLLSGVVVVKSLEVAKKMKNDRIYLGTNIANLESYL 240
           LQ+ W FGAD+++HS TKYF GHSDLLSGV+VVK  EVA K+K DRIYLG+NIANLESYL
Sbjct: 181 LQNAWDFGADMIMHSATKYFAGHSDLLSGVLVVKDKEVASKLKEDRIYLGSNIANLESYL 240

Query: 241 LLRSLRTFEMRVRKQSENATALVKYLDDHKSEFNKVLDKIYHSSLQTEDFVKKQLEGGYG 300
           LLRSLRT+++R+R+Q+ENAT +VKYL+DHK ++   L ++YHSSLQTE+FVKKQL GGY 
Sbjct: 241 LLRSLRTYDLRIRRQAENATKVVKYLNDHKDKY-PALVELYHSSLQTEEFVKKQLSGGYT 299

Query: 301 PVFSIVLKSKVQCKKLPGKLELFQHATSLGGVESLVEWRALTDPYIEQTLIRVSVGCEGV 360
           PVFS+  K++ QCKK    L+LFQHATSLGGVESLVEWRA+ D  I+Q L+RVS+GCE  
Sbjct: 300 PVFSLTFKTEEQCKKFCSSLKLFQHATSLGGVESLVEWRAMCDSDIDQCLVRVSIGCESA 359

Query: 361 EDLIKDLAGALKQL 374
           +DLI DL+  L QL
Sbjct: 360 DDLINDLSTVLSQL 373

>ZYRO0F15664g Chr6 (1286078..1287199) [1122 bp, 373 aa] {ON} highly
           similar to uniprot|P38716 Saccharomyces cerevisiae
           YHR112C Hypothetical ORF
          Length = 373

 Score =  519 bits (1337), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 238/374 (63%), Positives = 297/374 (79%), Gaps = 1/374 (0%)

Query: 1   MVSLPTTLIHADDKDNRVTDIVSPINVATTFRYDNNNLIAWNDRENYDFLETTPVYSRLA 60
           MV L T L+H DD+ NRVTD+  PINVA+TFRYDN+NL+ W D  N D L+  PVYSR  
Sbjct: 1   MVDLATLLLHGDDEHNRVTDVAPPINVASTFRYDNDNLVPWRDITNLDCLDEYPVYSREG 60

Query: 61  HPNATRLESIFSEILGGHAVIYSSGLAAYFATLTHYNPKKLFIGQSYHGCHGIADIFTRN 120
           HPN  RLE++FS  LGGHAV YS GL  + + + H+NPK++F+ Q YHG  GI  I  RN
Sbjct: 61  HPNGVRLEALFSRFLGGHAVCYSCGLGGFLSAMVHFNPKRVFMDQCYHGVQGIVGIMKRN 120

Query: 121 NGMKQYPLDRIEELASEGDIVHLETPVNPFGTSYDIEDFARKAHAKGALLVIDSTFAPPP 180
            G+++Y L  IE+ A +GDIVH+ETP+NPFGTS DI + AR+AHAKGALL++DSTFAPPP
Sbjct: 121 YGVERYGLADIEKHAQKGDIVHVETPINPFGTSLDISELARRAHAKGALLMVDSTFAPPP 180

Query: 181 LQDVWKFGADVVIHSCTKYFGGHSDLLSGVVVVKSLEVAKKMKNDRIYLGTNIANLESYL 240
           LQ+ W FGAD+++HS TKYFGGHSDLLSGV+VVK  E A K+K DRI LG+NI+NL+SYL
Sbjct: 181 LQNAWDFGADMIMHSATKYFGGHSDLLSGVLVVKDKETASKLKEDRICLGSNISNLDSYL 240

Query: 241 LLRSLRTFEMRVRKQSENATALVKYLDDHKSEFNKVLDKIYHSSLQTEDFVKKQLEGGYG 300
           LLRSLRT+++R+++QSE+AT +V+YL+DHK++F   LDK+YHSSLQ++DFVKKQL GGYG
Sbjct: 241 LLRSLRTYDLRIKRQSESATKIVQYLNDHKNDF-PALDKLYHSSLQSDDFVKKQLSGGYG 299

Query: 301 PVFSIVLKSKVQCKKLPGKLELFQHATSLGGVESLVEWRALTDPYIEQTLIRVSVGCEGV 360
           PVFS+ LK++ QCKK    L+LFQHATSLGGVESLVEWRA+ D  I+Q L+RVS+GCE  
Sbjct: 300 PVFSLTLKTEEQCKKFCSSLKLFQHATSLGGVESLVEWRAMCDSDIDQCLVRVSIGCESA 359

Query: 361 EDLIKDLAGALKQL 374
           EDL  DL   L QL
Sbjct: 360 EDLTNDLTTVLSQL 373

>TBLA0B03020 Chr2 complement(700483..701622) [1140 bp, 379 aa] {ON} 
          Length = 379

 Score =  509 bits (1311), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 239/374 (63%), Positives = 298/374 (79%), Gaps = 5/374 (1%)

Query: 1   MVSLPTTLIHADDKDNRVTDIVSPINVATTFRYDNNNLIAWNDRENYDFL---ETTPVYS 57
           MV L TTLIH+DDK+NRVTD+  PINV++TFRYDNNNLI  N+ +  DFL   E +PVYS
Sbjct: 1   MVHLATTLIHSDDKNNRVTDVAPPINVSSTFRYDNNNLIPANEVD--DFLASIEQSPVYS 58

Query: 58  RLAHPNATRLESIFSEILGGHAVIYSSGLAAYFATLTHYNPKKLFIGQSYHGCHGIADIF 117
           R +HPN++R++SI S++LGGHAVIY+SG +A+ A + HYNPK+ F+   Y G H IAD+ 
Sbjct: 59  RESHPNSSRVQSILSDLLGGHAVIYNSGCSAFHAVMCHYNPKRFFMDGGYFGVHAIADLI 118

Query: 118 TRNNGMKQYPLDRIEELASEGDIVHLETPVNPFGTSYDIEDFARKAHAKGALLVIDSTFA 177
           TRN G++Q+ LD IEE A  GD+VHLE+P+NPFGT+ DI+  A + H+KGA+L IDST A
Sbjct: 119 TRNYGLEQHSLDEIEEFAQPGDLVHLESPLNPFGTASDIKALADRVHSKGAILSIDSTLA 178

Query: 178 PPPLQDVWKFGADVVIHSCTKYFGGHSDLLSGVVVVKSLEVAKKMKNDRIYLGTNIANLE 237
           PPPLQ+VW FGAD+V+HS TKYFGGHSDLL+GV+ VK+ E A ++  DRI+LGTNI NLE
Sbjct: 179 PPPLQNVWNFGADIVLHSATKYFGGHSDLLAGVLAVKTKEQANELIEDRIHLGTNIGNLE 238

Query: 238 SYLLLRSLRTFEMRVRKQSENATALVKYLDDHKSEFNKVLDKIYHSSLQTEDFVKKQLEG 297
           SYLLLRSLRT+EMR+ KQS+NAT +VKYL +HK      L +I+H+SLQ E F+ KQL G
Sbjct: 239 SYLLLRSLRTYEMRIMKQSDNATKIVKYLHNHKESLKGSLKEIFHTSLQNESFINKQLSG 298

Query: 298 GYGPVFSIVLKSKVQCKKLPGKLELFQHATSLGGVESLVEWRALTDPYIEQTLIRVSVGC 357
           G+G VFSI+L S  QCKKLP  L+ FQHATSLGG+ESL+EWRA++D  I+Q LIRVSVGC
Sbjct: 299 GHGAVFSIILNSINQCKKLPLHLKYFQHATSLGGIESLIEWRAMSDDKIDQCLIRVSVGC 358

Query: 358 EGVEDLIKDLAGAL 371
           E VEDLIKDL  AL
Sbjct: 359 ENVEDLIKDLENAL 372

>CAGL0K05665g Chr11 complement(552804..553943) [1140 bp, 379 aa]
           {ON} highly similar to uniprot|P38716 Saccharomyces
           cerevisiae YHR112c
          Length = 379

 Score =  509 bits (1310), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 232/377 (61%), Positives = 297/377 (78%)

Query: 1   MVSLPTTLIHADDKDNRVTDIVSPINVATTFRYDNNNLIAWNDRENYDFLETTPVYSRLA 60
           MV L T LIH DDK NRV+D+  PINV+TT+RY   +LI W  REN+DF++  PVYSR  
Sbjct: 1   MVELATKLIHDDDKHNRVSDVAPPINVSTTYRYAEEDLIPWAQRENFDFMDEAPVYSREG 60

Query: 61  HPNATRLESIFSEILGGHAVIYSSGLAAYFATLTHYNPKKLFIGQSYHGCHGIADIFTRN 120
           HPN TRLE+IFS+IL GHAV+Y+SGLAA+FA + HYNPK++F+GQ YHG H I+D+FTRN
Sbjct: 61  HPNCTRLETIFSDILEGHAVLYASGLAAFFAAMMHYNPKQVFLGQCYHGVHCISDMFTRN 120

Query: 121 NGMKQYPLDRIEELASEGDIVHLETPVNPFGTSYDIEDFARKAHAKGALLVIDSTFAPPP 180
             ++Q  L+ I E A +GD+VHLE+PVNPFGT  D++  A  AH+KGA+++IDSTFAPPP
Sbjct: 121 FNVQQRTLEDIAEFAKKGDVVHLESPVNPFGTVIDVKKLADLAHSKGAIVIIDSTFAPPP 180

Query: 181 LQDVWKFGADVVIHSCTKYFGGHSDLLSGVVVVKSLEVAKKMKNDRIYLGTNIANLESYL 240
           LQ  W  GAD+++HS TKYFGGHSDLL G++V K  E+++ +K DRI LG+ I NLESYL
Sbjct: 181 LQYAWDLGADMIMHSATKYFGGHSDLLGGILVTKDKEISRALKEDRINLGSMIGNLESYL 240

Query: 241 LLRSLRTFEMRVRKQSENATALVKYLDDHKSEFNKVLDKIYHSSLQTEDFVKKQLEGGYG 300
           L+RSLRT+EMR+ KQSEN   +VKYL+D+K ++  VL  IYHSS+Q++ FVK QL GGY 
Sbjct: 241 LMRSLRTYEMRIMKQSENVVKIVKYLNDNKEKYPNVLGDIYHSSIQSDAFVKDQLVGGYN 300

Query: 301 PVFSIVLKSKVQCKKLPGKLELFQHATSLGGVESLVEWRALTDPYIEQTLIRVSVGCEGV 360
            VFS  LKS+ QCKK P KL+ F HATSLGG+ESL+EWRAL+D  I+Q L+RVSVGCE  
Sbjct: 301 SVFSFCLKSEEQCKKFPDKLKYFHHATSLGGIESLIEWRALSDDKIDQKLMRVSVGCESA 360

Query: 361 EDLIKDLAGALKQLQDE 377
           +DLI DL+ AL++L++E
Sbjct: 361 KDLIDDLSQALQELENE 377

>NDAI0F00140 Chr6 (15124..16260) [1137 bp, 378 aa] {ON} 
          Length = 378

 Score =  505 bits (1300), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 239/380 (62%), Positives = 301/380 (79%), Gaps = 5/380 (1%)

Query: 1   MVSLPTTLIHADDKDNRVTDIVSPINVATTFRYDNNNLIAWNDRENYDFLET---TPVYS 57
           M  L T LIH DDK NRVTD+  PINV+TTFR+DNNNLI  N  E  DFL++    PVY+
Sbjct: 1   MAHLSTALIHGDDKLNRVTDVAPPINVSTTFRFDNNNLIPAN--EVKDFLQSIDENPVYA 58

Query: 58  RLAHPNATRLESIFSEILGGHAVIYSSGLAAYFATLTHYNPKKLFIGQSYHGCHGIADIF 117
           R +HPN++R++++ S++LGGHAVIY+SG +A+ A + HYNPK+ F+   Y G H IAD+ 
Sbjct: 59  RESHPNSSRVQAVLSDLLGGHAVIYNSGCSAFHALMCHYNPKRFFMDGGYFGVHAIADLI 118

Query: 118 TRNNGMKQYPLDRIEELASEGDIVHLETPVNPFGTSYDIEDFARKAHAKGALLVIDSTFA 177
           TRN G++Q+ LD IEE A  GDIVHLETP+NPFGTS DIE  A++ H KGA+L ID+T A
Sbjct: 119 TRNYGLEQHSLDEIEEFAQAGDIVHLETPLNPFGTSSDIEALAKRVHDKGAILSIDATLA 178

Query: 178 PPPLQDVWKFGADVVIHSCTKYFGGHSDLLSGVVVVKSLEVAKKMKNDRIYLGTNIANLE 237
           PPPLQD WKFGAD+++HS TKYFGGHSDLL+GV+VVK+ E A ++  DRI+LGTNI NLE
Sbjct: 179 PPPLQDAWKFGADIILHSATKYFGGHSDLLAGVLVVKTKEQAYELIEDRIHLGTNIGNLE 238

Query: 238 SYLLLRSLRTFEMRVRKQSENATALVKYLDDHKSEFNKVLDKIYHSSLQTEDFVKKQLEG 297
           SYLLLRSLRT+EMR+ KQ  N   ++ YL+++KS+FNKVL+KIYHSSLQ +DFV+KQL G
Sbjct: 239 SYLLLRSLRTYEMRIMKQENNTRKVITYLNENKSKFNKVLNKIYHSSLQDDDFVQKQLSG 298

Query: 298 GYGPVFSIVLKSKVQCKKLPGKLELFQHATSLGGVESLVEWRALTDPYIEQTLIRVSVGC 357
            Y PVF+I L S  QCK+LP  L+ FQHATSLGGVESL+EWRA++D  I+Q LIRVS+GC
Sbjct: 299 LYCPVFAITLHSIDQCKELPLYLKYFQHATSLGGVESLIEWRAMSDSDIDQCLIRVSIGC 358

Query: 358 EGVEDLIKDLAGALKQLQDE 377
           E  +DLIKDL  AL+ LQ++
Sbjct: 359 ENADDLIKDLENALQILQNK 378

>KNAG0F01580 Chr6 complement(282872..284011) [1140 bp, 379 aa] {ON} 
          Length = 379

 Score =  499 bits (1285), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 230/378 (60%), Positives = 295/378 (78%)

Query: 1   MVSLPTTLIHADDKDNRVTDIVSPINVATTFRYDNNNLIAWNDRENYDFLETTPVYSRLA 60
           M    T+ IHADD++NRV D+  PINV+ T+RYDN+NL   +++E  + +++ PVYSR A
Sbjct: 1   MTHFATSAIHADDQNNRVPDVAPPINVSVTYRYDNDNLKICDEKECLEEMDSVPVYSRTA 60

Query: 61  HPNATRLESIFSEILGGHAVIYSSGLAAYFATLTHYNPKKLFIGQSYHGCHGIADIFTRN 120
           HPN TRLES+ S IL GHAV+Y+SG +A++A L HYNPK+LFI +SY G H IADI TRN
Sbjct: 61  HPNCTRLESVLSSILNGHAVVYNSGCSAFYAALVHYNPKRLFIEESYDGMHAIADIMTRN 120

Query: 121 NGMKQYPLDRIEELASEGDIVHLETPVNPFGTSYDIEDFARKAHAKGALLVIDSTFAPPP 180
            GM+Q+  D IE+ A  GDIVHLE+P+NP+G S DI+  A +AHAKGALL++DST APPP
Sbjct: 121 YGMQQHTFDNIEKYAQVGDIVHLESPLNPYGISSDIQALADRAHAKGALLMVDSTLAPPP 180

Query: 181 LQDVWKFGADVVIHSCTKYFGGHSDLLSGVVVVKSLEVAKKMKNDRIYLGTNIANLESYL 240
           LQ+ W FG D+++HS TKYFGGHSDLL+G++V K  +V+ ++K DRIYLGT   NLES+L
Sbjct: 181 LQNTWDFGPDIIMHSATKYFGGHSDLLAGILVTKDKDVSIQLKGDRIYLGTIPGNLESFL 240

Query: 241 LLRSLRTFEMRVRKQSENATALVKYLDDHKSEFNKVLDKIYHSSLQTEDFVKKQLEGGYG 300
           LLRSLRT EMRV KQSENAT +V+YL D+K  F+KVL +IYHSSLQ E FV  Q+ GGY 
Sbjct: 241 LLRSLRTMEMRVLKQSENATKIVQYLVDNKETFDKVLGEIYHSSLQDEPFVAAQMSGGYT 300

Query: 301 PVFSIVLKSKVQCKKLPGKLELFQHATSLGGVESLVEWRALTDPYIEQTLIRVSVGCEGV 360
           P+FS  L++  Q K  P KL++FQHATSLGG+ESL+EWR L++P ++QTL+R+SVGCE V
Sbjct: 301 PLFSFKLQTIDQAKHFPEKLKIFQHATSLGGIESLIEWRVLSEPELDQTLLRISVGCENV 360

Query: 361 EDLIKDLAGALKQLQDEE 378
           +DLI DL  AL+Q Q EE
Sbjct: 361 DDLIADLQNALQQAQKEE 378

>AER250C Chr5 complement(1098456..1099580) [1125 bp, 374 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YHR112C
          Length = 374

 Score =  490 bits (1261), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 223/374 (59%), Positives = 288/374 (77%)

Query: 1   MVSLPTTLIHADDKDNRVTDIVSPINVATTFRYDNNNLIAWNDRENYDFLETTPVYSRLA 60
           MV L T+LIHADD  NRV D+  PINV TTFRY  ++LI   +R           YSR++
Sbjct: 1   MVELCTSLIHADDNSNRVNDVAPPINVTTTFRYSEDDLIPAVERTADTAGSNGHFYSRVS 60

Query: 61  HPNATRLESIFSEILGGHAVIYSSGLAAYFATLTHYNPKKLFIGQSYHGCHGIADIFTRN 120
           HPN  R E + +E LGG AV+YSSGLAA+ A LTH+NPK+LFIG+ YHGCHG+ADI+ RN
Sbjct: 61  HPNGARCEVLLAEALGGEAVVYSSGLAAFGAALTHFNPKRLFIGRGYHGCHGVADIWVRN 120

Query: 121 NGMKQYPLDRIEELASEGDIVHLETPVNPFGTSYDIEDFARKAHAKGALLVIDSTFAPPP 180
           +G+++  L+ + E +  GD+VH+E+P+NP+GT  D+   A  AH KGA +V+D+TFAPPP
Sbjct: 121 HGLQKLSLEEVSERSEPGDLVHIESPINPYGTLVDVAGIAAAAHEKGAYVVLDATFAPPP 180

Query: 181 LQDVWKFGADVVIHSCTKYFGGHSDLLSGVVVVKSLEVAKKMKNDRIYLGTNIANLESYL 240
           LQD W+ GADVV+HSCTKYFGGHSDLL GV  V+   VA++++ DR+YLGTNIANLE+YL
Sbjct: 181 LQDRWEQGADVVVHSCTKYFGGHSDLLGGVHAVRDAAVARQLRQDRVYLGTNIANLEAYL 240

Query: 241 LLRSLRTFEMRVRKQSENATALVKYLDDHKSEFNKVLDKIYHSSLQTEDFVKKQLEGGYG 300
           L+RS+RT EMRV +QS +AT +V YL+ HK+EF  VL K++HSSLQTE +V++ L GG  
Sbjct: 241 LIRSMRTMEMRVVRQSTSATKVVAYLESHKAEFGGVLVKVFHSSLQTEPYVQQYLRGGNA 300

Query: 301 PVFSIVLKSKVQCKKLPGKLELFQHATSLGGVESLVEWRALTDPYIEQTLIRVSVGCEGV 360
           PVFSI+L++  QCK+LP  L+LF HATSLGGVESL+EWRA++D  +EQ L+R+SVGCE  
Sbjct: 301 PVFSILLRTVEQCKRLPSLLKLFHHATSLGGVESLIEWRAMSDTTVEQNLLRISVGCESP 360

Query: 361 EDLIKDLAGALKQL 374
           EDLI DLAGA +QL
Sbjct: 361 EDLIADLAGAFRQL 374

>Ecym_5523 Chr5 complement(1060537..1061682) [1146 bp, 381 aa] {ON}
           similar to Ashbya gossypii AER250C
          Length = 381

 Score =  490 bits (1261), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 237/379 (62%), Positives = 293/379 (77%), Gaps = 3/379 (0%)

Query: 1   MVSLPTTLIHADDK-DNRVTDIVSPINVATTFRYDNNNLI-AWNDRENYDFLETTPVYSR 58
           M  L T LIHADD   + VTD+  PINV+TTFRYDN+NL+    D + Y   E  PVYSR
Sbjct: 1   MAGLSTLLIHADDGVSDHVTDVAPPINVSTTFRYDNDNLVLPEGDCDGY-ATEGAPVYSR 59

Query: 59  LAHPNATRLESIFSEILGGHAVIYSSGLAAYFATLTHYNPKKLFIGQSYHGCHGIADIFT 118
             HPN+ R  SI S  L G+AV Y+SGL+A+ A LTHYNPK+LFIGQSYHGCH +ADI+ 
Sbjct: 60  EGHPNSNRCGSILSHALNGYAVAYNSGLSAFGAALTHYNPKRLFIGQSYHGCHKLADIWV 119

Query: 119 RNNGMKQYPLDRIEELASEGDIVHLETPVNPFGTSYDIEDFARKAHAKGALLVIDSTFAP 178
           RN G+ +  LD IEE A  GD+VH+E+P+NP+GT+ DIE++  K H KGA+++IDSTFAP
Sbjct: 120 RNYGLLKLGLDEIEERAQPGDMVHIESPMNPYGTAVDIEEYVSKGHKKGAIVMIDSTFAP 179

Query: 179 PPLQDVWKFGADVVIHSCTKYFGGHSDLLSGVVVVKSLEVAKKMKNDRIYLGTNIANLES 238
           PPLQ+ W+FG D+++HSCTKY GGHSDLL GV+VVK   V +++  DRIYLGTNIANL+S
Sbjct: 180 PPLQNAWEFGVDILMHSCTKYLGGHSDLLGGVLVVKDKAVFRQLVADRIYLGTNIANLDS 239

Query: 239 YLLLRSLRTFEMRVRKQSENATALVKYLDDHKSEFNKVLDKIYHSSLQTEDFVKKQLEGG 298
           YLL+RSLRT E+RV KQS+ AT LV YL  H SEF+ VL +I H+SLQ E+FVKKQL GG
Sbjct: 240 YLLIRSLRTLELRVMKQSDTATKLVAYLKQHISEFSDVLSEIRHTSLQQEEFVKKQLAGG 299

Query: 299 YGPVFSIVLKSKVQCKKLPGKLELFQHATSLGGVESLVEWRALTDPYIEQTLIRVSVGCE 358
           + PVFSI+LK+  QC++LP KL+ F HATS GGVESL+EWRAL+DP IE+TL+RVSVGCE
Sbjct: 300 HTPVFSIMLKTVDQCRELPKKLKFFHHATSFGGVESLIEWRALSDPEIEKTLVRVSVGCE 359

Query: 359 GVEDLIKDLAGALKQLQDE 377
              DLI DLA AL+ LQ +
Sbjct: 360 DHNDLINDLANALRYLQTQ 378

>TDEL0G00140 Chr7 complement(20315..21460) [1146 bp, 381 aa] {ON} 
          Length = 381

 Score =  484 bits (1247), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 223/376 (59%), Positives = 293/376 (77%), Gaps = 1/376 (0%)

Query: 1   MVSLPTTLIHADDKDNRVTDIVSPINVATTFRYDNNNLIAWNDRENY-DFLETTPVYSRL 59
           M  L T  IHADD  NRVTD+  PINV+TTFRYDN NL+   + EN+ + +E TPVYSR 
Sbjct: 1   MTHLSTACIHADDIHNRVTDVAPPINVSTTFRYDNENLVPEVEIENFIETIEQTPVYSRE 60

Query: 60  AHPNATRLESIFSEILGGHAVIYSSGLAAYFATLTHYNPKKLFIGQSYHGCHGIADIFTR 119
           +HPN+ RL+++ S+ILGGHA +Y+SG++A+ A + HYNPK+ F+   Y G  GIA ++  
Sbjct: 61  SHPNSLRLQTVLSDILGGHATVYNSGVSAFHALIFHYNPKRFFMDDGYSGVRGIATLYQE 120

Query: 120 NNGMKQYPLDRIEELASEGDIVHLETPVNPFGTSYDIEDFARKAHAKGALLVIDSTFAPP 179
            +G++ Y L +IEE A +GD++HLE P+NP+GT  DI   A++ H KGA+L IDST APP
Sbjct: 121 KHGLETYKLHQIEEFAEKGDLIHLEVPLNPYGTCRDIAALAKRVHKKGAILSIDSTLAPP 180

Query: 180 PLQDVWKFGADVVIHSCTKYFGGHSDLLSGVVVVKSLEVAKKMKNDRIYLGTNIANLESY 239
           PLQD W FGADVV+HS TKY GGHSDLL+GVVVVK++E  +K+  +RI+LGTN+ NLES+
Sbjct: 181 PLQDAWDFGADVVMHSATKYLGGHSDLLAGVVVVKTMEQQRKLIRERIFLGTNVGNLESF 240

Query: 240 LLLRSLRTFEMRVRKQSENATALVKYLDDHKSEFNKVLDKIYHSSLQTEDFVKKQLEGGY 299
           LLLRSLRTFEMRV KQSENA  +V +L ++K++++KVL+++YHSSLQ E FV++QL GG+
Sbjct: 241 LLLRSLRTFEMRVLKQSENAAKIVSFLHENKAKYSKVLNEVYHSSLQKEAFVQRQLAGGH 300

Query: 300 GPVFSIVLKSKVQCKKLPGKLELFQHATSLGGVESLVEWRALTDPYIEQTLIRVSVGCEG 359
           G VFS+ L+S  QCKKLP KL  FQHATSLGGVESL+EWRAL+D  I+  L+R+S+GCE 
Sbjct: 301 GAVFSVTLRSVEQCKKLPAKLVYFQHATSLGGVESLIEWRALSDTKIDPFLVRLSIGCEN 360

Query: 360 VEDLIKDLAGALKQLQ 375
            +DLI+DL  AL+ LQ
Sbjct: 361 ADDLIQDLDNALQVLQ 376

>TDEL0G04970 Chr7 complement(925785..926930) [1146 bp, 381 aa] {ON} 
          Length = 381

 Score =  466 bits (1198), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 219/377 (58%), Positives = 286/377 (75%), Gaps = 1/377 (0%)

Query: 1   MVSLPTTLIHADDKDNRVTDIVSPINVATTFRYDNNNLIAWNDRENY-DFLETTPVYSRL 59
           M  L TT IHADD  NRV+D+  PINV TTFR+DN+NLI   + EN+ + +E +PVY+R 
Sbjct: 1   MTHLSTTSIHADDIHNRVSDVAPPINVTTTFRFDNDNLIPEAELENFIEAIEESPVYARE 60

Query: 60  AHPNATRLESIFSEILGGHAVIYSSGLAAYFATLTHYNPKKLFIGQSYHGCHGIADIFTR 119
            HPN+ R++SI S ILGGHA +Y+SG +A+ A +   NPK++F+  +Y G   IA +   
Sbjct: 61  THPNSIRVQSILSSILGGHAAVYNSGCSAFHALMFRLNPKRVFMDDAYGGVETIASLIKE 120

Query: 120 NNGMKQYPLDRIEELASEGDIVHLETPVNPFGTSYDIEDFARKAHAKGALLVIDSTFAPP 179
             G+K + LD+IEE A +GD+VHLETP+NPFG   +I   A + H KGALL +DST APP
Sbjct: 121 KYGLKIFKLDQIEEFAEKGDLVHLETPLNPFGICTNIVALAERVHKKGALLSVDSTLAPP 180

Query: 180 PLQDVWKFGADVVIHSCTKYFGGHSDLLSGVVVVKSLEVAKKMKNDRIYLGTNIANLESY 239
           PLQ+ W FGAD+V+HS TKY GGHSDLL+GV+VVK +E  + +  +RIYLGTN+ NLES+
Sbjct: 181 PLQNAWDFGADIVMHSATKYLGGHSDLLAGVLVVKDVETQRALIKERIYLGTNLGNLESF 240

Query: 240 LLLRSLRTFEMRVRKQSENATALVKYLDDHKSEFNKVLDKIYHSSLQTEDFVKKQLEGGY 299
           LLLRSLRTFEMRV KQSENA  +V +L ++ +++ KVLD++YHSSLQ E+FV+KQL GG+
Sbjct: 241 LLLRSLRTFEMRVTKQSENALKVVTFLHENSAKYPKVLDQLYHSSLQKEEFVQKQLAGGH 300

Query: 300 GPVFSIVLKSKVQCKKLPGKLELFQHATSLGGVESLVEWRALTDPYIEQTLIRVSVGCEG 359
           G VFS++LKS  Q KKLP KL  FQHATSLGGVESL+EWRA++D  I+  L+R+SVGCE 
Sbjct: 301 GAVFSMILKSVEQAKKLPTKLVYFQHATSLGGVESLIEWRAMSDSTIDPCLVRLSVGCEN 360

Query: 360 VEDLIKDLAGALKQLQD 376
           V+DLI+DL   L+ LQ+
Sbjct: 361 VDDLIQDLDQGLQALQN 377

>NDAI0B00595 Chr2 (131225..132361) [1137 bp, 378 aa] {ON}
          Length = 378

 Score =  457 bits (1175), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 223/380 (58%), Positives = 292/380 (76%), Gaps = 5/380 (1%)

Query: 1   MVSLPTTLIHADDKDNRVTDIVSPINVATTFRYDNNNLIAWNDRENYDFLET---TPVYS 57
           MV L TTLIH DDK NRVT +  PINV+TTFR+D+NNLI  N+ +  DFL++    PVY+
Sbjct: 1   MVHLSTTLIHGDDKLNRVTYVAPPINVSTTFRFDSNNLIPANEVK--DFLQSIDENPVYA 58

Query: 58  RLAHPNATRLESIFSEILGGHAVIYSSGLAAYFATLTHYNPKKLFIGQSYHGCHGIADIF 117
           + ++PN++R++++ S++LGGHAVIY+SG + + A + HYNPK+ F+   Y G H IAD+ 
Sbjct: 59  KESYPNSSRVQAVLSDLLGGHAVIYNSGCSFFHALMCHYNPKRFFMDGGYFGVHAIADLL 118

Query: 118 TRNNGMKQYPLDRIEELASEGDIVHLETPVNPFGTSYDIEDFARKAHAKGALLVIDSTFA 177
           TRN G++Q  LD IEE A  GDIVHLETP+NPFGTS D+E    + H KGA+L ID+T A
Sbjct: 119 TRNYGLEQQFLDEIEEFAQAGDIVHLETPLNPFGTSSDMEALGERVHTKGAILSIDATLA 178

Query: 178 PPPLQDVWKFGADVVIHSCTKYFGGHSDLLSGVVVVKSLEVAKKMKNDRIYLGTNIANLE 237
            PPLQD WKFGAD+++HS TKY GGHSDLL+GV+VVK+ E A ++  DRI+LGTNI NLE
Sbjct: 179 SPPLQDAWKFGADIILHSATKYSGGHSDLLAGVLVVKTKEQAYELIEDRIHLGTNIGNLE 238

Query: 238 SYLLLRSLRTFEMRVRKQSENATALVKYLDDHKSEFNKVLDKIYHSSLQTEDFVKKQLEG 297
           SYLLLR L T+EMR+ KQ +N   ++ YL+++KS+FNKV++KIYHSS Q +DF++KQL G
Sbjct: 239 SYLLLRLLSTYEMRIMKQEKNTRKVIIYLNENKSKFNKVVNKIYHSSSQDDDFIQKQLSG 298

Query: 298 GYGPVFSIVLKSKVQCKKLPGKLELFQHATSLGGVESLVEWRALTDPYIEQTLIRVSVGC 357
            Y PVF+I L S  QCK+LP  L+ FQHATSLG  ESL+EWRA++D  I+Q LI VS+GC
Sbjct: 299 LYCPVFAITLHSIDQCKELPLHLKYFQHATSLGAAESLIEWRAVSDVDIDQCLIGVSIGC 358

Query: 358 EGVEDLIKDLAGALKQLQDE 377
           E  +DLIKDL  AL+ LQ++
Sbjct: 359 ENADDLIKDLENALQILQNK 378

>Kwal_55.22221 s55 (1160724..1161866) [1143 bp, 380 aa] {ON} YHR112C
           - Hypothetical ORF [contig 697] FULL
          Length = 380

 Score =  448 bits (1152), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 203/373 (54%), Positives = 279/373 (74%)

Query: 6   TTLIHADDKDNRVTDIVSPINVATTFRYDNNNLIAWNDRENYDFLETTPVYSRLAHPNAT 65
           T  IH+DD  NRV+D+  PINV+TTFRYDN +L+           ++  +YSRL HPNA 
Sbjct: 6   TNAIHSDDYLNRVSDVAPPINVSTTFRYDNEHLVPATRETGMHTSDSPMIYSRLGHPNAD 65

Query: 66  RLESIFSEILGGHAVIYSSGLAAYFATLTHYNPKKLFIGQSYHGCHGIADIFTRNNGMKQ 125
           RLE++ S++L  HAV+Y+SGLAAY A L H+ PK+LF+   YHGC  +A I +R NGM+ 
Sbjct: 66  RLEAVLSQLLDSHAVVYASGLAAYHAILVHFKPKRLFLPHCYHGCKEVARIISRLNGMEI 125

Query: 126 YPLDRIEELASEGDIVHLETPVNPFGTSYDIEDFARKAHAKGALLVIDSTFAPPPLQDVW 185
             L+ IE    EGD+VH+E P+NPFG + D+  +A + H+ G L+++DST  PPPL++ W
Sbjct: 126 LSLEDIEAKCQEGDLVHIEDPINPFGETVDLAQYASRIHSAGGLMMLDSTLGPPPLRNAW 185

Query: 186 KFGADVVIHSCTKYFGGHSDLLSGVVVVKSLEVAKKMKNDRIYLGTNIANLESYLLLRSL 245
            +GAD+++HS TKYFGGHSDLLSG+V V    +A+++KNDR YLGT  A+LES+LLLRSL
Sbjct: 186 DYGADIIMHSGTKYFGGHSDLLSGIVCVSDEAIAEQLKNDRTYLGTIPASLESFLLLRSL 245

Query: 246 RTFEMRVRKQSENATALVKYLDDHKSEFNKVLDKIYHSSLQTEDFVKKQLEGGYGPVFSI 305
           RT ++RVR+QS+N T LV YL ++  +F+ V+ +I H+SLQTE FVK+Q+ GG+GPVF++
Sbjct: 246 RTMDIRVRRQSQNCTELVSYLANNSEKFSSVVQEIRHASLQTEAFVKQQMPGGFGPVFAL 305

Query: 306 VLKSKVQCKKLPGKLELFQHATSLGGVESLVEWRALTDPYIEQTLIRVSVGCEGVEDLIK 365
           +LKS+ QC+K+   +  FQHATSLGGVESL+EWRA++DP   +TLIRVSVG E +EDLI 
Sbjct: 306 ILKSEDQCRKVVKNVSFFQHATSLGGVESLIEWRAMSDPTALKTLIRVSVGLENIEDLIA 365

Query: 366 DLAGALKQLQDEE 378
           DLAG+L+++   E
Sbjct: 366 DLAGSLEKINKGE 378

>KLTH0E16566g Chr5 (1468783..1469928) [1146 bp, 381 aa] {ON} similar
           to uniprot|P38716 Saccharomyces cerevisiae YHR112C
           Hypothetical ORF
          Length = 381

 Score =  445 bits (1145), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 211/370 (57%), Positives = 273/370 (73%)

Query: 6   TTLIHADDKDNRVTDIVSPINVATTFRYDNNNLIAWNDRENYDFLETTPVYSRLAHPNAT 65
           T  IH DD+ NRV+D+  PINV+TTFRYD+ +L            ++  +YSRL HPNA 
Sbjct: 6   TATIHGDDRLNRVSDVAPPINVSTTFRYDDEHLEPATISTGTHTSDSPMIYSRLGHPNAD 65

Query: 66  RLESIFSEILGGHAVIYSSGLAAYFATLTHYNPKKLFIGQSYHGCHGIADIFTRNNGMKQ 125
           RLE + +EIL G  V+Y+SGLAAY A L H NPK+LF    YHGC  +A I +R +GM+ 
Sbjct: 66  RLEVVLTEILDGPTVVYASGLAAYHAILIHVNPKRLFQPHCYHGCEAVAKIISRISGMEI 125

Query: 126 YPLDRIEELASEGDIVHLETPVNPFGTSYDIEDFARKAHAKGALLVIDSTFAPPPLQDVW 185
            PL+ +E+    GD+VHLE P NP+G   ++++FA K H  GAL+++DST APPPL++ W
Sbjct: 126 LPLENLEDKCQSGDLVHLEDPGNPYGEVVNLDEFAEKIHRAGALMLVDSTLAPPPLRNTW 185

Query: 186 KFGADVVIHSCTKYFGGHSDLLSGVVVVKSLEVAKKMKNDRIYLGTNIANLESYLLLRSL 245
           +FGAD+V+HS TKYFGGHSDLLSG+V V+  +VA++++NDR YLGT  A+LESYLLLRSL
Sbjct: 186 EFGADIVMHSGTKYFGGHSDLLSGIVSVRDEKVAQQLRNDRTYLGTIPASLESYLLLRSL 245

Query: 246 RTFEMRVRKQSENATALVKYLDDHKSEFNKVLDKIYHSSLQTEDFVKKQLEGGYGPVFSI 305
           RT E+RV KQS N T LV+YL  HK  +N V+  I H+SLQ E+FVKKQL GGYGPVFS+
Sbjct: 246 RTMEIRVLKQSSNCTRLVEYLASHKDRYNSVVKDIRHASLQKEEFVKKQLPGGYGPVFSL 305

Query: 306 VLKSKVQCKKLPGKLELFQHATSLGGVESLVEWRALTDPYIEQTLIRVSVGCEGVEDLIK 365
           +L S+ QCK L     LFQHATSLGG ESL+EWRA++DP+  + LIRVSVG E  EDLI+
Sbjct: 306 LLFSQEQCKLLVKNTVLFQHATSLGGAESLIEWRAMSDPFANRNLIRVSVGLENAEDLIE 365

Query: 366 DLAGALKQLQ 375
           DLAG L++++
Sbjct: 366 DLAGTLEKIE 375

>TPHA0A06070 Chr1 complement(1370008..1371129) [1122 bp, 373 aa]
           {ON}  YFR055W
          Length = 373

 Score =  433 bits (1113), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 199/362 (54%), Positives = 275/362 (75%), Gaps = 1/362 (0%)

Query: 17  RVTDIVSPINVATTFRYDNNNLIAWNDRENY-DFLETTPVYSRLAHPNATRLESIFSEIL 75
           +++DI  PINV+TT+RYD +NLI   + +++   +E  PVYSR +H N++R++ + S++L
Sbjct: 8   KISDIAPPINVSTTYRYDEHNLIPAAEVKDFLSSIEENPVYSRESHANSSRVQKVLSKVL 67

Query: 76  GGHAVIYSSGLAAYFATLTHYNPKKLFIGQSYHGCHGIADIFTRNNGMKQYPLDRIEELA 135
            GHAVIY+SG +A+ A + HYNPK++F  +SY G   IA++ TRN G+KQY L  I++ A
Sbjct: 68  NGHAVIYNSGCSAFHALMCHYNPKRIFFDESYFGIKAIANLITRNYGLKQYSLKDIDKFA 127

Query: 136 SEGDIVHLETPVNPFGTSYDIEDFARKAHAKGALLVIDSTFAPPPLQDVWKFGADVVIHS 195
            EGDI+H+ETP+NPFGT+ +I++ A KAHAK ALL +DST APPPLQ+ + FGAD+V+HS
Sbjct: 128 QEGDIIHIETPLNPFGTAINIKEIAVKAHAKKALLSVDSTLAPPPLQNAFDFGADIVLHS 187

Query: 196 CTKYFGGHSDLLSGVVVVKSLEVAKKMKNDRIYLGTNIANLESYLLLRSLRTFEMRVRKQ 255
            TKY GGHSDLL+GV+VVK+ + A+ +  DRI+LGTNI NLES+LLLRSLRT+EMR+  Q
Sbjct: 188 ATKYLGGHSDLLAGVLVVKTEKEARALIEDRIHLGTNIGNLESFLLLRSLRTYEMRLSTQ 247

Query: 256 SENATALVKYLDDHKSEFNKVLDKIYHSSLQTEDFVKKQLEGGYGPVFSIVLKSKVQCKK 315
           S+N   +V +L+ ++ ++  V+  IYHSSLQ E FV +QL  G+  VF+++ KS+ QCK 
Sbjct: 248 SQNVVKIVNFLETNRCQYKNVIQHIYHSSLQKEVFVSEQLSKGHTAVFAVIFKSQEQCKN 307

Query: 316 LPGKLELFQHATSLGGVESLVEWRALTDPYIEQTLIRVSVGCEGVEDLIKDLAGALKQLQ 375
               L+ FQHATSLGGVESLVEWRA++DP I+  LIR S+GCE  EDLI+DL  AL +L+
Sbjct: 308 FVQYLKYFQHATSLGGVESLVEWRAMSDPDIDPCLIRFSIGCENAEDLIEDLKSALCRLE 367

Query: 376 DE 377
            E
Sbjct: 368 KE 369

>CAGL0H06369g Chr8 (627708..628883) [1176 bp, 391 aa] {ON} highly
           similar to uniprot|P31373 Saccharomyces cerevisiae
           YAL012w CYS3
          Length = 391

 Score =  141 bits (355), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 125/404 (30%), Positives = 198/404 (49%), Gaps = 62/404 (15%)

Query: 6   TTLIHADDKDNRVTDIVSPINVATTFRYDNNNLIAWNDRENYDFLETTPV----YSRLAH 61
           T  IHA   ++    ++ PI+++TTF+                     P+    YSR  +
Sbjct: 11  TKAIHAGAHEDIHGSVIEPISLSTTFKQSE---------------PAKPIGTYEYSRSQN 55

Query: 62  PNATRLESIFSEILGG-HAVIYSSGLAAYFATLTHYNPK---KLFIGQSYHG-------- 109
           PN   LE+  + + GG + + +SSG +A  A +    P+    + IG  Y G        
Sbjct: 56  PNRENLEAAIASLEGGKYGLAFSSG-SATTAVILQSLPQGSHAVSIGDVYGGTHRYFTKV 114

Query: 110 --CHGIADIFTRNNGMKQYPLDRIEELASEGDIVHLETPVNPFGTSYDIEDFAR--KAHA 165
              HG+   FT NN ++  P    + +     +V +E+P NP     DI+  A   K   
Sbjct: 115 ANAHGVDTSFT-NNLIEDLP----KLVKDNTKLVWIESPTNPTLKVTDIQLVAENVKKIN 169

Query: 166 KGALLVIDSTFAPPPLQDVWKFGADVVIHSCTKYFGGHSDLLSGVVVVKSLEVAKKMKND 225
           K  LLV+D+TF  P L +  KFGAD+V+HS TKY  GHSD++ GV+   S ++ ++++  
Sbjct: 170 KDILLVVDNTFLSPYLSNPLKFGADIVVHSATKYINGHSDVVLGVLATNSKDIYERLQFL 229

Query: 226 RIYLGTNIANLESYLLLRSLRTFEMRVRKQSENATALVKYLDDHKSEFNKVLDKIYHSSL 285
           +  +G   +  +++L  R L+T  +RVR+ S NAT +  +L     E N+ +  + +  L
Sbjct: 230 QNAIGCIPSPFDAWLTHRGLKTLHLRVRQASLNATKIATFL-----ESNENVVAVNYPGL 284

Query: 286 QTE---DFVKKQ-LEGGYGPVFSIVLKSKVQ-CKKLPGKLELFQHATSLGGVESLVEWRA 340
           Q+    D VKKQ  E   G + S  +K   +   K      LF  A SLGG+ESL+E  A
Sbjct: 285 QSHPNYDVVKKQHREALGGGMISFRIKGGAEAAAKFSSSTRLFTLAESLGGIESLLEVPA 344

Query: 341 -LTDPYIEQT----------LIRVSVGCEGVEDLIKDLAGALKQ 373
            +T   I +           L+R+SVG E  EDL++D+  AL++
Sbjct: 345 VMTHGGIPKEAREASGVFDDLVRLSVGIEDGEDLLEDIKQALQK 388

>KAFR0K00760 Chr11 (171591..172769) [1179 bp, 392 aa] {ON} Anc_7.97
           YAL012W
          Length = 392

 Score =  134 bits (337), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 117/399 (29%), Positives = 192/399 (48%), Gaps = 52/399 (13%)

Query: 6   TTLIHADDKDNRVTDIVSPINVATTFRYDNNNLIAWNDRENYDFLETTPV----YSRLAH 61
           T  IHA    +    ++ PI+++TTFR                     P+    YSR  +
Sbjct: 11  TKAIHAGAHVDVHGSVIEPISLSTTFRQS---------------APAQPIGTYEYSRSQN 55

Query: 62  PNATRLESIFSEILGG-HAVIYSSGLAAYFATLTHYNPK---KLFIGQSYHGCH----GI 113
           PN   LE   + +  G + + +SSG +A  A +    P+    + IG  Y G H     +
Sbjct: 56  PNRENLEVAIASLENGKYGLAFSSG-SATTAVILQSLPQGSHAISIGDVYGGTHRYFTKV 114

Query: 114 ADIFTRNNGMKQYPLDRIEELASEG-DIVHLETPVNPFGTSYDIEDFARKAHA--KGALL 170
           A+            L+ + +L  E   +V +E+P NP     DIE  ++K  +  K  LL
Sbjct: 115 ANAHGVETSFTNDLLNDLPKLVKENTKLVWIESPTNPTLKITDIEAVSQKVKSLNKDILL 174

Query: 171 VIDSTFAPPPLQDVWKFGADVVIHSCTKYFGGHSDLLSGVVVVKSLEVAKKMKNDRIYLG 230
           V+D+TF  P L +   FGAD+V+HS TKY  GHSD++ GV+   + ++ ++++  +  +G
Sbjct: 175 VVDNTFLSPYLSNPLNFGADIVVHSATKYINGHSDVVLGVLATNNKDIYERLQFLQNAIG 234

Query: 231 TNIANLESYLLLRSLRTFEMRVRKQSENATALVKYLDDHKSEFNKVLDKIYHSSLQTE-- 288
              +  +++L  R LRT  +RVR+ S +A  + ++L +     N+ ++ + +  L T   
Sbjct: 235 AIPSPFDAWLTHRGLRTLHLRVRQASLSAQKIAEFLQN-----NENVEAVNYPGLPTHKD 289

Query: 289 -DFVKKQ-LEGGYGPVFSIVLKSKVQ-CKKLPGKLELFQHATSLGGVESLVEWRALTD-- 343
            D VKKQ  E   G + S  +K   +   K      LF  A SLGGVESL+E  A+    
Sbjct: 290 YDVVKKQHREALGGGMISFRIKGGAEAAAKFSSSTRLFALAESLGGVESLLEVPAVMTHG 349

Query: 344 ---------PYIEQTLIRVSVGCEGVEDLIKDLAGALKQ 373
                      +   L+R+SVG E  +DL++D+  AL++
Sbjct: 350 GIPKEAREASGVYDNLVRLSVGIEDGDDLLEDVKQALEK 388

>NDAI0H02400 Chr8 complement(582916..584097) [1182 bp, 393 aa] {ON}
           Anc_7.97
          Length = 393

 Score =  133 bits (334), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 122/403 (30%), Positives = 187/403 (46%), Gaps = 62/403 (15%)

Query: 6   TTLIHADDKDNRVTDIVSPINVATTFRYDNNNLIAWNDRENYDFLETTPV----YSRLAH 61
           T  IHA    +    ++ PI+++TTF+                     P+    YSR  +
Sbjct: 11  TKAIHAGSHVDVHGSVIEPISLSTTFKQS---------------APAQPIGTYEYSRSQN 55

Query: 62  PNATRLESIFSEILGG-HAVIYSSGLAAYFATLTHY--NPKKLFIGQSYHG--------- 109
           PN   LE+  + +  G + + +SSG A     L     N   + IG  Y G         
Sbjct: 56  PNRENLENAIAALENGKYGLAFSSGSATTAIILQSLPQNSHAISIGDVYGGTHRYFTKVA 115

Query: 110 -CHGIADIFTRNNGMKQYPLDRIEELASEGDIVHLETPVNPFGTSYDIEDFAR--KAHAK 166
             HG+   FT N+ +K  P + ++E      +V +E+P NP     DIE  ++  K+  K
Sbjct: 116 NAHGVETTFT-NDLIKDLP-NLVKE---NTKLVWIESPTNPTLKVTDIEAVSKSIKSLNK 170

Query: 167 GALLVIDSTFAPPPLQDVWKFGADVVIHSCTKYFGGHSDLLSGVVVVKSLEVAKKMKNDR 226
             LLV+D+TF  P L +   FGAD+V+HS TKY  GHSD++ GV+   + E+ ++++  +
Sbjct: 171 DILLVVDNTFLSPYLSNPLNFGADIVVHSATKYINGHSDVVLGVLATNNQEIYERLQFLQ 230

Query: 227 IYLGTNIANLESYLLLRSLRTFEMRVRKQSENATALVKYLDDHKSEFNKVLDKIYHSSLQ 286
             +G   +  +S+L  R L+T  +RVR+ S  AT + ++L       N  +  + +  L 
Sbjct: 231 NAVGAIPSPFDSWLTHRGLKTLHLRVRQASLTATKIAEFLST-----NPNVKAVNYPGLP 285

Query: 287 TE---DFVKKQLE---GGYGPVFSIVLKSKVQCKKLPGKLELFQHATSLGGVESLVEWRA 340
           T    D VKKQ     GG    F I   S+    K      LF  A SLGG+ESL+E  A
Sbjct: 286 THENYDIVKKQHREALGGGMISFRINGGSEA-AAKFSSSTRLFTLAESLGGIESLLEVPA 344

Query: 341 LTD-----------PYIEQTLIRVSVGCEGVEDLIKDLAGALK 372
           +               +   LIR+SVG E   DL+ D+  AL+
Sbjct: 345 VMTHGGIPKESREASGVYDDLIRLSVGIEDAGDLLDDIKQALE 387

>Ecym_2629 Chr2 complement(1216179..1217357) [1179 bp, 392 aa] {ON}
           similar to Ashbya gossypii AEL341W
          Length = 392

 Score =  132 bits (331), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 123/404 (30%), Positives = 189/404 (46%), Gaps = 60/404 (14%)

Query: 4   LPTTLIHADDKDNRVTDIVSPINVATTFRYDNNNLIAWNDRENYDFLETTPV----YSRL 59
           + T ++HA +  +    ++ PI+++TTF+  +                  PV    YSR 
Sbjct: 9   ISTKVVHAGEHVDIHGSVIEPISLSTTFKQAS---------------PAVPVGAYEYSRS 53

Query: 60  AHPNATRLESIFSEILGG-HAVIYSSGLAAYFATLTHYNPK---KLFIGQSYHG------ 109
            +PN   LE   + +    H + +SSG +A  A +    P+    + IG  Y G      
Sbjct: 54  QNPNRKNLEDAIAVLENAKHGLAFSSG-SATTAVILQSLPQGSHAISIGDVYGGTHRYFN 112

Query: 110 ----CHGIADIFTRNNGMKQYPLDRIEELASEGDIVHLETPVNPFGTSYDIEDFAR--KA 163
                HG+   FT NN ++  P   I E      +V +E+P NP     DI+  ++  K+
Sbjct: 113 NVANAHGVETTFT-NNLVEDLPT-LIRE---NTKLVWIESPTNPTLKVTDIQLVSQIIKS 167

Query: 164 HAKGALLVIDSTFAPPPLQDVWKFGADVVIHSCTKYFGGHSDLLSGVVVVKSLEVAKKMK 223
             K  +LV+D+TF  P L +   FGAD+VIHS TKY  GHSD++ GV+   S  +  K++
Sbjct: 168 SNKDIILVVDNTFLSPYLSNPLNFGADIVIHSATKYINGHSDVVLGVLATNSQVLYDKLQ 227

Query: 224 NDRIYLGTNIANLESYLLLRSLRTFEMRVRKQSENATALVKYLDDHKSEFNKVLDKIYH- 282
             +  +G   +  +++L  R L+T  +RVR  S +A  + ++L     + +KV+   Y  
Sbjct: 228 YLQNAIGAVPSPFDAWLTHRGLKTLHLRVRTASNSAQEIAEFL----VKSDKVISVNYPG 283

Query: 283 -SSLQTEDFVKKQLEGGY-GPVFSIVLKSKVQ-CKKLPGKLELFQHATSLGGVESLVEWR 339
            SS    D VKKQ   G  G + S  +K       K      LF  A SLGG+ESL+E  
Sbjct: 284 LSSHPNNDIVKKQHRDGLGGGMISFRIKGGADGAAKFSASTRLFTLAESLGGIESLLEVP 343

Query: 340 ALTD-----------PYIEQTLIRVSVGCEGVEDLIKDLAGALK 372
           A+               +   LIR+SVG E   DL+KD+  AL 
Sbjct: 344 AVMTHGGIPKDQREASGVYDDLIRLSVGIEDTGDLLKDIEQALN 387

>Skud_1.49 Chr1 (106029..107213) [1185 bp, 394 aa] {ON} YAL012W
           (REAL)
          Length = 394

 Score =  132 bits (331), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 122/402 (30%), Positives = 192/402 (47%), Gaps = 55/402 (13%)

Query: 6   TTLIHADDKDNRVTDIVSPINVATTFRYDNNNLIAWNDRENYDFLETTPVYSRLAHPNAT 65
           T  IHA +  +    ++ PI+++TTF+  +      N    Y+       YSR  +PN  
Sbjct: 11  TKAIHAGEHVDVHGSVIEPISLSTTFKQSS----PANPIGTYE-------YSRSQNPNRE 59

Query: 66  RLESIFSEILGG-HAVIYSSGLAAYFATLTHYNPK---KLFIGQSYHG----------CH 111
            LE   + +    + + +SSG +A  AT+    P+    + IG  Y G           H
Sbjct: 60  NLERAVAALENAQYGLAFSSG-SATTATILQSLPQGAHAVSIGDVYGGTHRYFTKVANAH 118

Query: 112 GIADIFTRNNGMKQYPLDRIEELASEGDIVHLETPVNPFGTSYDIEDFAR--KAHAKG-- 167
           G+   FT N+ +   P    + L     +V +ETP NP     DI+  A   K HA G  
Sbjct: 119 GVETSFT-NDLLTDLP----QLLKDNTKLVWIETPTNPTLKVTDIQKVADLIKKHAAGQD 173

Query: 168 ALLVIDSTFAPPPLQDVWKFGADVVIHSCTKYFGGHSDLLSGVVVVKSLEVAKKMKNDRI 227
            +LV+D+TF  P + +   FGAD+V+HS TKY  GHSD++ GV+   S  + ++++  + 
Sbjct: 174 VILVVDNTFLSPYISNPLDFGADIVVHSATKYINGHSDVVLGVLATNSKPLYERLQFLQN 233

Query: 228 YLGTNIANLESYLLLRSLRTFEMRVRKQSENATALVKYLDDHKSEFNKVLDKIYHSSLQT 287
            +G   +  +++L  R L+T  +RVR+ + +A  + ++L   K     V     +  L+T
Sbjct: 234 AIGAIPSPFDAWLTHRGLKTLHLRVRQAALSAIKIAEFLASDKENIVAV----NYPGLKT 289

Query: 288 E---DFVKKQLEGGY-GPVFSIVLKSKVQ-CKKLPGKLELFQHATSLGGVESLVEWRA-L 341
               D V KQ      G + S  +K   +   K      LF  A SLGG+ESL+E  A +
Sbjct: 290 HPNYDVVLKQHRDALGGGMISFRIKGGAEAASKFASSTRLFTLAESLGGIESLLEVPAVM 349

Query: 342 TDPYIEQT----------LIRVSVGCEGVEDLIKDLAGALKQ 373
           T   I +           LIR+SVG E  +DL++D+  ALKQ
Sbjct: 350 THGGIPKEAREASGVFDDLIRISVGIEDTDDLLEDVKQALKQ 391

>Smik_1.55 Chr1 (113765..114949) [1185 bp, 394 aa] {ON} YAL012W
           (REAL)
          Length = 394

 Score =  132 bits (331), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 117/402 (29%), Positives = 193/402 (48%), Gaps = 55/402 (13%)

Query: 6   TTLIHADDKDNRVTDIVSPINVATTFRYDNNNLIAWNDRENYDFLETTPVYSRLAHPNAT 65
           T  IHA +  +    ++ PI+++TTF+  +      N    Y+       YSR  +PN  
Sbjct: 11  TKAIHAGEHIDVHGSVIEPISLSTTFKQSS----PANPIGTYE-------YSRSQNPNRE 59

Query: 66  RLESIFSEILGG-HAVIYSSGLAAYFATLTHYNPK---KLFIGQSYHG----------CH 111
            LE   + +    + + +SSG +A  AT+    P+    + IG  Y G           H
Sbjct: 60  NLEKAVAALENAQYGLAFSSG-SATTATILQSLPQGSHAVSIGDVYGGTHRYFTKVANAH 118

Query: 112 GIADIFTRNNGMKQYPLDRIEELASEGDIVHLETPVNPFGTSYDIEDFAR--KAHAKG-- 167
           G+   FT N+ +   P    + L +   +V +ETP NP     DI+  A   K HA G  
Sbjct: 119 GVETSFT-NDLLNDLP----QLLKNNTKLVWIETPTNPTLKVTDIQKVADLIKKHAAGQD 173

Query: 168 ALLVIDSTFAPPPLQDVWKFGADVVIHSCTKYFGGHSDLLSGVVVVKSLEVAKKMKNDRI 227
            +LV+D+TF  P + +   FGAD+V+HS TKY  GHSD++ GV+   + ++ ++++  + 
Sbjct: 174 VILVVDNTFLSPYISNPLNFGADIVVHSATKYINGHSDVVLGVLATNNKQLYERLQFLQN 233

Query: 228 YLGTNIANLESYLLLRSLRTFEMRVRKQSENATALVKYLDDHKSEFNKVLDKIYHSSLQT 287
            +G   +  +++L  R L+T  +RVR+ + +A  + ++L   K      +  + +  L+T
Sbjct: 234 AIGAIPSPFDAWLTHRGLKTLHLRVRQAALSAIKIAEFLASDKEN----VVAVNYPGLKT 289

Query: 288 E---DFVKKQLEGGY-GPVFSIVLKSKVQ-CKKLPGKLELFQHATSLGGVESLVEWRALT 342
               D V KQ      G + S  +K   +   K      LF  A SLGG+ESL+E  A+ 
Sbjct: 290 HPNYDVVLKQHRDALGGGMISFRIKGGAEAASKFASSTRLFTLAESLGGIESLLEVPAVM 349

Query: 343 D-----------PYIEQTLIRVSVGCEGVEDLIKDLAGALKQ 373
                         +   L+R+SVG E  +DL++D+  ALKQ
Sbjct: 350 THGGIPKEAREASGVYDDLVRISVGIEDTDDLLEDVKQALKQ 391

>Suva_1.56 Chr1 (107030..108217) [1188 bp, 395 aa] {ON} YAL012W
           (REAL)
          Length = 395

 Score =  130 bits (328), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 115/399 (28%), Positives = 189/399 (47%), Gaps = 48/399 (12%)

Query: 6   TTLIHADDKDNRVTDIVSPINVATTFRYDNNNLIAWNDRENYDFLETTPVYSRLAHPNAT 65
           T  IHA +  +    ++ PI+++TTF+  +      N    Y+       YSR  +PN  
Sbjct: 11  TKAIHAGEHVDVHGSVIEPISLSTTFKQSS----PANPIGTYE-------YSRSQNPNRE 59

Query: 66  RLESIFSEILGG-HAVIYSSGLAAYFATLTHYNPK---KLFIGQSYHG----------CH 111
            LE   + +    + + +SSG +A  AT+    P+    + IG  Y G           H
Sbjct: 60  NLERAVAALENAQYGLAFSSG-SATTATILQSLPQGSHAVSIGDVYGGTHRYFTKVANAH 118

Query: 112 GIADIFTRNNGMKQYPLDRIEELASEGDIVHLETPVNPFGTSYDIEDFA-----RKAHAK 166
           G+   FT N+ +K  P    + L     +V +ETP NP     DI+  A       A ++
Sbjct: 119 GVETSFT-NDLLKDLP----QLLKDNTKLVWIETPTNPTLKVTDIQKVADAIKKHTAASQ 173

Query: 167 GALLVIDSTFAPPPLQDVWKFGADVVIHSCTKYFGGHSDLLSGVVVVKSLEVAKKMKNDR 226
             +LV+D+TF  P + +   FGAD+V+HS TKY  GHSD++ GV+   S  + ++++  +
Sbjct: 174 DVILVVDNTFLSPYISNPLNFGADIVVHSATKYINGHSDVVLGVLATNSKPLYERLQFLQ 233

Query: 227 IYLGTNIANLESYLLLRSLRTFEMRVRKQSENATALVKYLDDHKSEFNKVLDKIYHSSLQ 286
             +G   +  +++L  R L+T  +RVR+ + +A  + ++L   K     V      +   
Sbjct: 234 NAIGAIPSPFDAWLTHRGLKTLHLRVRQAALSAIKIAEFLAADKENIVAVNYPGLKTHPN 293

Query: 287 TEDFVKKQLEGGYGPVFSIVLKSKVQ-CKKLPGKLELFQHATSLGGVESLVEWRA-LTDP 344
            +  VK+  +   G + S  +K   +   K      LF  A SLGG+ESL+E  A +T  
Sbjct: 294 YDVVVKQHRDALGGGMISFRIKGGAEAASKFASSTRLFTLAESLGGIESLLEVPAVMTHG 353

Query: 345 YIEQT----------LIRVSVGCEGVEDLIKDLAGALKQ 373
            I +           L+R+SVG E  +DL+ D+  ALKQ
Sbjct: 354 GIPKEAREASGVFDDLVRISVGIEDADDLLDDIKQALKQ 392

>TPHA0L00570 Chr12 (97933..99108) [1176 bp, 391 aa] {ON} Anc_7.97
           YAL012W
          Length = 391

 Score =  129 bits (325), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 116/397 (29%), Positives = 188/397 (47%), Gaps = 48/397 (12%)

Query: 6   TTLIHADDKDNRVTDIVSPINVATTFRYDNNNLIAWNDRENYDFLETTPV----YSRLAH 61
           T  IHA    +    ++ PI+++TTF+                     P+    YSR  +
Sbjct: 11  TKAIHAGSHVDVHGSVIEPISLSTTFKQS---------------APAEPIGEYEYSRSQN 55

Query: 62  PNATRLESIFSEILGG-HAVIYSSGLAAYFATLTHY--NPKKLFIGQSYHGCHGIADIFT 118
           PN   LE   + +  G + + +SSG A     L     N   + IG  Y G H       
Sbjct: 56  PNRKNLEDAIAALENGKYGLAFSSGSATTAIILQSLPQNSHAISIGDVYGGTHRYFSKVA 115

Query: 119 RNNGM-KQYPLDRIEELAS----EGDIVHLETPVNPFGTSYDIEDFAR--KAHAKGALLV 171
             +G+   +  D + +L         +V +E+P NP     DIE  A+  K+  K  LLV
Sbjct: 116 NTHGVDTDFTNDLVADLPKLVKENTRLVWIESPTNPTLKVTDIELVAKTIKSLNKDILLV 175

Query: 172 IDSTFAPPPLQDVWKFGADVVIHSCTKYFGGHSDLLSGVVVVKSLEVAKKMKNDRIYLGT 231
           +D+TF  P L +   FGAD+V+HS TKY  GHSD++ GV+   S ++ ++++  +  +G 
Sbjct: 176 VDNTFLSPYLSNPLNFGADIVVHSATKYINGHSDVVLGVLATNSRDIYERLQFLQNAVGA 235

Query: 232 NIANLESYLLLRSLRTFEMRVRKQSENATALVKYLDDHKSEFNKVLDKIYHSSLQTEDF- 290
             +  +++L  R L+T  +RVR+ + NAT + ++L    ++ + V+   Y       D+ 
Sbjct: 236 IPSPFDAWLTHRGLKTLHLRVRQAALNATKIAEFL----AQSDNVVAVNYPGLPTNPDYA 291

Query: 291 -VKKQLEGGY-GPVFSIVLKSKVQ-CKKLPGKLELFQHATSLGGVESLVEWRA-LTDPYI 346
            VKKQ      G + S  +K   +   K      LF  A SLGG+ESL+E  A +T   I
Sbjct: 292 IVKKQHRDALGGGMISFRVKGGAEAASKFASSTRLFTLAESLGGIESLLEVPAVMTHGGI 351

Query: 347 EQT----------LIRVSVGCEGVEDLIKDLAGALKQ 373
            +           L+R+SVG E  +DL++D+  AL++
Sbjct: 352 PKEQREASGVFDDLVRLSVGIEDGDDLLEDVKAALQK 388

>TBLA0E02240 Chr5 (554046..555209) [1164 bp, 387 aa] {ON} Anc_7.97
           YAL012W
          Length = 387

 Score =  129 bits (325), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 121/408 (29%), Positives = 196/408 (48%), Gaps = 59/408 (14%)

Query: 1   MVSLPT-----TLIHADDKDNRVTDIVSPINVATTFRYDNNNLIAWNDRENYDFLETTPV 55
           M  LPT       IHA    +    ++ PI+++TTF+                   + P+
Sbjct: 1   MTVLPTDKFATKAIHAGAHIDVHGSVIEPISLSTTFKQS---------------APSQPI 45

Query: 56  ----YSRLAHPNATRLESIFSEILGG-HAVIYSSGLAAYFATLTHYNPK---KLFIGQSY 107
               YSR  +PN   LE   + +  G + + +SSG +A  A +    P+    + IG  Y
Sbjct: 46  GIYEYSRSQNPNRKNLEEAIATLENGKYGLAFSSG-SATTAVILQSLPQGSHSISIGDVY 104

Query: 108 HGCHGIADIFTRNNGMKQ-YPLDRIEELAS----EGDIVHLETPVNPFGTSYDIE---DF 159
            G H         +G++  +  + IEEL +       +V +E+P NP     DI+   D 
Sbjct: 105 GGTHRYFTKVANAHGVESTFSNNLIEELPTLVKPNTRLVWIESPTNPTLKVTDIQLVVDT 164

Query: 160 ARKAHAKGALLVIDSTFAPPPLQDVWKFGADVVIHSCTKYFGGHSDLLSGVVVVKSLEVA 219
            +K + K  L+V+D+TF  P L +   FGAD+V+HS TKY  GHSD++ GV+   S E+ 
Sbjct: 165 VKKLN-KDILVVVDNTFLSPYLSNPLNFGADIVVHSATKYINGHSDVVLGVLATNSKEIY 223

Query: 220 KKMKNDRIYLGTNIANLESYLLLRSLRTFEMRVRKQSENATALVKYLDDHKSEFNKVLDK 279
           ++++  +  +G   +  +++L  R L+T  +RVR+ S +A  + ++L    +        
Sbjct: 224 ERLQFLQNAIGAIPSPFDAWLAHRGLKTLHLRVRQASLSAQKIAEFLAQDPNVI-----A 278

Query: 280 IYHSSLQT---EDFVKKQLEGGY-GPVFSIVLKSKVQ-CKKLPGKLELFQHATSLGGVES 334
           + +  L++    D VKKQ   G  G + S  +K   +   K   K  LF  A SLGG+ES
Sbjct: 279 VNYPGLESHPNRDIVKKQHRDGLGGGMISFRIKGGAEGASKFTQKTRLFTLAESLGGIES 338

Query: 335 LVEWRA-LTDPYIEQT----------LIRVSVGCEGVEDLIKDLAGAL 371
           L+E  A +T   I +           L+R+SVG E V+DL+ D+  AL
Sbjct: 339 LLEVPAVMTHGGIPKEAREATGVYDDLVRLSVGIEDVDDLLADVKQAL 386

>YAL012W Chr1 (130799..131983) [1185 bp, 394 aa] {ON}
           CYS3Cystathionine gamma-lyase, catalyzes one of the two
           reactions involved in the transsulfuration pathway that
           yields cysteine from homocysteine with the intermediary
           formation of cystathionine
          Length = 394

 Score =  129 bits (325), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 117/397 (29%), Positives = 192/397 (48%), Gaps = 45/397 (11%)

Query: 6   TTLIHADDKDNRVTDIVSPINVATTFRYDNNNLIAWNDRENYDFLETTPVYSRLAHPNAT 65
           T  IHA +  +    ++ PI+++TTF+  +      N    Y+       YSR  +PN  
Sbjct: 11  TKAIHAGEHVDVHGSVIEPISLSTTFKQSS----PANPIGTYE-------YSRSQNPNRE 59

Query: 66  RLESIFSEILGG-HAVIYSSGLAAYFATLTHYNPK---KLFIGQSYHGCH----GIADIF 117
            LE   + +    + + +SSG +A  AT+    P+    + IG  Y G H     +A+  
Sbjct: 60  NLERAVAALENAQYGLAFSSG-SATTATILQSLPQGSHAVSIGDVYGGTHRYFTKVANAH 118

Query: 118 TRNNGMKQYPLDRIEELASEG-DIVHLETPVNPFGTSYDIEDFAR--KAHAKG--ALLVI 172
                     L+ + +L  E   +V +ETP NP     DI+  A   K HA G   +LV+
Sbjct: 119 GVETSFTNDLLNDLPQLIKENTKLVWIETPTNPTLKVTDIQKVADLIKKHAAGQDVILVV 178

Query: 173 DSTFAPPPLQDVWKFGADVVIHSCTKYFGGHSDLLSGVVVVKSLEVAKKMKNDRIYLGTN 232
           D+TF  P + +   FGAD+V+HS TKY  GHSD++ GV+   +  + ++++  +  +G  
Sbjct: 179 DNTFLSPYISNPLNFGADIVVHSATKYINGHSDVVLGVLATNNKPLYERLQFLQNAIGAI 238

Query: 233 IANLESYLLLRSLRTFEMRVRKQSENATALVKYLDDHKSEFNKVLDKIYHSSLQTE---D 289
            +  +++L  R L+T  +RVR+ + +A  + ++L   K      +  + +  L+T    D
Sbjct: 239 PSPFDAWLTHRGLKTLHLRVRQAALSANKIAEFLAADKEN----VVAVNYPGLKTHPNYD 294

Query: 290 FVKKQLEGGY-GPVFSIVLKSKVQ-CKKLPGKLELFQHATSLGGVESLVEWRA-LTDPYI 346
            V KQ      G + S  +K   +   K      LF  A SLGG+ESL+E  A +T   I
Sbjct: 295 VVLKQHRDALGGGMISFRIKGGAEAASKFASSTRLFTLAESLGGIESLLEVPAVMTHGGI 354

Query: 347 EQT----------LIRVSVGCEGVEDLIKDLAGALKQ 373
            +           L+R+SVG E  +DL++D+  ALKQ
Sbjct: 355 PKEAREASGVFDDLVRISVGIEDTDDLLEDIKQALKQ 391

>NCAS0F01520 Chr6 complement(303410..304699) [1290 bp, 429 aa] {ON}
           Anc_7.97 YAL012W
          Length = 429

 Score =  130 bits (326), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 120/400 (30%), Positives = 195/400 (48%), Gaps = 56/400 (14%)

Query: 6   TTLIHADDKDNRVTDIVSPINVATTFRYDNNNLIAWNDRENYDFLETTPVYSRLAHPNAT 65
           T  IHA    +    ++ PI+++TTF+  +      N    Y+       YSR  +PN  
Sbjct: 48  TKAIHAGTHTDVHGSVIEPISLSTTFKQSS----PANPVGIYE-------YSRSQNPNRE 96

Query: 66  RLESIFSEILGG-HAVIYSSGLAAYFATLTHYNPK---KLFIGQSYHG----------CH 111
            LE+  + +  G + + +SSG +A  AT+    P+    + IG  Y G           H
Sbjct: 97  NLENAIAALENGKYGLAFSSG-SATTATVLQSLPQGSHAISIGDVYGGTHRYFTKVANAH 155

Query: 112 GIADIFTRNNGMKQYPLDRIEELASEGDIVHLETPVNPFGTSYDIEDFAR--KAHAKGAL 169
           G+   FT N+ +K+ P + ++E      +V +E+P NP     DI+  A   K+  K  +
Sbjct: 156 GVETTFT-NDLLKELP-NLVKE---NTKLVWIESPTNPTLKVTDIQAVADAIKSLNKDII 210

Query: 170 LVIDSTFAPPPLQDVWKFGADVVIHSCTKYFGGHSDLLSGVVVVKSLEVAKKMKNDRIYL 229
           LV+D+TF  P L +   FGAD+V+HS TKY  GHSD++ GV+      + +K++  +  +
Sbjct: 211 LVVDNTFLSPYLSNPLDFGADIVVHSATKYINGHSDVVLGVLATNDKALYEKLQFLQNAI 270

Query: 230 GTNIANLESYLLLRSLRTFEMRVRKQSENATALVKYLDDHKSEFNKVLDKIYHSSLQTED 289
           G   +  +S+L  R L+T  +RVR+ S NAT + ++L     + + ++  + +  L T +
Sbjct: 271 GAIPSPFDSWLAHRGLKTLHLRVRQASLNATKIAQFL-----QSSPLVKAVNYPGLPTHE 325

Query: 290 ---FVKKQLE---GGYGPVFSIVLKSKVQCKKLPGKLELFQHATSLGGVESLVEWRALTD 343
               V+KQ     GG    F I   S+    K      LF  A SLGG+ESL+E  A+  
Sbjct: 326 NYAVVQKQHREALGGGMISFRIQGGSEA-ASKFSSSTRLFTLAESLGGIESLLEVPAVMT 384

Query: 344 -----------PYIEQTLIRVSVGCEGVEDLIKDLAGALK 372
                        +   L+R+SVG E  +DL+ D+  AL+
Sbjct: 385 HGGIPKEAREASGVYDDLVRLSVGIEDGDDLLDDIKQALE 424

>Kpol_1044.10 s1044 (19232..20407) [1176 bp, 391 aa] {ON}
           (19232..20407) [1176 nt, 392 aa]
          Length = 391

 Score =  129 bits (324), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 117/401 (29%), Positives = 190/401 (47%), Gaps = 58/401 (14%)

Query: 6   TTLIHADDKDNRVTDIVSPINVATTFRYDNNNLIAWNDRENYDFLETTPV----YSRLAH 61
           T  IHA    +    ++ PI+++TTF+                     P+    YSR  +
Sbjct: 11  TKAIHAGSHVDVHGSVIEPISLSTTFKQS---------------APAQPIGEYEYSRSQN 55

Query: 62  PNATRLESIFSEILGG-HAVIYSSGLAAYFATLTHY--NPKKLFIGQSYHGCH------- 111
           PN   LE   + +  G + + +SSG A     L         + IG  Y G H       
Sbjct: 56  PNRKNLEDAIAALENGKYGLAFSSGSATTSVILQSLPQGSHAVSIGDVYGGTHRYFTKVA 115

Query: 112 ---GIADIFTRNNGMKQYPLDRIEELASEGDIVHLETPVNPFGTSYDIEDFAR--KAHAK 166
              G+   FT NN +++ P    + +     +V +E+P NP     DI   ++  K+  K
Sbjct: 116 NTHGVETTFT-NNLVEELP----QLIKENTRLVWIESPTNPTLKVTDIGLVSQTIKSLKK 170

Query: 167 GALLVIDSTFAPPPLQDVWKFGADVVIHSCTKYFGGHSDLLSGVVVVKSLEVAKKMKNDR 226
             +LV+D+TF  P L +   FGAD+V+HS TKY  GHSD++ GV+     ++ ++++  +
Sbjct: 171 DIILVVDNTFLSPYLSNPLNFGADIVVHSATKYINGHSDVVLGVLATNDKDIYERLQFLQ 230

Query: 227 IYLGTNIANLESYLLLRSLRTFEMRVRKQSENATALVKYLDDHKSEFNKVLDKIYHSSLQ 286
             +G   +  +S+L+ R L+T  +RVR+ + NAT + ++L  +++    V+   Y     
Sbjct: 231 NAIGAIPSPFDSWLVHRGLKTLHLRVRQAALNATKIAEFLASNEN----VIAVNYPGLPS 286

Query: 287 TEDF--VKKQLEGGY-GPVFSIVLKSKVQ-CKKLPGKLELFQHATSLGGVESLVEWRA-L 341
           +E+F  VKKQ      G + S  +K   +   K      LF  A SLGG+ESL+E  A +
Sbjct: 287 SENFEVVKKQHRDALGGGMISFRIKGGAEAASKFSSSTRLFTLAESLGGIESLLEVPAVM 346

Query: 342 TDPYIEQT----------LIRVSVGCEGVEDLIKDLAGALK 372
           T   I +           LIR+SVG E  +DL+ D+  AL+
Sbjct: 347 THGGIPKEQREASGVFDDLIRLSVGIEDSDDLLDDIKQALQ 387

>ZYRO0D05742g Chr4 (489953..491128) [1176 bp, 391 aa] {ON} highly
           similar to uniprot|P31373 Saccharomyces cerevisiae
           YAL012W CYS3 Cystathionine gamma-lyase catalyzes one of
           the two reactions involved in the transsulfuration
           pathway that yields cysteine from homocysteine with the
           intermediary formation of cystathionine
          Length = 391

 Score =  127 bits (319), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 116/393 (29%), Positives = 190/393 (48%), Gaps = 42/393 (10%)

Query: 6   TTLIHADDKDNRVTDIVSPINVATTFRYDNNNLIAWNDRENYDFLETTPVYSRLAHPNAT 65
           T  IHA    +    ++ PI+++TTF+              Y+       YSR  +PN  
Sbjct: 11  TKAIHAGAHVDVHGSVIEPISLSTTFKQS----APAQPLGEYE-------YSRSQNPNRK 59

Query: 66  RLESIFSEILGG-HAVIYSSGLAAYFATLTHYNPK---KLFIGQSYHGCHGIADIFTRNN 121
            LE   + +  G H + +SSG +A  A +    P+    + IG  Y G H         +
Sbjct: 60  NLEDAIASLENGKHGLAFSSG-SATTAVILQSLPQGSHAISIGDVYGGTHRYFTKVANAH 118

Query: 122 GMK-QYPLDRIEELAS----EGDIVHLETPVNPFGTSYDIEDFAR--KAHAKGALLVIDS 174
           G+   +  + +++L S       ++ +E+P NP     DI    +  K   K  L+V+D+
Sbjct: 119 GVDVSFTNELVKDLPSLVKPNTKLLWIESPTNPTLQVTDIALVNKTVKELNKDILVVVDN 178

Query: 175 TFAPPPLQDVWKFGADVVIHSCTKYFGGHSDLLSGVVVVKSLEVAKKMKNDRIYLGTNIA 234
           TF  P L +   FG DVV+HS TKY  GHSD++ GV+   S E+ ++++  +  +G   +
Sbjct: 179 TFLSPYLSNPLDFGVDVVVHSATKYINGHSDVVLGVLATNSTELYERLQFLQNAIGAIPS 238

Query: 235 NLESYLLLRSLRTFEMRVRKQSENATALVKYLDDHKSEFNKVLDKIYH--SSLQTEDFVK 292
             +++L  R L+T  +RVR+ +  AT + ++L  +    ++V+   Y   +S  + D V+
Sbjct: 239 PFDAWLAHRGLKTLHLRVRQAATTATKIAEFLQSN----DRVIAVNYPGLASHPSHDVVQ 294

Query: 293 KQLEGGY-GPVFSIVLKSKVQ-CKKLPGKLELFQHATSLGGVESLVEWRA-LTDPYIEQ- 348
           +Q   G  G + S  +K   +   K      LF  A SLGG+ESL+E  A +T   I + 
Sbjct: 295 RQHRDGLGGGMISFRIKGGAEGAAKFSSNTRLFTLAESLGGIESLLEVPAVMTHGGIPED 354

Query: 349 ---------TLIRVSVGCEGVEDLIKDLAGALK 372
                     LIR+SVG E  EDL++D+  ALK
Sbjct: 355 QREASGVYDDLIRLSVGIEDTEDLLEDIKQALK 387

>KLLA0F07909g Chr6 (742468..743643) [1176 bp, 391 aa] {ON} highly
           similar to uniprot|P31373 Saccharomyces cerevisiae
           YAL012W CYS3 Cystathionine gamma-lyase catalyzes one of
           the two reactions involved in the transsulfuration
           pathway that yields cysteine from homocysteine with the
           intermediary formation of cystathionine
          Length = 391

 Score =  126 bits (317), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 119/402 (29%), Positives = 190/402 (47%), Gaps = 62/402 (15%)

Query: 6   TTLIHADDKDNRVTDIVSPINVATTFRYDNNNLIAWNDRENYDFLETTPV----YSRLAH 61
           T  IHA    +    ++ PI+++TTF+                     P+    YSR  +
Sbjct: 11  TKAIHAGTHVDVHGSVIEPISLSTTFKQS---------------APAQPIGEYEYSRSQN 55

Query: 62  PNATRLESIFSEILGG-HAVIYSSGLAAYFATLTHYNPK---KLFIGQSYHG-------- 109
           PN   LE   + +  G + + +SSG +A  A +    P+    + IG  Y G        
Sbjct: 56  PNRKNLEDAIAALENGKYGLAFSSG-SATTAVILQSLPQGSHAVSIGDVYGGTHRYFTKV 114

Query: 110 --CHGIADIFTRNNGMKQYPLDRIEELASEGDIVHLETPVNPFGTSYDIEDFARKAHA-- 165
              HG+   FT NN + + P   I+E      +V +ETP NP     DIE  A+ A +  
Sbjct: 115 ANAHGVETTFT-NNLVAELP-SLIKE---NTKLVWIETPTNPTLKVTDIELVAKTAKSIN 169

Query: 166 KGALLVIDSTFAPPPLQDVWKFGADVVIHSCTKYFGGHSDLLSGVVVVKSLEVAKKMKND 225
           K  LLV+D+TF  P L +   FGAD+V+HS TKY  GHSD++ GV+      + +K++  
Sbjct: 170 KDILLVVDNTFLSPYLSNPLNFGADIVVHSATKYINGHSDVVLGVLATNDKVIYEKLQFL 229

Query: 226 RIYLGTNIANLESYLLLRSLRTFEMRVRKQSENATALVKYLDDHKSEFNKVLDKIYHSSL 285
           +  +G   +  +S+L+ R ++T  +RVR+ S +A  + ++L       N+ +  + +  L
Sbjct: 230 QNAIGAIPSPFDSWLVHRGVKTLHLRVRQASLSAHKIAEFLSS-----NENVIAVNYPGL 284

Query: 286 QTED---FVKKQLEGGY-GPVFSIVLKSKVQCKK-LPGKLELFQHATSLGGVESLVEWRA 340
            T +    VKKQ      G + S  +K   +          LF  A SLGG+ESL+E  A
Sbjct: 285 PTHESYAVVKKQHRDALGGGMISFRIKGGAEAASTFSSSTRLFTLAESLGGIESLLEVPA 344

Query: 341 -LTDPYIEQT----------LIRVSVGCEGVEDLIKDLAGAL 371
            +T   I +           L+R+S+G E  +DL++D+  AL
Sbjct: 345 VMTHGGIPKEQREASGVYDDLVRLSIGIEDTDDLLEDIKQAL 386

>AEL341W Chr5 (9428..10609) [1182 bp, 393 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YAL012W (CYS3)
          Length = 393

 Score =  125 bits (313), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 114/391 (29%), Positives = 188/391 (48%), Gaps = 38/391 (9%)

Query: 6   TTLIHADDKDNRVTDIVSPINVATTFRYDNNNLIAWNDRENYDFLETTPVYSRLAHPNAT 65
           T  IHA    +    ++ PI+++TTF+  +      N    Y+       YSR  +PN  
Sbjct: 11  TKAIHAGAHTDLHGSVIEPISLSTTFKQSSPG----NPVGAYE-------YSRGQNPNRQ 59

Query: 66  RLESIFSEILGG-HAVIYSSGLAAYFATLTHYNPK---KLFIGQSYHGCH----GIADIF 117
            LE   + +    + + +SSG +A  A +    P+    + IG  Y G H     +A+  
Sbjct: 60  NLEEAIAALESAKYGLAFSSG-SATTAVIVQSLPQGSHAISIGDVYGGTHRYFTKVANAH 118

Query: 118 TRNNGMKQYPLDRIEELASEGD-IVHLETPVNPFGTSYDIEDFAR--KAHAKGALLVIDS 174
                     L+ + +L  +   +V +E+P NP     DI+  A   KA  +  +LV+D+
Sbjct: 119 GVETSFTNSLLEDLPKLVRDNTRLVWIESPTNPTLQVTDIQQVADTVKALNEDIILVVDN 178

Query: 175 TFAPPPLQDVWKFGADVVIHSCTKYFGGHSDLLSGVVVVKSLEVAKKMKNDRIYLGTNIA 234
           TF  P L +   FGAD+VIHS TKY  GHSD++ G +   S  + +++   +  +G   +
Sbjct: 179 TFLSPYLSNPLNFGADIVIHSATKYINGHSDVVLGALATNSTSLYERLAFLQNAIGAIPS 238

Query: 235 NLESYLLLRSLRTFEMRVRKQSENATALVKYLDDHKSEFNKVLDKIYHSSLQTEDFVKKQ 294
             +++L  R L+T  +RVR+ +++A  + +YL+  +SE    ++     S +     +KQ
Sbjct: 239 PFDAWLTHRGLKTLHLRVRQAAQSAQKIAEYLE--QSEHVVSVNYPGLPSHRGYQIAQKQ 296

Query: 295 LEGGY-GPVFSIVLKSKVQCKKLPGK-LELFQHATSLGGVESLVEWRA-LTDPYIEQT-- 349
              G  G + S  +K   Q   L  +   LF  A SLGG+ESL+E  A +T   I +   
Sbjct: 297 HRDGLGGGMISFRVKGGAQGAALLSQSTRLFTLAESLGGIESLLEVPAVMTHAGIPKEAR 356

Query: 350 --------LIRVSVGCEGVEDLIKDLAGALK 372
                   L+RVSVG E  +DL++D+  AL 
Sbjct: 357 EASGVYDDLVRVSVGIEDTDDLLEDIKQALS 387

>SAKL0B09614g Chr2 complement(813507..814685) [1179 bp, 392 aa] {ON}
           highly similar to uniprot|P31373 Saccharomyces
           cerevisiae YAL012W CYS3 Cystathionine gamma-lyase
           catalyzes one of the two reactions involved in the
           transsulfuration pathway that yields cysteine from
           homocysteine with the intermediary formation of
           cystathionine
          Length = 392

 Score =  124 bits (312), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 116/407 (28%), Positives = 191/407 (46%), Gaps = 70/407 (17%)

Query: 6   TTLIHADDKDNRVTDIVSPINVATTFRYDNNNLIAWNDRENYDFLETTPV-------YSR 58
           T  IHA    +    ++ PI+++TTF+                  +T P        YSR
Sbjct: 11  TKAIHAGAHTDVHGSVIEPISLSTTFK------------------QTAPAQPVGEYEYSR 52

Query: 59  LAHPNATRLESIFSEILGG-HAVIYSSGLAAYFATLTHYNPK---KLFIGQSYHG----- 109
             +PN   LE   + +    + + +SSG +A  A +    P+    + IG  Y G     
Sbjct: 53  SQNPNRKNLEDAVAALENAKYGLAFSSG-SATTAVVLQSLPQGSHAVSIGDVYGGTHRYF 111

Query: 110 -----CHGIADIFTRNNGMKQYPLDRIEELASEGD-IVHLETPVNPFGTSYDIEDFAR-- 161
                 HG+   FT N       ++ + +L  E   +V +E+P NP     DIE  ++  
Sbjct: 112 TKVANAHGVETTFTNN------LVEDLAQLVKENTRLVWIESPTNPTLKVTDIELVSKTI 165

Query: 162 KAHAKGALLVIDSTFAPPPLQDVWKFGADVVIHSCTKYFGGHSDLLSGVVVVKSLEVAKK 221
           K+  K  LLV+D+TF  P L +   FGAD+V+HS TKY  GHSD++ GV+     E+ ++
Sbjct: 166 KSINKDILLVVDNTFLSPYLSNPLNFGADIVVHSATKYINGHSDVVLGVLATNDKEIYER 225

Query: 222 MKNDRIYLGTNIANLESYLLLRSLRTFEMRVRKQSENATALVKYLDDHKSEFNKVLDKIY 281
           ++  +  +G   +  +++L  R L+T  +RVR+ +  AT + ++L    S+   V+  + 
Sbjct: 226 LQFLQNAIGAIPSPFDAWLSHRGLKTLHLRVRQAATTATKIAEFL----SQSEDVV-AVN 280

Query: 282 HSSLQTED----FVKKQLEGGYGPVFSIVLKSKVQ-CKKLPGKLELFQHATSLGGVESLV 336
           +  L T       +K+  +G  G + S  +K   +   K      LF  A SLGG+ESL+
Sbjct: 281 YPGLPTHPNHNVVLKQHRDGLGGGMISFRIKGGAEAAAKFSSSTRLFTLAESLGGIESLL 340

Query: 337 EWRA-LTDPYIEQ----------TLIRVSVGCEGVEDLIKDLAGALK 372
           E  A +T   I +           LIR+S+G E  +DL+ D+  AL+
Sbjct: 341 EVPAVMTHGGIPKDQREASGVFDDLIRLSIGIEDTDDLLDDIKQALE 387

>KNAG0D04740 Chr4 complement(851405..852577) [1173 bp, 390 aa] {ON}
           Anc_7.97 YAL012W
          Length = 390

 Score =  122 bits (305), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 112/398 (28%), Positives = 185/398 (46%), Gaps = 52/398 (13%)

Query: 6   TTLIHADDKDNRVTDIVSPINVATTFRYDNNNLIAWNDRENYDFLETTPVYSRLAHPNAT 65
           T  +HA +  +    ++ PI+++TTF+  +      N    Y+       YSR  +PN  
Sbjct: 9   TLAVHAGEHTDVHGSVIEPISLSTTFKQSS----PANPIGVYE-------YSRSQNPNRD 57

Query: 66  RLESIFSEI-LGGHAVIYSSGLAAYFATLTHY--NPKKLFIGQSYHGCH----------G 112
            LE+  + +    + + +SSG AA    +         + IG  Y G H          G
Sbjct: 58  NLENAIAALEKAQYGLAFSSGSAATSVIMQSLPQGSHAVSIGDVYGGTHRYFTKVANTHG 117

Query: 113 IADIFTRNNGMKQYPLDRIEELASEGDIVHLETPVNPFGTSYDIEDF--ARKAHAKGALL 170
           +   FT NN +++ P      +     +V +E+P NP     DI+    A K   K  LL
Sbjct: 118 VETTFT-NNLLEELP----NLVKDNTRLVWIESPTNPTLKVTDIQAVSNAIKKINKDILL 172

Query: 171 VIDSTFAPPPLQDVWKFGADVVIHSCTKYFGGHSDLLSGVVVVKSLEVAKKMKNDRIYLG 230
           V+D+TF  P L +   FGAD+V+HS TKY  GHSD++ GV+   S ++ ++++  +  +G
Sbjct: 173 VVDNTFLSPYLSNPLTFGADIVVHSATKYINGHSDVVLGVLATNSKDIYERLQFLQNAIG 232

Query: 231 TNIANLESYLLLRSLRTFEMRVRKQSENATALVKYLDDHKSEFNKVLDKIYHSSLQTED- 289
              +  +++L  R L+T  +RV++ S  A  + ++L   K      ++ + +  L+T   
Sbjct: 233 AIPSPFDAWLTHRGLKTLHLRVKQASVTAQKIAEFLSASKH-----VEAVNYPGLKTHPN 287

Query: 290 --FVKKQLEG--GYGPVFSIVLKSKVQCKKLPGKLELFQHATSLGGVESLVEWRALTD-- 343
              V++Q     G G +   V        K      LF  A SLGG+ESL+E  A+    
Sbjct: 288 HAVVQRQHRDALGGGMISFRVKGGAAAAAKFSSTTRLFTLAESLGGIESLLEVPAVMTHG 347

Query: 344 ---------PYIEQTLIRVSVGCEGVEDLIKDLAGALK 372
                      +   LIR+SVG E  EDL++D+  AL+
Sbjct: 348 GIPKESREASGVYDNLIRLSVGIEDTEDLLEDIKQALE 385

>KLTH0D02728g Chr4 (267019..268197) [1179 bp, 392 aa] {ON} highly
           similar to uniprot|P31373 Saccharomyces cerevisiae
           YAL012W CYS3 Cystathionine gamma-lyase catalyzes one of
           the two reactions involved in the transsulfuration
           pathway that yields cysteine from homocysteine with the
           intermediary formation of cystathionine
          Length = 392

 Score =  120 bits (300), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 114/411 (27%), Positives = 184/411 (44%), Gaps = 61/411 (14%)

Query: 1   MVSLP-----TTLIHADDKDNRVTDIVSPINVATTFRYDNNNLIAWNDRENYDFLETTPV 55
           M  LP     T  IHA    +    ++ PI+++TTF+                     P+
Sbjct: 1   MTVLPSDKFATLAIHAGAHTDVHGSVIEPISLSTTFKQS---------------APAQPI 45

Query: 56  ----YSRLAHPNATRLESIFSEILGGH-AVIYSSGLAAYFATLTHY--NPKKLFIGQSYH 108
               YSR  +PN   LE+  + +      + +SSG A     L     +   + IG  Y 
Sbjct: 46  GAYEYSRSQNPNRANLEAAVAALERAQFGLAFSSGSATTAVVLQSLPTDSHAISIGDVYG 105

Query: 109 GCHGIADIFTRNNGMKQYPLDRIEE-----LASEGDIVHLETPVNPFGTSYDIEDFARKA 163
           G H         +G++    + +E      +     +V LE+P NP     DI   A  A
Sbjct: 106 GTHRYFTQVAHAHGVQTSFTNDLERDLPQLVRPNTRLVWLESPTNPTLKVTDIRRVADAA 165

Query: 164 HAKGA--LLVIDSTFAPPPLQDVWKFGADVVIHSCTKYFGGHSDLLSGVVVVKSLEVAKK 221
           HA     L+V+D+TF  P + +    GAD+V+HS TKY  GHSD++ GV+   +  + ++
Sbjct: 166 HAANPDILVVVDNTFLSPYISNPLTHGADIVVHSATKYINGHSDVVLGVLATNNEPLYER 225

Query: 222 MKNDRIYLGTNIANLESYLLLRSLRTFEMRVRKQSENATALVKYLDDHKSEFNKVLDKIY 281
           ++  +  +G   +  +S+L  R L+T  +RVR  +++A  + K+L+          D++ 
Sbjct: 226 LRFLQNAIGAVPSPFDSWLTHRGLKTLHLRVRAAAQSAQRIAKFLE--------ASDRVE 277

Query: 282 H------SSLQTEDFVKKQLEGGY-GPVFSIVLKSKV-QCKKLPGKLELFQHATSLGGVE 333
           H      SS      V+KQ      G + S  +K       +      LF  A SLGG+E
Sbjct: 278 HVNYPGLSSHPAYAVVQKQHRDALGGGMISFRIKGGAGAAARFTSTTRLFTLAESLGGIE 337

Query: 334 SLVEWRA-LTDPYIEQ----------TLIRVSVGCEGVEDLIKDLAGALKQ 373
           SLVE  A +T   I +           LIR+SVG E ++DL++D+  AL++
Sbjct: 338 SLVEVPAVMTHGGIPREQREASGVFDNLIRLSVGIEDIDDLLEDVRQALEK 388

>TDEL0H03530 Chr8 complement(586031..587206) [1176 bp, 391 aa] {ON}
           Anc_7.97 YAL012W
          Length = 391

 Score =  118 bits (296), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 113/392 (28%), Positives = 184/392 (46%), Gaps = 42/392 (10%)

Query: 6   TTLIHADDKDNRVTDIVSPINVATTFRYDNNNLIAWNDRENYDFLETTPVYSRLAHPNAT 65
           T  IHA    +    ++ PI+++TTF+  ++      + E          YSR  +PN  
Sbjct: 11  TKAIHAGAHVDIHGSVIEPISLSTTFK-QSSPAAPLGEYE----------YSRSQNPNRK 59

Query: 66  RLESIFSEILGG-HAVIYSSGLAAYFATLTHYNPK---KLFIGQSYHGCHGIADIFTRNN 121
            LE   + +    + + +SSG +A  A +    P+    + IG  Y G H         +
Sbjct: 60  NLEEALAALENAKYGLAFSSG-SATTAVVLQSLPQGSHAVSIGDVYGGTHRYFTKVANAH 118

Query: 122 GM-KQYPLDRIEELAS----EGDIVHLETPVNPFGTSYDIEDFARKAHA--KGALLVIDS 174
           G+   +  D I++L S       +V +E+P NP     DI    + A    K  L+V+D+
Sbjct: 119 GVDTSFTNDLIKDLPSLIKENTKLVWIESPTNPTLKVTDIALVVKTAKQINKEILVVVDN 178

Query: 175 TFAPPPLQDVWKFGADVVIHSCTKYFGGHSDLLSGVVVVKSLEVAKKMKNDRIYLGTNIA 234
           TF  P L +   FG D+V+HS TKY  GHSD++ GV+      + +K++  +  +G   +
Sbjct: 179 TFLSPYLSNPLNFGVDIVVHSATKYINGHSDVVLGVLATNDKAIYEKLQFLQNAIGAIPS 238

Query: 235 NLESYLLLRSLRTFEMRVRKQSENATALVKYLDDHKSEFNKVLDKIYH--SSLQTEDFVK 292
             +S+L  R L+T  +RVR+ +  AT + ++L+    + + VL   Y   +S    + V+
Sbjct: 239 PFDSWLAHRGLKTLHLRVRQAALTATKIAEFLE----QDSNVLAVNYPGLASNPDREIVQ 294

Query: 293 KQLEGGY-GPVFSIVLKSKVQ-CKKLPGKLELFQHATSLGGVESLVEWRALTD------- 343
           +Q   G  G + S  +K   Q   K      LF  A SLGG+ESL+E  A+         
Sbjct: 295 RQHRDGLGGGMISFRIKGGAQAAAKFSSSTRLFTLAESLGGIESLLEVPAVMTHGGIPKE 354

Query: 344 ----PYIEQTLIRVSVGCEGVEDLIKDLAGAL 371
                 +   LIR+SVG E  +DL+ D+  AL
Sbjct: 355 QREASGVYDDLIRLSVGIEDSDDLLTDIKEAL 386

>CAGL0L06094g Chr12 (693250..694602) [1353 bp, 450 aa] {ON} similar
           to uniprot|P53101 Saccharomyces cerevisiae YGL184c
          Length = 450

 Score =  110 bits (275), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 110/392 (28%), Positives = 178/392 (45%), Gaps = 55/392 (14%)

Query: 22  VSPINVATTFRYDNNNLIAWNDRENYDFLETTPVYSRLAHPNATRLES----IFSEILGG 77
           V+P+ ++TTF+ D       N+   YD       YSR  +P  T L+     ++ +I   
Sbjct: 9   VAPLYLSTTFKVD-----LENENNQYD-------YSRSGNPTRTLLQQQVAKLYDDIDPN 56

Query: 78  HAVIYSSGLAAYFATLTHYNPKK-----LFIGQS-YHGCHGIADIFTRNNGMKQYPLDRI 131
                SSG+ A    L  + P +     +  G   Y G   + ++   +     + L   
Sbjct: 57  FVFAVSSGMTALDVVLRSFLPSETNNHCIIAGDDLYGGTQRLLNLLKISIDTMHFDLSHT 116

Query: 132 EELASEG-----------DIVHLETPVNPFGTSYDIE---DFARKAHAKGALLVIDSTFA 177
           E   ++            DI+ LE+P NP     DI     F RK ++   L+VID+T  
Sbjct: 117 ENFKAKFYDLVTIKKTIVDIIVLESPTNPLCKIIDIPHLIKFIRK-YSPETLIVIDNTMM 175

Query: 178 PPPLQDVWKFGADVVIHSCTKYFGGHSDLLSGVVVVKSLEVAKKMKNDRIYLGTNIANLE 237
                +  KFGADVV  S TKY  GH D+++GV++ K+  +A+K+       G+ +  ++
Sbjct: 176 SGLNCNPLKFGADVVYESATKYLNGHHDIMAGVIIAKNKLLAEKIYFLINSTGSGLNPMD 235

Query: 238 SYLLLRSLRTFEMRVRKQSENATALVKYLDD---HKSEFNKVLDKIYHSSLQTE-DF-VK 292
           S+LL+R L+T  +R+ KQ  NA A+  +L++    K+  N    K  +  L++  D+ + 
Sbjct: 236 SWLLIRGLKTLSIRLHKQQLNALAISHWLEEGCGFKTHNNNNNLKTRYIGLKSHPDYELH 295

Query: 293 KQLEGGYGPVFSIVLKSKVQCKKLPGK--LELFQHATSLGGVESLVEWRALT-----DPY 345
           +    G G V S+   S    KK+     L+L+    S G V SL+    L      DP 
Sbjct: 296 RSFNKGPGAVISLQTGSIPISKKIVASKLLKLWNVTVSFGCVNSLISMPCLMSHASIDPE 355

Query: 346 IE------QTLIRVSVGCEGVEDLIKDLAGAL 371
           +       + LIR+  G E V+ L +DL GA 
Sbjct: 356 LRKERQFPEDLIRLCCGIEDVKALQEDLLGAF 387

>Smik_7.89 Chr7 complement(149314..150711) [1398 bp, 465 aa] {ON}
           YGL184C (REAL)
          Length = 465

 Score =  108 bits (271), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 109/413 (26%), Positives = 181/413 (43%), Gaps = 57/413 (13%)

Query: 3   SLPTTLIHADDKDNRVTDIVSPINVATTFRYDNNNLIAWNDRENYDFLETTPVYSRLAHP 62
           +L T +++   ++++ +  V P+ ++TTF+ D +N  A    ++YD       YSR  +P
Sbjct: 5   TLDTVVVNTGSQNDQHSASVPPVYLSTTFKVDLSNETA----QDYD-------YSRSGNP 53

Query: 63  NATRLESIFSEIL---GGHAVIYSSGLAAY---------FATLTHYNPKKLFIGQSYHGC 110
             + L++   ++      + +  SSG+ A          F    ++ P  +     Y G 
Sbjct: 54  TRSVLQNQIGKLYRVPQENVLAVSSGMTALDIILRGLVLFNGTDNHTPTIIAGDDLYGGT 113

Query: 111 HGIADIFTRNNGMKQYPLDR--------IEELASEGDIVHLETPVNPFGTSYDIEDFAR- 161
             + + F + +      +D         + +   + D V LE+P NP     DI    R 
Sbjct: 114 QRLLNFFKQQSHAVSVHVDTSDFEKFKTVFQSLDKVDCVLLESPTNPLCKVVDIPRILRF 173

Query: 162 -KAHAKGALLVIDSTFAP----PPLQDVWKFGADVVIHSCTKYFGGHSDLLSGVVVVKSL 216
            K  +    +V+D+T        PLQ     G DVV  S TKY  GH DL+ GV++ K+ 
Sbjct: 174 VKCISPETTVVVDNTMMSGLNCNPLQ--LDPGCDVVYESATKYLNGHHDLMGGVIISKTA 231

Query: 217 EVAKKMKNDRIYLGTNIANLESYLLLRSLRTFEMRVRKQSENATALVKYLDD----HKSE 272
           E+A K+       G  ++ ++S+LL+R L+T  +R+ +Q  NA  L  +L+D      +E
Sbjct: 232 EIAAKLYFVVNSTGAGLSPMDSWLLVRGLKTLGVRLYQQQRNAMILAHWLEDSCGFKPTE 291

Query: 273 FNKVLDKIYHSSLQTEDF-VKKQLEGGYGPVFSIVLKSKVQCKKL--PGKLELFQHATSL 329
            NK     +       DF + +    G G V S    S    K+L    KL ++    S 
Sbjct: 292 TNKTTKTRFVGLRSNPDFKLHQSFNSGPGAVLSFETGSFEHSKRLVSSKKLSIWAVTVSF 351

Query: 330 GGVESLVEW-----RALTDPYIE------QTLIRVSVGCEGVEDLIKDLAGAL 371
           G V SL+        A  DP +       + LIR+  G E + DL KDL  A+
Sbjct: 352 GCVNSLLSMPCKMSHASIDPELRKERDFPEDLIRLCCGIENIVDLKKDLLAAM 404

>YGL184C Chr7 complement(154615..156012) [1398 bp, 465 aa] {ON}
           STR3Peroxisomal cystathionine beta-lyase, converts
           cystathionine into homocysteine; may be redox regulated
           by Gto1p
          Length = 465

 Score =  108 bits (271), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 109/412 (26%), Positives = 178/412 (43%), Gaps = 57/412 (13%)

Query: 4   LPTTLIHADDKDNRVTDIVSPINVATTFRYDNNNLIAWNDRENYDFLETTPVYSRLAHPN 63
           L T +++   ++++ +  V P+ ++TTF+ D NN     D +NYD       YSR  +P 
Sbjct: 6   LDTVVVNTGSQNDQHSASVPPVYLSTTFKVDLNN----EDAQNYD-------YSRSGNPT 54

Query: 64  ATRLESIFSEIL---GGHAVIYSSGLAAYFATLT---------HYNPKKLFIGQSYHGCH 111
            + L+    ++      + +  SSG+ A    L          ++ P  +     Y G  
Sbjct: 55  RSVLQHQIGKLYRVPQENVLAVSSGMTALDVILRGLVLLNGTDNHTPTIIAGDDLYGGTQ 114

Query: 112 GIADIFTRNNGMKQYPLDR--------IEELASEGDIVHLETPVNPFGTSYDIEDFAR-- 161
            + + F + +      +D         + +   + D V LE+P NP     DI    R  
Sbjct: 115 RLLNFFKQQSHAVSVHVDTSDFEKFKTVFQSLDKVDCVLLESPTNPLCKVVDIPRILRFV 174

Query: 162 KAHAKGALLVIDSTFAP----PPLQDVWKFGADVVIHSCTKYFGGHSDLLSGVVVVKSLE 217
           K  +    +V+D+T        PLQ     G DVV  S TKY  GH DL+ GV++ K+ E
Sbjct: 175 KCISPDTTVVVDNTMMSGLNCNPLQ--LNPGCDVVYESATKYLNGHHDLMGGVIISKTPE 232

Query: 218 VAKKMKNDRIYLGTNIANLESYLLLRSLRTFEMRVRKQSENATALVKYLDD----HKSEF 273
           +A K+       G  ++ ++S+LL+R L+T  +R+ +Q  NA  L  +L++      +  
Sbjct: 233 IASKLYFVINSTGAGLSPMDSWLLVRGLKTLGVRLYQQQRNAMILAHWLENSCGFKPTRT 292

Query: 274 NKVLDKIYHSSLQTEDF-VKKQLEGGYGPVFSIVLKSKVQCKKL--PGKLELFQHATSLG 330
           NK     +       DF + K    G G V S    S    K+L    KL ++    S G
Sbjct: 293 NKATKTRFVGLRSNPDFKLHKSFNNGPGAVLSFETGSFEHSKRLVSSKKLSIWAVTVSFG 352

Query: 331 GVESLVEW-----RALTDPYIE------QTLIRVSVGCEGVEDLIKDLAGAL 371
            V SL+        A  DP +       + L+R+  G E + DL KDL  A+
Sbjct: 353 CVNSLLSMPCKMSHASIDPELRKERDFPEDLVRLCCGIENIVDLKKDLLAAM 404

>Skud_7.88 Chr7 complement(160235..161632) [1398 bp, 465 aa] {ON}
           YGL184C (REAL)
          Length = 465

 Score =  106 bits (265), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 106/413 (25%), Positives = 179/413 (43%), Gaps = 57/413 (13%)

Query: 3   SLPTTLIHADDKDNRVTDIVSPINVATTFRYDNNNLIAWNDRENYDFLETTPVYSRLAHP 62
           +L T +++   ++++ +  V P+ ++TTF+ D NN  A    +N+D       YSR  +P
Sbjct: 5   TLDTVVVNTGSQNDQHSASVPPVYLSTTFKVDLNNEAA----QNFD-------YSRSGNP 53

Query: 63  NATRLESIFSEIL---GGHAVIYSSGLAAYFATLT---------HYNPKKLFIGQSYHGC 110
             + L++   ++      + +  SSG+ A    L          ++ P  +     Y G 
Sbjct: 54  TRSVLQNQIGKLYRVPQENVLAVSSGMTALDIILRGLVLLNGTDNHTPTIIAGDDLYGGT 113

Query: 111 HGIADIFTRNNGMKQYPLDR--------IEELASEGDIVHLETPVNPFGTSYDIEDFAR- 161
             + + F          +D         + +   + D V LE+P NP     DI    R 
Sbjct: 114 QRLLNFFKHQTHAVTAHVDTSDFEKFKTVFQSVDKVDCVLLESPTNPLCKVVDIPKILRF 173

Query: 162 -KAHAKGALLVIDSTFAP----PPLQDVWKFGADVVIHSCTKYFGGHSDLLSGVVVVKSL 216
            K  +   ++++D+T        PLQ       DVV  S TKY  GH DL+ GV++ K+ 
Sbjct: 174 VKRISPETIVIVDNTMMSGLNCNPLQ--LNPSCDVVYESATKYLNGHHDLMGGVIISKTP 231

Query: 217 EVAKKMKNDRIYLGTNIANLESYLLLRSLRTFEMRVRKQSENATALVKYLDD----HKSE 272
           E+A K+       G  ++ ++S+LL+R L+T  +R+ +Q  NA  L  +L++      +E
Sbjct: 232 EIASKLYFVVNSTGAGLSPMDSWLLVRGLKTLGVRLHQQQRNAMILAHWLENSCGFKPTE 291

Query: 273 FNKVLDKIYHSSLQTEDF-VKKQLEGGYGPVFSIVLKSKVQCKKL--PGKLELFQHATSL 329
            NK     +       DF + +    G G V S    S    K+L    KL ++    S 
Sbjct: 292 TNKATKTRFVGLRSNPDFKLHQSFNSGPGAVLSFETGSSEHSKRLVSSKKLNIWAVTVSF 351

Query: 330 GGVESLVEW-----RALTDPYIE------QTLIRVSVGCEGVEDLIKDLAGAL 371
           G V SL+        A  DP +       + L+R+  G E + DL KDL  A+
Sbjct: 352 GCVNSLLSMPCKMSHASIDPELRKERDFPEDLVRLCCGIENIVDLKKDLLAAM 404

>Suva_7.79 Chr7 complement(150082..151479) [1398 bp, 465 aa] {ON}
           YGL184C (REAL)
          Length = 465

 Score =  103 bits (256), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 107/413 (25%), Positives = 177/413 (42%), Gaps = 57/413 (13%)

Query: 3   SLPTTLIHADDKDNRVTDIVSPINVATTFRYDNNNLIAWNDRENYDFLETTPVYSRLAHP 62
           +L T +++   ++++ +  V P+ ++TTF+ D NN  A    ++YD       YSR  +P
Sbjct: 5   TLDTVVVNTGSQNDQHSASVPPVYLSTTFKVDLNNEAA----QDYD-------YSRSGNP 53

Query: 63  NATRLESIFSEIL---GGHAVIYSSGLAAYFATLT---------HYNPKKLFIGQSYHGC 110
             + L++   ++      + +  SSG+ A    L           + P  +     Y G 
Sbjct: 54  TRSVLQNQIGKLYRVPQENVLAVSSGMTALDIILRGLVLLNGTEDHTPTIIAGDDLYGGT 113

Query: 111 HGIADIFTRNNG-----MKQYPLDRIEEL---ASEGDIVHLETPVNPFGTSYDIEDFAR- 161
             + + F          +     DR + +     + D V LE+P NP     DI    R 
Sbjct: 114 QRLLNFFKHQTHAVTVHVDTSNFDRFKTVFQSLDKVDCVLLESPTNPLCKVVDIPKILRY 173

Query: 162 -KAHAKGALLVIDSTFAP----PPLQDVWKFGADVVIHSCTKYFGGHSDLLSGVVVVKSL 216
            K  +    +++D+T        PLQ       DVV  S TKY  GH DL+ GV++ K+ 
Sbjct: 174 VKCVSPDTKVIVDNTMMSGLNCNPLQ--LNPSCDVVYESATKYLNGHHDLMGGVIISKTA 231

Query: 217 EVAKKMKNDRIYLGTNIANLESYLLLRSLRTFEMRVRKQSENATALVKYLDD----HKSE 272
           E+A K+       G  ++ ++S+LL+R L+T  +R+ +Q  NA  L  +L+D      + 
Sbjct: 232 EIASKLYFVVNSTGAGLSPMDSWLLVRGLKTLGVRLHQQQRNAMILAHWLEDSCGFKPTA 291

Query: 273 FNKVLDKIYHSSLQTEDF-VKKQLEGGYGPVFSIVLKSKVQCKKL--PGKLELFQHATSL 329
            NK     +       DF + +    G G V S    S    K+L    KL ++    S 
Sbjct: 292 TNKATKTRFVGLRSNPDFKLHQSFNNGPGAVLSFETGSFEHSKRLVSSKKLNIWAVTVSF 351

Query: 330 GGVESLVEW-----RALTDPYIE------QTLIRVSVGCEGVEDLIKDLAGAL 371
           G V SL+        A  DP +       + L+R+  G E + DL KDL  A+
Sbjct: 352 GCVNSLLSMPCKMSHASIDPEVRKERDFPEDLVRLCCGIENIVDLKKDLLAAM 404

>ACL059C Chr3 complement(259732..261093) [1362 bp, 453 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL184C
           (STR3)
          Length = 453

 Score =  101 bits (252), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 80/257 (31%), Positives = 122/257 (47%), Gaps = 34/257 (13%)

Query: 143 LETPVNPFGTSYDIEDFAR--KAHAKGALLVIDSTFAPPPLQDVWKFGADVVIHSCTKYF 200
           LE+P NP     D+       KAHA G  +V+D+T       +  + GAD V  S TKY 
Sbjct: 148 LESPTNPLMKVADVPALVAHVKAHAPGCRVVVDNTMMSGLNCNPLRLGADYVYESATKYL 207

Query: 201 GGHSDLLSGVVVVKSLEVAKKMKNDRIYLGTNIANLESYLLLRSLRTFEMRVRKQSENAT 260
            GH D+++GV+V  +  +A++       +G  +A ++++LL+R L+T  +R+ KQ  NA 
Sbjct: 208 NGHHDIMAGVIVAATRALAEEAYFVVNSVGAGLAPMDAWLLIRGLKTLSLRLYKQQHNAM 267

Query: 261 ALVKYLDDHKSEFNKVLDKIYHSSLQT---------EDFVKKQLEGGYGPVFSI-----V 306
            L  +L +    F  V     + +LQT         +  + +    G G V SI      
Sbjct: 268 VLAHWLRE-VCGFRAVGG---NHALQTRFVGLRSHPQHKLHRSFNRGPGAVLSIQTGDTA 323

Query: 307 LKSKVQCKKLPGKLELFQHATSLGGVESLVEW-----RALTDPYIEQT------LIRVSV 355
           L  ++ C K   KL+ +    S G V SL+        A  DP + +       LIR+S 
Sbjct: 324 LSERIVCSK---KLQFWGVTVSFGCVNSLISMPCRMSHASIDPELRKARQFPEDLIRLSC 380

Query: 356 GCEGVEDLIKDLAGALK 372
           G E VEDL +DL  AL+
Sbjct: 381 GVEDVEDLQQDLLAALE 397

>ZYRO0G19162g Chr7 (1590120..1591487) [1368 bp, 455 aa] {ON} similar
           to uniprot|P53101 Saccharomyces cerevisiae YGL184C STR3
           Cystathionine beta-lyase converts cystathionine into
           homocysteine
          Length = 455

 Score =  100 bits (249), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 107/401 (26%), Positives = 171/401 (42%), Gaps = 76/401 (18%)

Query: 22  VSPINVATTFRYDNNNLIAWNDRENYDFLETTPVYSRLAHPNATRLESIFSEILGG---- 77
           V P+ ++TTF+ D       +D + YD       YSR  +P  + L     ++       
Sbjct: 21  VQPVYMSTTFKVD-----LRSDGQAYD-------YSRSGNPTRSLLHRQLGQLYNVPESQ 68

Query: 78  -HAVIYSSGLAAYFATL-------THYNPKKLFIGQSYHG-----------CHGIADIFT 118
            HAV  SSG+ A  A +       T + P  L     Y G           CH       
Sbjct: 69  VHAV--SSGMTALDAIMRGLILSNTSHVPTILAGDDLYGGSDRLLTFLKTRCHA------ 120

Query: 119 RNNGMKQYPLDRIEEL---ASEGDIVHLETPVNPFGTSYDIEDFAR--KAHAKGALLVID 173
           R   +     D+ +E      + D VH+E+P NP     D+       K+ +    +++D
Sbjct: 121 RTINVDTSNFDKFQEAFLSVDKVDCVHIESPTNPMCKVVDVPRIISFVKSVSPQTYVIVD 180

Query: 174 STFAPPPLQDVWKFGADVVIHSCTKYFGGHSDLLSGVVVVKSLEVAKKMKNDRIYL---- 229
           +T     L +    GAD V  S TK+  GH D+++GVVV ++ ++A     D IY     
Sbjct: 181 NTMMSGLLCNPLSLGADAVYESATKFLNGHHDIMAGVVVSRNQKIA-----DAIYFVVNA 235

Query: 230 -GTNIANLESYLLLRSLRTFEMRVRKQSENATALVKYLDD----HKSEFNKVLDKIYHSS 284
            G  +A ++S+LL+R L+T  +R+ +Q  NA  L ++L+      +S+ N +L   Y   
Sbjct: 236 TGCGLAPMDSWLLIRGLKTLSVRLYQQQFNAMVLAEWLEQSCGFKQSKDNSLLRTRYVGL 295

Query: 285 LQTEDF-VKKQLEGGYGPVFSIVLKSKVQCKKLPGK--LELFQHATSLGGVESLVEW--- 338
                F + +    G G V S    S    +++     L+++    S G V SL+     
Sbjct: 296 QSHPQFSLHRSFNDGPGAVLSFETGSTPLSRRIVSSKALKIWSVTVSFGCVNSLISLPCS 355

Query: 339 --RALTDPYIE------QTLIRVSVGCEGVEDLIKDLAGAL 371
              A  DP +       + LIR+ VG E + DL KDL  A+
Sbjct: 356 MSHASIDPNVRKEREFPEDLIRLCVGIEDIVDLQKDLLAAM 396

>Ecym_8405 Chr8 (839466..840884) [1419 bp, 472 aa] {ON} similar to
           Ashbya gossypii ACL059C
          Length = 472

 Score = 98.6 bits (244), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 111/416 (26%), Positives = 181/416 (43%), Gaps = 58/416 (13%)

Query: 3   SLPTTLIHADDKDNRVTDIVSPINVATTFRYDNNNLIAWNDRENYDFLETTPVYSRLAHP 62
           SL T L++   + +     V P+  +TTF+ ++         + YD       Y+R  +P
Sbjct: 15  SLHTRLVNVTQQKDPYGASVPPLYQSTTFKQESFE----PGCQEYD-------YTRSGNP 63

Query: 63  NATRLESIFSEILG--GHAVI-YSSGLAAY----FATLTHYNPKK---LFIGQS-YHGCH 111
             + +E    ++ G  G  V+  SSG++A      + L  Y   K   +  G   Y G  
Sbjct: 64  TRSVVERQVGKLYGVCGEQVLAVSSGMSALDVILRSILGSYQAGKTPVVIAGDDLYGGTQ 123

Query: 112 GIADIFTRNNGMKQYPLDR------IEELASEGDI--VHLETPVNPFGTSYDIEDFAR-- 161
            +  I      +K   +D       ++   S+ ++  V LE+P NP     D+       
Sbjct: 124 RLLGILGIQGHVKVLHVDTSDAARFVDVFLSQRNVACVLLESPTNPLMKVADLPKLISFV 183

Query: 162 KAH--AKGALLVIDSTFAPPPLQDVWKFGADVVIHSCTKYFGGHSDLLSGVVVVKSLEVA 219
           K+H    G  +V+D+T       +  + GAD+V  S TK+  GH D+++GV+V  S+E+A
Sbjct: 184 KSHRGGSGCKIVVDNTMVSGINCNPLELGADLVYESATKFLNGHHDIMAGVIVAASVELA 243

Query: 220 KKMKNDRIYLGTNIANLESYLLLRSLRTFEMRVRKQSENATALVKYLDDH----KSEFNK 275
           + M      +G  +A ++S+LL+R L+T  +R+ +Q  NA  L  +L D      +E N 
Sbjct: 244 QDMYFIVNSMGAGLAPMDSWLLIRGLKTLGVRMYQQQHNAMVLAHWLQDSCGFAPTEQNS 303

Query: 276 VLDKIYHSSLQTEDF-VKKQLEGGYGPVFS-----IVLKSKVQCKKLPGKLELFQHATSL 329
            L   +        F + +    G G V S     I L  K+ C K   K + +    S 
Sbjct: 304 QLRTRFVGLKSHPQFHLHRSFNSGPGAVLSIETGDIELSEKIVCSK---KFKYWNVTVSF 360

Query: 330 GGVESLVEW-----RALTDPYIE------QTLIRVSVGCEGVEDLIKDLAGALKQL 374
           G V SL+        A  DP +       + LIR+  G E V DL  DL GA + +
Sbjct: 361 GCVNSLISMPCKMSHASIDPELRKDRKFPEDLIRICCGIEDVSDLQWDLLGAFEDV 416

>TDEL0B04660 Chr2 complement(828468..829862) [1395 bp, 464 aa] {ON}
           Anc_8.145 YGL184C
          Length = 464

 Score = 94.4 bits (233), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 99/393 (25%), Positives = 170/393 (43%), Gaps = 59/393 (15%)

Query: 22  VSPINVATTFRYDNNNLIAWNDRENYDFLETTPVYSRLAHPNATRLE---SIFSEILGGH 78
           V P+ ++TTF+ D +N     + + +D       YSR  +P  + L+       E+   H
Sbjct: 27  VQPLYLSTTFKVDLDN----PESQVFD-------YSRSGNPTRSLLQYQIGKLYEVPVEH 75

Query: 79  AVIYSSGLAAYFATLTHYNPKKLFIGQSYHGCHGIA--DIFTRNNGMKQYPLDRIEELA- 135
            +  +SG+ A    L     + L I  + H    IA  D++  +N +  Y   +    A 
Sbjct: 76  VLAVASGMTALDVIL-----RGLVISSATHVPTIIAGDDLYGGSNRLLAYLESKSHARAV 130

Query: 136 -----------------SEGDIVHLETPVNPFGTSYDIEDFAR--KAHAKGALLVIDSTF 176
                             + D V LE+P NP     D+       K  +   ++++D+T 
Sbjct: 131 HVDTTDMEKFKAVFGSLDKVDCVLLESPTNPLCKVVDVPQLVAYVKRISPSTVVIVDNTM 190

Query: 177 APPPLQDVWKFGADVVIHSCTKYFGGHSDLLSGVVVVKSLEVAKKMKNDRIYLGTNIANL 236
                 +  ++G DVV  S TKY  GH D++ G++V K+ E+A+++       G+ ++ +
Sbjct: 191 MSGLQCNPLEYGCDVVYESATKYLNGHHDIMGGIIVGKTAEIAQEIYYVVNATGSGLSPM 250

Query: 237 ESYLLLRSLRTFEMRVRKQSENATALVKYLDD----HKSEFNKVLDKIYHSSLQTEDF-V 291
           +S+LL R L+T  +R+ +Q  N+  + ++L++      +E N  L   Y        F +
Sbjct: 251 DSWLLNRGLKTLGVRMYQQQYNSMVIAQWLEESCGFKPTEKNSALKTRYVGLKTNPGFEL 310

Query: 292 KKQLEGGYGPVFSIVLKSKVQCKKLPGK--LELFQHATSLGGVESLVEW-----RALTDP 344
            +    G G V S    S    +++      +LF    S G V SL+        A  DP
Sbjct: 311 HRSFNKGPGAVLSFETGSLEHSQRIVASKAFQLFSVTVSFGCVNSLISLPCKMSHASIDP 370

Query: 345 YIEQT------LIRVSVGCEGVEDLIKDLAGAL 371
            + +       LIR+ VG E V DL KDL  A+
Sbjct: 371 EVRKQREFPEDLIRLCVGIEDVGDLQKDLLYAM 403

>SAKL0H24882g Chr8 (2167623..2169002) [1380 bp, 459 aa] {ON} highly
           similar to uniprot|P53101 Saccharomyces cerevisiae
           YGL184C STR3 Cystathionine beta-lyase converts
           cystathionine into homocysteine
          Length = 459

 Score = 94.4 bits (233), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 105/408 (25%), Positives = 177/408 (43%), Gaps = 50/408 (12%)

Query: 3   SLPTTLIHADDKDNRVTDIVSPINVATTFRYDNNNLIAWNDRENYDFLETTPVYSRLAHP 62
           SL T L+      ++    V P+  +TTF+   ++L    D+E YD       Y+R  +P
Sbjct: 5   SLHTKLVSVTHHKDQHGSSVPPLYQSTTFK--QSSLEDDADQE-YD-------YTRSGNP 54

Query: 63  NATRLESIFSEIL---GGHAVIYSSGLAAYFATL-------THYNPKKLFIGQSYHGCHG 112
             + L+   +++    G      SSG+      L       +++ P  +     Y G   
Sbjct: 55  TRSVLQEQIAKLYNVPGFQVFAVSSGMTCLDVILRALVLGNSNHTPTIIAGDDLYGGTQR 114

Query: 113 IADIFTRNNGMKQYPLDR------IEELASEG--DIVHLETPVNPFGTSYDIE---DFAR 161
           +     R N  +   +D       +      G  D V LE+P NP     D+     F +
Sbjct: 115 LLTFLERKNHARVIHVDTTDFDKFVSAFNGCGFVDCVVLESPTNPLCKVADLPGLTKFIK 174

Query: 162 KAHAKGALLVIDSTFAPPPLQDVWKFGADVVIHSCTKYFGGHSDLLSGVVVVKSLEVAKK 221
           +A+ K   +V+D+T       +  +F  DVV  S TKY  GH D+++GV++ +S E+A++
Sbjct: 175 QANPK-CHVVVDNTMVSGLNCNPLEFQCDVVYESGTKYLNGHHDIMAGVIIGRSKEIAQE 233

Query: 222 MKNDRIYLGTNIANLESYLLLRSLRTFEMRVRKQSENATALVKYLDD----HKSEFNKVL 277
           +       G  ++ ++ +LL+R L+T  +R+ +Q  NA  L ++L        +  NK+L
Sbjct: 234 LYFVINSTGCGLSPMDCWLLIRGLKTLSIRLYQQQHNAMILARWLYSSCGFRPNSENKLL 293

Query: 278 DKIYHSSLQTEDF-VKKQLEGGYGPVFSIVLKSKVQCKKL--PGKLELFQHATSLGGVES 334
              Y        F + +    G G V S    S    K+L    KL+++    S G V S
Sbjct: 294 RTRYVGLKSHPQFELHRSFNKGPGAVLSFDTGSFEHSKRLVSSKKLKIWAVTVSFGCVNS 353

Query: 335 LVEW-----RALTDPYIE------QTLIRVSVGCEGVEDLIKDLAGAL 371
           L+        A  DP +       + L+R+  G E V+DL KDL  A+
Sbjct: 354 LISMPCKMSHASIDPELRKERDFPEDLVRLCCGIEDVKDLQKDLLAAM 401

>KLTH0E06644g Chr5 complement(608116..609498) [1383 bp, 460 aa] {ON}
           highly similar to uniprot|P53101 Saccharomyces
           cerevisiae YGL184C STR3 Cystathionine beta-lyase
           converts cystathionine into homocysteine
          Length = 460

 Score = 94.4 bits (233), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 76/258 (29%), Positives = 120/258 (46%), Gaps = 29/258 (11%)

Query: 139 DIVHLETPVNPFGTSYDIEDFAR--KAHAKGALLVIDSTFAPPPLQDVWKFGADVVIHSC 196
           D V LE+P NP     D+       K+  +  L+ ID+T     L +  KF  DVV  S 
Sbjct: 149 DCVLLESPTNPLLKVADLPRLTHFIKSANEACLVAIDNTMMSGMLCNPLKFQCDVVYESA 208

Query: 197 TKYFGGHSDLLSGVVVVKSLEVAKKMKNDRIYLGTNIANLESYLLLRSLRTFEMRVRKQS 256
           TKY  GH D+++G+VV ++L++A+++       G+ ++  +S+LL+R L+T  +R+ +Q 
Sbjct: 209 TKYLNGHHDIMAGIVVTQTLKMAQEIYFVINSTGSGLSPFDSWLLVRGLKTLGVRLYQQQ 268

Query: 257 ENATALVKYLDDHKSEFNKVLDKIYHSSLQTEDFV----------KKQLEGGYGPVFSIV 306
            NA  L  +L++      K   K    S +T  FV           K    G G V S  
Sbjct: 269 HNAMVLAHWLENSCGFVGK---KGVKGSPRTR-FVGLKSHPQFELHKSFNAGPGAVLSFE 324

Query: 307 LKSKVQCKKLPG--KLELFQHATSLGGVESLVEW-----RALTDPYIEQT------LIRV 353
             S    ++L    K++++    S G V SL+        A  DP + Q       L+R+
Sbjct: 325 TGSYEHSRRLVSSRKIKIWAVTVSFGCVNSLISMPCKMSHAAIDPALRQERDFPEDLVRL 384

Query: 354 SVGCEGVEDLIKDLAGAL 371
             G E + DL  DL  A+
Sbjct: 385 CCGIENISDLQNDLLEAM 402

>Kwal_47.17221 s47 complement(306099..307490) [1392 bp, 463 aa] {ON}
           YGL184C (STR3) - Cystathionine beta-lyase [contig 211]
           FULL
          Length = 463

 Score = 92.8 bits (229), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 76/257 (29%), Positives = 117/257 (45%), Gaps = 26/257 (10%)

Query: 139 DIVHLETPVNPFGTSYDIEDFAR--KAHAKGALLVIDSTFAPPPLQDVWKFGADVVIHSC 196
           D V LE+P NP     D+    R  K   +  ++ ID+T     L +   F  DVV  S 
Sbjct: 151 DCVLLESPTNPLLKVADLPRITRFVKQSNEKCVVAIDNTMMSGMLCNPLHFHCDVVYESA 210

Query: 197 TKYFGGHSDLLSGVVVVKSLEVAKKMKNDRIYLGTNIANLESYLLLRSLRTFEMRVRKQS 256
           TKY  GH D+++G+VV +S ++A ++       G  ++  +S+LL+R L+T  +R+ +Q 
Sbjct: 211 TKYLNGHHDIMAGIVVARSAQLAGEIYFMINSTGCGLSPFDSWLLIRGLKTLGVRIYQQQ 270

Query: 257 ENATALVKYLDDHKSEFNKVLDKIYHSSLQT---------EDFVKKQLEGGYGPVFSIVL 307
            NA  L  +L++     +    K    SLQT         E  + K    G G V S   
Sbjct: 271 HNAMVLAHWLENSCGFVSH--GKKGKGSLQTRFVGLKSHPEFELHKSFNTGPGAVLSFET 328

Query: 308 KSKVQCKKL--PGKLELFQHATSLGGVESLVEW-----RALTDPYIEQT------LIRVS 354
            S    ++L    K++L+    S G V SL+        A  DP + Q       L+R+ 
Sbjct: 329 GSFEHSRRLVSSKKIKLWAVTVSFGCVNSLISMPCKMSHAAIDPALRQERDFPEDLVRLC 388

Query: 355 VGCEGVEDLIKDLAGAL 371
            G E + DL  DL  A+
Sbjct: 389 CGIENIVDLQNDLLEAM 405

>KLLA0C17028g Chr3 complement(1487806..1489188) [1383 bp, 460 aa]
           {ON} similar to uniprot|P53101 Saccharomyces cerevisiae
           YGL184C STR3 Cystathionine beta-lyase converts
           cystathionine into homocysteine
          Length = 460

 Score = 91.7 bits (226), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 106/414 (25%), Positives = 171/414 (41%), Gaps = 60/414 (14%)

Query: 3   SLPTTLIHADDKDNRVTDIVSPINVATTFRYDNNNLIAWNDRENYDFLETTPVYSRLAHP 62
           SL T+L+     D +    V P+  +TTF+       +++  + YD       Y+R  +P
Sbjct: 5   SLNTSLVSVSHND-KYGSSVPPLYQSTTFKAS-----SFDQLQEYD-------YTRSGNP 51

Query: 63  NATRLESIFS---EILGGHAVIYSSGLAAYFATL------THYNPKKLFIGQSYHGCHGI 113
             T L+   +   ++        SSG+ A    L      + + P  +     Y G   +
Sbjct: 52  TRTVLQQQIANLYDVAPEQVFAVSSGMTALDIILRTLIDNSDHIPTIIAGDDLYGGTQRL 111

Query: 114 ADIFTRNNGMKQYPLD--------RIEELASEGDIVHLETPVNPFGTSYDIEDFARKAHA 165
                  N  K    D        ++     + DIV LE+P NP     D+    +    
Sbjct: 112 LTFLQTRNHAKVIHTDTTDAESFIKLYNSLGQVDIVLLESPTNPLMKVADLPRLCQFVKQ 171

Query: 166 KGAL-----LVIDSTFAPPPLQDVWKFGADVVIHSCTKYFGGHSDLLSGVVVVKSLEVAK 220
           KG       +V+D+T       +  +FGADVV  S TKY  GH D+++GV++ K  +VA 
Sbjct: 172 KGGSSSNCKIVVDNTMMSGLNSNPLQFGADVVYESGTKYLNGHHDIMAGVIIAKK-DVAP 230

Query: 221 KMKNDRIYLGTNIANLESYLLLRSLRTFEMRVRKQSENATALVKYLDD----HKSEFNKV 276
            +       G  ++ ++S+LL+R L+T  +R+ KQ  NA  L  +L D      ++ N+ 
Sbjct: 231 SVYFVINSTGAGLSPMDSWLLIRGLKTLSVRLYKQQINAMVLSHWLQDICGFKPTDNNQQ 290

Query: 277 LDKIYHSSLQTEDF-VKKQLEGGYGPVFSI-----VLKSKVQCKKLPGKLELFQHATSLG 330
           L   +        F + K    G G V SI      L   +   K   +L ++    S G
Sbjct: 291 LKTRFVGLESHPQFELHKSFNNGPGAVLSIETGDLALSEAIVTSK---RLNIWAVTVSFG 347

Query: 331 GVESLVEW-----RALTDPYIEQT------LIRVSVGCEGVEDLIKDLAGALKQ 373
            V SL+        A  DP + +       LIR+  G E V+DL  DL  A ++
Sbjct: 348 CVNSLISMPCKMSHASIDPELRKQRAFPEDLIRLCCGIEDVKDLQYDLLAAFEE 401

>TDEL0D06630 Chr4 complement(1200459..1201667) [1209 bp, 402 aa]
           {ON}  YFR055W
          Length = 402

 Score = 89.7 bits (221), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 88/344 (25%), Positives = 155/344 (45%), Gaps = 33/344 (9%)

Query: 56  YSRLAHPNATRLESIFSEILGGHAVIYS-SGLA----AYFATLTHYNPKKLFI---GQSY 107
           Y     P    LE  ++E+ G    + S +GL     A  + + H +   L I   G + 
Sbjct: 57  YGTAGSPTIANLEDSWTELTGAAGTVLSPTGLGSISLAILSVVKHGDHILLPISVYGPTA 116

Query: 108 HGCHGIADIFTRNNGMKQYPLDR-IEEL-ASEGDIVHLETPVNPFGTSYDIEDFARKAHA 165
           + C+ +   F  N+      + + IEEL  +   ++ LE+P +      D+    + A  
Sbjct: 117 NFCNNVLRKFGVNSEFYDPLIGKDIEELIKTNTSLIFLESPCSQTMEIQDVPAIVKVAKK 176

Query: 166 KGALLVIDSTFAPPPLQDVWKFGADVVIHSCTKYFGGHSDLLSGVVVVKSLEVAKKMKND 225
                V+D+T+A P       +G D+ + + TKY GGHSDLL G+    S      +++ 
Sbjct: 177 HNVKTVLDNTWATPLFFKAHDYGIDISVEAGTKYVGGHSDLLLGLTSANS-RCWPALRST 235

Query: 226 RIYLGTNIANLESYLLLRSLRTFEMRVRKQSENATALVKYLDDHKSEFNKVLDKIYHS-- 283
              +G      + +L LR LRT ++RV++    A  L ++L + ++E  ++L   +    
Sbjct: 236 YDAMGMLPGADDCHLALRGLRTLQLRVKEAERKALILAEWL-EARNEVERILHPAFEDCP 294

Query: 284 --SLQTEDFVKKQLEGGYGPVFSIVLK---SKVQCKKLPGKLELFQHATSLGGVESLV-- 336
             SL   D+       G   VF+ +LK   S+   K +  K+++F+   S GG ESL+  
Sbjct: 295 GHSLWVRDY------SGSTGVFTFILKDQFSRAGLKDMLEKMQIFKLGYSWGGYESLLIP 348

Query: 337 -----EWRALTDPYIEQTLIRVSVGCEGVEDLIKDLAGALKQLQ 375
                  R  T  +    L R+ VG E ++D ++DL    ++L+
Sbjct: 349 VNSTSRDRIRTWSHFGYAL-RIQVGLEDIDDQLRDLEMGFERLK 391

>NCAS0A05810 Chr1 (1143717..1145060) [1344 bp, 447 aa] {ON} Anc_4.53
          Length = 447

 Score = 86.3 bits (212), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 116/452 (25%), Positives = 181/452 (40%), Gaps = 100/452 (22%)

Query: 6   TTLIHA-----DDKDNRVTDIVSPINVATTFRYDNNNLIAWNDRENYDFLETTPVYSRLA 60
           T  +HA     DD  NR   +  PI   T++ ++++     +  + +       VYSR  
Sbjct: 7   TVQLHAGQENPDDNKNRPRAV--PIYATTSYVFNDSK----HGAQLFGLEVPGYVYSRFQ 60

Query: 61  HPNATRLESIFSEILGGHA-VIYSSGLAAY---FATLTHYNPKKLFIGQSYHGCHGIADI 116
           +P     E   + + GG A V  SSG AA     + L H     +     Y G +    +
Sbjct: 61  NPTNNVFEERIAALEGGAAAVAVSSGQAAQTLAISGLAHVGDNIVSTSYLYGGTYNQFKV 120

Query: 117 FTRNNGMKQYPLDR-----IEELASE-GDIVHLETPVNPFGTSYDIEDFARKAHAKGALL 170
             +  G++   +D       E+L  E    V+LE+  NP     D E     AH  G  +
Sbjct: 121 AFKRLGVEARFVDGDNPADFEKLFDERTKAVYLESIGNPKYNVPDFEGIVAVAHKHGIPV 180

Query: 171 VIDSTFAP-----PPLQDVWKFGADVVIHSCTKYFGGHSDLLSGVVV------------- 212
           V+D+TF        PL    KFGAD+V HS TK+ GGH   ++GVVV             
Sbjct: 181 VVDNTFGAGGFFCQPL----KFGADIVTHSATKWIGGHGTTVAGVVVDSGKFPWKDYPEK 236

Query: 213 ----VKSLEVAKKMKNDRIY----------------LGTNIANLESYLLLRSLRTFEMRV 252
                K  E       +  Y                LG  +    ++LLL+ + T  +R 
Sbjct: 237 FPQFSKPAEGYHGTIFNETYGNLAYIVHVRVELLRDLGPGMNPFAAFLLLQGVETLSLRC 296

Query: 253 RKQSENATALVKYLDDHKSEFNKVLDKIYHSSLQTEDFVKKQLEGGYGPVFSIVLK---- 308
            + + NA AL K+L+  KS +   +      S    +  KK L  G+G V S  +K    
Sbjct: 297 ERHASNALALAKWLE--KSPYVSWVSYPGLESHSHHENAKKYLSNGFGGVLSFGVKDLPN 354

Query: 309 -SKVQCKKLP---------GKLELFQHATSLGGVESLVEWRALTDPY------------- 345
            S+ + KK P           L+L  +  ++G  ++LV       PY             
Sbjct: 355 QSEEEVKKNPFAASGAQVVDSLQLASNLANVGDSKTLV-----IAPYFTTHQQLDDDEKL 409

Query: 346 ---IEQTLIRVSVGCEGVEDLIKDLAGALKQL 374
              + + LIRVSVG E ++D+I D   + +++
Sbjct: 410 LSGVTKDLIRVSVGTEFIDDIIGDFQQSFEKV 441

>Skud_19.6 Chr19 complement(5562..6767) [1206 bp, 401 aa] {ON}
           YFR055W (REAL)
          Length = 401

 Score = 85.1 bits (209), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 88/342 (25%), Positives = 146/342 (42%), Gaps = 25/342 (7%)

Query: 56  YSRLAHPNATRLESIFSEILGGHAVIYS-SGLAAY---FATLTHYNPKKLFIGQSYHGCH 111
           Y     P    LE  ++ + GG   + S SGL +      TL       L     Y    
Sbjct: 57  YGTAGSPTIANLEDAWTHLTGGAGTVLSPSGLGSISLALLTLAKAGDHILITDSVYVPTR 116

Query: 112 GIADIFTRNNGMK-QYPLDRIEE-----LASEGDIVHLETPVNPFGTSYDIEDFARKAHA 165
            + D      G++ +Y    + E     +     ++ LE+P +      DI      A  
Sbjct: 117 MLCDGLLAKFGIETEYYDPSVGEDIKKLIKPNTTVIFLESPGSGTMEIQDIPALVSVAKK 176

Query: 166 KGALLVIDSTFAPPPLQDVWKFGADVVIHSCTKYFGGHSDLLSGVVVVKSLEVAKKMKND 225
            G   ++D+T+A P   D    G D+ + + TKY GGHSDLL G+      E    +++ 
Sbjct: 177 HGIKTILDNTWATPLFFDAHGHGIDISLEAGTKYLGGHSDLLIGLTSANE-ECWPLLRST 235

Query: 226 RIYLGTNIANLESYLLLRSLRTFEMRVRKQSENATALVKYLDDHKSEFNKVLDKIYHSSL 285
              +       +  L LR +RT  +R+++    A  L  +L+D + E  KVL   +    
Sbjct: 236 YDAMAMLPGADDCLLALRGMRTLHLRLKEAERKALDLAAWLED-RDEVEKVLHPAFKDCP 294

Query: 286 QTEDFVKKQLEGGYGPVFSIVLK---SKVQCKKLPGKLELFQHATSLGGVESLV------ 336
             E +V +  +G  G +FSIVLK   ++   + +  K+++F    S GG ESL+      
Sbjct: 295 GHEYWV-RDYKGSSG-LFSIVLKDGYTRTGLENMVEKMKVFHLGFSWGGYESLITPVNPA 352

Query: 337 -EWRALTDPYIEQTLIRVSVGCEGVEDLIKDLAGALKQLQDE 377
            + +A   P+     +R+ VG E + DL +DL    ++L  E
Sbjct: 353 RQRKAANWPH-RGFALRIQVGLEELTDLKRDLELGFERLAQE 393

>Smik_7.375 Chr7 (620194..621399) [1206 bp, 401 aa] {ON} YFR055W
           (REAL)
          Length = 401

 Score = 79.7 bits (195), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 85/341 (24%), Positives = 144/341 (42%), Gaps = 23/341 (6%)

Query: 56  YSRLAHPNATRLESIFSEILGGHAVIYS-SGLAAY---FATLTHYNPKKLFIGQSYHGCH 111
           Y     P    LE  ++ + G    + S SGL +      TL+      L     Y    
Sbjct: 57  YGTAGSPTIANLEDAWTHLTGSAGTVLSPSGLGSISLALLTLSKAGDHILITDSVYFPTR 116

Query: 112 GIADIFTRNNGMKQYPLD-----RIEELASEGD-IVHLETPVNPFGTSYDIEDFARKAHA 165
            + D      G++    D      IE+L      ++ LE+P +      +I      A  
Sbjct: 117 MLCDGLLAKFGIETEYYDPSIGEDIEKLVKPNTTVIFLESPGSGTMEIQNIPALVSVAKK 176

Query: 166 KGALLVIDSTFAPPPLQDVWKFGADVVIHSCTKYFGGHSDLLSGVVVVKSLEVAKKMKND 225
            G   ++D+T+A P   D    G D+ + + TKY GGHSDLL G+V     E    +++ 
Sbjct: 177 HGIKTILDNTWATPLFFDAHGHGIDISLEAGTKYLGGHSDLLLGLVSANE-ECWPLLRST 235

Query: 226 RIYLGTNIANLESYLLLRSLRTFEMRVRKQSENATALVKYLDDHKSEFNKVLDKIYHSSL 285
              +       +  L LR +RT  +R+++    A  L  +    + E  KVL   +    
Sbjct: 236 YDAMAMLPGADDCLLALRGMRTLHLRLKEAERKALDLAAWF-KKRDEVEKVLHPAFEDCP 294

Query: 286 QTEDFVKKQLEGGYGPVFSIVLK---SKVQCKKLPGKLELFQHATSLGGVESLV-----E 337
             E +V +  +G  G +FSIVLK   ++   + +   +++F+   S GG +SL+      
Sbjct: 295 GHEYWV-RDYKGSSG-LFSIVLKDGFTRSGLENMVDNMKVFELGYSWGGYDSLITPVNPP 352

Query: 338 WRALTDPYIEQTL-IRVSVGCEGVEDLIKDLAGALKQLQDE 377
            +    P+      +R+ VG E +EDL +DL    ++L +E
Sbjct: 353 TQRKAAPWSHNGFALRIQVGLEELEDLKRDLELGFERLTEE 393

>ADL031W Chr4 (645776..647179) [1404 bp, 467 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR303W (MET17)
          Length = 467

 Score = 78.2 bits (191), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 80/306 (26%), Positives = 127/306 (41%), Gaps = 80/306 (26%)

Query: 136 SEGDIVHLETPVNPFGTSYDIEDFAR---KAHAKGALLVIDSTF-APPPLQDVWKFGADV 191
           S+   V LE+  NP    Y++ DF R    AH  G  +V+D+TF A        KFGAD+
Sbjct: 146 SKTKAVFLESIGNP---KYNVPDFERIVAVAHRHGIPVVVDNTFGAGGYFCQPIKFGADI 202

Query: 192 VIHSCTKYFGGHSDLLSGVVV-----------------------------VKSLEVAKKM 222
           V HS TK+ GGH   + G+VV                              ++L     +
Sbjct: 203 VTHSATKWIGGHGTAIGGLVVDSGKFPWKDYPAKFPQFSEPSEGYHGLVLNEALGPLAFV 262

Query: 223 KNDRIY----LGTNIANLESYLLLRSLRTFEMRVRKQSENATALVKYLDDHKSEFNKVLD 278
            + RI     LG  ++   ++L L+ L T  +R  +  +NA AL KYL     E +  + 
Sbjct: 263 GHARIELLRDLGPALSPFAAFLFLQGLETLSLRAERHGQNALALAKYL-----ETSAYVS 317

Query: 279 KIYHSSLQTEDFVK---KQLEGGYGPVFSIVLKS-----------KVQCKKLPGKLELFQ 324
            + +  L++ D++    + L+ GYG V S  +K            K    +    L+   
Sbjct: 318 WVSYPGLESHDYLSNATRYLQNGYGGVLSFGVKPLPDTDEEADPFKAAGAQFVDNLKFAS 377

Query: 325 HATSLGGVESLVEWRALTDPY----------------IEQTLIRVSVGCEGVEDLIKDLA 368
           +  ++G  ++LV       PY                + + LIRVSVG E ++D+I D  
Sbjct: 378 NLANVGDSKTLV-----IAPYFTTHQQLSESEKLASGVTRDLIRVSVGTEYLQDIIADFE 432

Query: 369 GALKQL 374
            A   +
Sbjct: 433 QAFSTV 438

>TBLA0C04400 Chr3 (1062021..1063358) [1338 bp, 445 aa] {ON} Anc_4.53
           YLR303W
          Length = 445

 Score = 77.0 bits (188), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 76/294 (25%), Positives = 129/294 (43%), Gaps = 66/294 (22%)

Query: 141 VHLETPVNPFGTSYDIEDFAR---KAHAKGALLVIDSTFAPPPL--QDVWKFGADVVIHS 195
           V+LET  NP    Y++ DF +    AH  G  +V+D+TF       Q + K+GAD+V HS
Sbjct: 151 VYLETIGNP---KYNVPDFDKIVAVAHKHGIPVVVDNTFGAGGFFCQPI-KYGADIVTHS 206

Query: 196 CTKYFGGHSDLLSGVVV--------------------------------VKSLEVAKKMK 223
            TK+ GGH   ++G ++                                + +L     ++
Sbjct: 207 ATKWIGGHGTTIAGAIIDSGKFPWKEYPEKFPQFSKPSEGYHGMIFNEAMGNLAFIGHVR 266

Query: 224 NDRIY-LGTNIANLESYLLLRSLRTFEMRVRKQSENATALVKYLDDHKSEFNKVLDKIYH 282
            + +  LG  ++   S+LLL+ + T  +R  +Q EN  AL K+L+  KS +   +     
Sbjct: 267 TELLRDLGPCMSPFASFLLLQGVETLSLRAERQGENTLALAKWLE--KSAYVSWVSYPGL 324

Query: 283 SSLQTEDFVKKQLEGGYGPVFSIVLKS-----------KVQCKKLPGKLELFQHATSLGG 331
            S    +  KK L  G+G V S  +K            K    +    L+L  +  ++G 
Sbjct: 325 VSHSHHENAKKYLRNGFGGVLSFGVKDLPGAAEEKDPFKAAGAQAVDNLKLASNLANVGD 384

Query: 332 VESLV------EWRALTD-----PYIEQTLIRVSVGCEGVEDLIKDLAGALKQL 374
            ++LV        + L+D       + + LIRVSVG E ++D+I D   + +++
Sbjct: 385 SKTLVIAPYFTTHQQLSDEEKLASGVTKDLIRVSVGTEFIDDIIADFQQSFEKI 438

>Suva_17.6 Chr17 (9922..11127) [1206 bp, 401 aa] {ON} YFR055W (REAL)
          Length = 401

 Score = 75.1 bits (183), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 84/341 (24%), Positives = 137/341 (40%), Gaps = 23/341 (6%)

Query: 56  YSRLAHPNATRLESIFSEILGGHAVIYS-SGLAAY---FATLTHYNPKKLFIGQSYHGCH 111
           Y     P    LE  ++ + G    + S SGL +      TL       L     Y    
Sbjct: 57  YGTAGSPTIANLEDAWTHLTGAAGTVLSPSGLGSITLALMTLAKAGDHILITDSVYVPTR 116

Query: 112 GIADIFTRNNGMKQYPLDR-----IEELASEG-DIVHLETPVNPFGTSYDIEDFARKAHA 165
            + D      G++    D      IE+L      ++ LE+P +      DI      A  
Sbjct: 117 VLCDGLLAKFGIQTEYYDPTVGEDIEKLVKPNTSVIFLESPGSGTMEIQDIPALVSIAKK 176

Query: 166 KGALLVIDSTFAPPPLQDVWKFGADVVIHSCTKYFGGHSDLLSGVVVVKSLEVAKKMKND 225
            G   ++D+T+A P   D    G D+ + + TKY GGHSD L G+      E    +++ 
Sbjct: 177 HGIRTILDNTWATPLFFDAHGHGIDISLEAGTKYLGGHSDFLLGLTSANQ-ECWPLLRST 235

Query: 226 RIYLGTNIANLESYLLLRSLRTFEMRVRKQSENATALVKYLDDHKSEFNKVLDKIYHSSL 285
              +       +  L LR +RT  +R+++    A  L  +L   + E   VL   +    
Sbjct: 236 YDAMAMLPGADDCQLALRGMRTLHLRLKEAERKALDLAAWLGK-RDEVETVLHPAFEDC- 293

Query: 286 QTEDFVKKQLEGGYGPVFSIVLK---SKVQCKKLPGKLELFQHATSLGGVESLV------ 336
               +  +  +G  G +FSIVLK   ++   + +  K+++F    S GG ESL+      
Sbjct: 294 PGHKYWLRDYKGSSG-LFSIVLKEGFTRAGLESMVEKMKIFHLGFSWGGYESLITPVKPA 352

Query: 337 EWRALTDPYIEQTLIRVSVGCEGVEDLIKDLAGALKQLQDE 377
           E R   +       +R+ VG E + DL +DL    ++L  E
Sbjct: 353 EQRKPHNWPHRGFALRIQVGLEELSDLKRDLELGFERLAAE 393

>ZYRO0G22198g Chr7 complement(1827527..1828864) [1338 bp, 445 aa]
           {ON} highly similar to uniprot|P06106 Saccharomyces
           cerevisiae YLR303W MET17 O-acetyl homoserine-O-acetyl
           serine sulfhydrylase required for sulfur amino acid
           synthesis
          Length = 445

 Score = 75.1 bits (183), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 108/447 (24%), Positives = 177/447 (39%), Gaps = 92/447 (20%)

Query: 6   TTLIHADDKD-----NRVTDIVSPINVATTFRYDNNNLIAWNDRENYDFLETTPVYSRLA 60
           T  +HA  +D     NR   +  PI   T++ +D++     +  + +       +YSR+ 
Sbjct: 7   TIQLHAGQEDPSEHSNRPRAV--PIYSTTSYVFDDSK----HGSQLFGLETPGYIYSRIM 60

Query: 61  HPNATRLESIFSEILGG-HAVIYSSGLAAY---FATLTHYNPKKLFIGQSYHGCHGIADI 116
           +P A   E   + + GG  A+  SSGLAA       L H     +     Y G +    I
Sbjct: 61  NPTADVFERRIAALEGGVGALAVSSGLAAQTLAITGLAHAGDNIVSTSYLYGGTYNQFKI 120

Query: 117 FTRNNGMKQYPLDRIEELASEGDI------VHLETPVNPFGTSYDIEDFARKAHAKGALL 170
             +  G++   ++  +    E  I      V+LET  NP     D E     AH  G  +
Sbjct: 121 AFKRFGIESRFIEGDDPSGLEAQIDERTKAVYLETIGNPKYNVPDFEKIVAIAHKHGVPV 180

Query: 171 VIDSTFAPPP--LQDVWKFGADVVIHSCTKY----------------------------- 199
           V+D+TF       Q + K GADVV+HS TK+                             
Sbjct: 181 VVDNTFGAGGYYCQPI-KHGADVVVHSATKWIGGHGTTIGGVIVDSGNFPWKEYPKKFPQ 239

Query: 200 FGGHSDLLSGVVVVKSLEVAKKMKNDRIY----LGTNIANLESYLLLRSLRTFEMRVRKQ 255
           F   S+   G+V  ++L     + + R      LG +++   ++LLL+ L T  +R  + 
Sbjct: 240 FSEPSEGYHGLVFNEALGNQAFIGHVRAELLRDLGPSLSPFAAFLLLQGLETLSLRAERH 299

Query: 256 SENATALVKYLDDHKSEFNKVLDKIYHSSLQTEDFVKKQLEGGYGPVFSIVLKS------ 309
           + NA  L ++L+  KS +   +      +       KK L  G+G V S   K       
Sbjct: 300 ASNALKLAQWLE--KSPYVSWVSYPGLPNHSHHANAKKYLTNGFGGVLSFGAKDLPDNPE 357

Query: 310 ------KVQCKKLPGKLELFQHATSLGGVESLVEWRALTDPY----------------IE 347
                 K    ++   LEL  +  ++G  ++LV       PY                + 
Sbjct: 358 EKENPFKAAGAQISDNLELASNLANVGDCKTLV-----IAPYFTTHLQLNHEEKLAAGVS 412

Query: 348 QTLIRVSVGCEGVEDLIKDLAGALKQL 374
           + LIRVSVG E ++D+I D   + K++
Sbjct: 413 KDLIRVSVGTEFIDDIIADFEQSFKKV 439

>NDAI0D02880 Chr4 (669487..670830) [1344 bp, 447 aa] {ON} Anc_4.53
          Length = 447

 Score = 75.1 bits (183), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 111/446 (24%), Positives = 173/446 (38%), Gaps = 105/446 (23%)

Query: 12  DDKDNRVTDIVSPINVATTFRYDNNNLIAWNDRENYD--FLETTP--VYSRLAHPNATRL 67
           DD  NR   +  PI   T++         +ND E+    F    P  VYSR  +P    L
Sbjct: 18  DDNANRPRAV--PIYATTSY--------VFNDSEHGSNLFGLKVPGYVYSRFQNPTQNVL 67

Query: 68  ESIFSEILGG-HAVIYSSGLAAY---FATLTHYNPKKLFIGQSYHGCHGIADIFTRNNGM 123
           E   + + GG  AV  +SG AA       L H     +     Y G +    +  +  G+
Sbjct: 68  EERMAALEGGVAAVAVASGQAAQTLAICGLAHSGDNIISTSFLYGGTYNQFKVAFKRLGI 127

Query: 124 KQY------PLDRIEELASEGDIVHLETPVNPFGTSYDIEDFARKAHAKGALLVIDSTFA 177
           +        P D  + +  +   V+LE+  NP     D E     AH  G  +V+D+TF 
Sbjct: 128 EARFVTGDNPDDFEKLIDDKTKAVYLESIGNPKYNVPDFEKIVEIAHKHGVPVVVDNTFG 187

Query: 178 PPPL--QDVWKFGADVVIHSCTKYFGGHSDLLSGVVV-----------------VKSLEV 218
                 Q + K+GAD+V HS TK+ GGH   ++G++V                  K  E 
Sbjct: 188 AGGFFCQPI-KYGADIVTHSATKWIGGHGTTIAGMIVDSGKFPWADYPEKFPQFSKPAEG 246

Query: 219 AKKMKNDRIY----------------LGTNIANLESYLLLRSLRTFEMRVRKQSENATAL 262
                 +  Y                LG  I+   ++LL++ + T  +R  +  +NA  L
Sbjct: 247 YHGTIFNEAYGNLAYIVHVRVELLRDLGPAISPFAAFLLIQGIETLSLRGERHGQNALKL 306

Query: 263 VKYLDDHKSEFNKVLDKIYHSSLQTEDF---VKKQLEGGYGPVFSIVLKSKVQCKKLPG- 318
            ++L     E +  +  + +  L +  +    KK L  G+G V S         K +PG 
Sbjct: 307 AQWL-----EQSPYVSWVSYPGLPSHPYHENAKKYLSNGFGGVLSF------GVKDIPGQ 355

Query: 319 -KLELFQHATSLGG---VESLVEWRALTD----------PY----------------IEQ 348
            K EL     S  G   V+SL     L +          PY                + +
Sbjct: 356 TKEELAAKPFSASGAQVVDSLKLASNLANVGDSKTLVIAPYFTTHEQLDDDEKLLSGVTK 415

Query: 349 TLIRVSVGCEGVEDLIKDLAGALKQL 374
            LIRVSVG E ++D+I D   + +++
Sbjct: 416 DLIRVSVGTEFIDDIIADFQQSFEKV 441

>KLTH0D03652g Chr4 complement(358612..359946) [1335 bp, 444 aa] {ON}
           highly similar to uniprot|P06106 Saccharomyces
           cerevisiae YLR303W MET17 O-acetyl homoserine-O-acetyl
           serine sulfhydrylase required for sulfur amino acid
           synthesis
          Length = 444

 Score = 72.8 bits (177), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 95/386 (24%), Positives = 157/386 (40%), Gaps = 68/386 (17%)

Query: 55  VYSRLAHPNATRLESIFSEILGGHAVI-YSSGLAAY---FATLTHYNPKKLFIGQSYHGC 110
           +YSR+ +P     E   + + GG A +  +SG AA     + L H     +     Y G 
Sbjct: 55  MYSRIVNPTVDVFERRIAALEGGVAALAVASGQAAQALAISGLAHAGDNIVSTSFLYGGT 114

Query: 111 HGIADIFTRNNGMKQY------PLDRIEELASEGDIVHLETPVNPFGTSYDIEDFARKAH 164
           +    +  R  G++        P D  +    +   V+LET  NP     D E     AH
Sbjct: 115 YNQFKVAFRRLGIETRFIEGDKPEDFEKAFDDKTKAVYLETIGNPKYNVPDFEKIVAVAH 174

Query: 165 AKGALLVIDSTF-APPPLQDVWKFGADVVIHSCTKY------------------------ 199
             G  +V+D+TF A        K+GAD+V HS TK+                        
Sbjct: 175 KHGIPVVVDNTFGAGGYFAQPIKYGADIVTHSATKWIGGHGTTIGGVIVDSGKFPWKEYP 234

Query: 200 -----FGGHSDLLSGVVVVKSLEVAKKMKNDRIY----LGTNIANLESYLLLRSLRTFEM 250
                F   S+   G+V+  +L     + + RI     LG  +    ++ LL+ + T  +
Sbjct: 235 EKFPQFSKPSEGYHGLVINDALGPLAYIGHVRIELLRDLGPALNPFAAFQLLQGVETLSL 294

Query: 251 RVRKQSENATALVKYLDDHKSEFNKVLDKIYHSSLQTEDFVKKQLEGGYGPVFSIVLKS- 309
           R  + + NA  L +YL+  KS +   +     SS    +  KK L+ G+G V S  +K  
Sbjct: 295 RCERHATNALKLAQYLE--KSPYVSWVSYPGLSSHSHHENAKKYLQNGFGGVLSFGVKDL 352

Query: 310 ----------KVQCKKLPGKLELFQHATSLGGVESLV------EWRALTDPY-----IEQ 348
                     K    ++   L++  +  ++G  ++LV        + LTD       + +
Sbjct: 353 PNAHEIEDPFKASGAQVVDSLKIASNLANVGDSKTLVIAPYFTTHQQLTDEEKLASGVTK 412

Query: 349 TLIRVSVGCEGVEDLIKDLAGALKQL 374
            LIRVSVG E ++D+I D   A +++
Sbjct: 413 DLIRVSVGTEFIDDIIGDFEQAFEKV 438

>TPHA0F00420 Chr6 complement(103419..104747) [1329 bp, 442 aa] {ON}
           Anc_4.53 YLR303W
          Length = 442

 Score = 72.0 bits (175), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 105/438 (23%), Positives = 181/438 (41%), Gaps = 76/438 (17%)

Query: 6   TTLIHA---DDKDNRVTDIVSPINVATTFRYDNNNLIAWNDRENYDFLETTPVYSRLAHP 62
           T  +HA   D  DN       PI   T+F +++++    +  + +   +   +YSR+ +P
Sbjct: 7   TVQLHAGQEDPGDNAHRPAAVPIYQTTSFVFEDSH----HGAQLFGLEKPGYMYSRVGNP 62

Query: 63  NATRLES-IFSEILGGHAVIYSSGLAAY---FATLTHYNPKKLFIGQSYHGCHGIADIFT 118
               LE  + +   G  AV  SSG AA       L H     +     Y G +    +  
Sbjct: 63  TVDVLEKRLAALEGGAAAVCVSSGQAAQTLAITGLAHCGDNIVSTSYLYGGTYNQFKVAF 122

Query: 119 RNNG------MKQYPLDRIEELASEGDIVHLETPVNPFGTSYDIEDFARKAHAKGALLVI 172
           +  G      +   P D  +    +   V++E+  NP     D E     AH  G  +V+
Sbjct: 123 KRLGIDVRFVLGDNPEDFEKLFDEKTKAVYIESIGNPKYNVPDFEKIVAVAHKHGIPVVV 182

Query: 173 DSTFAPPPL--QDVWKFGADVVIHSCTKYFGGHSDLLSGVVV-----------VKSLEVA 219
           D+TF       Q + K G D+V HS TK+ GGH   ++GV+V            K  + +
Sbjct: 183 DNTFGAGGFFCQPI-KHGVDIVTHSATKWIGGHGTTIAGVIVDSGKFPWKDYPEKFPQFS 241

Query: 220 KKMK-------NDRIY---------------LGTNIANLESYLLLRSLRTFEMRVRKQSE 257
           K  +       ND +                LG  +  + ++LLL+ + T  +R  +Q +
Sbjct: 242 KPSEGYHGMIFNDAMGPLAYIAHVRTELLRDLGPVMEPIAAFLLLQGVETLSLRAERQGQ 301

Query: 258 NATALVKYLDDHKSEFNKVLDKIYHSSLQTEDFVKKQLEGGYGPVFSIVLKS-------- 309
           NA  L ++L+  KS     +      S    D  KK L+ G+G V SI +K         
Sbjct: 302 NALKLAQWLE--KSPHVNWVSYPGLPSHPYHDNAKKYLDNGFGGVLSIGVKPLKDVSDSD 359

Query: 310 --KVQCKKLPGKLELFQHATSLGGVESLV------EWRALTD-----PYIEQTLIRVSVG 356
             K    ++   L+L  +  ++G  ++LV        + L+D       + + LIR+S+G
Sbjct: 360 PFKKSGAQVVDNLKLALNLANVGDSKTLVIAPYFTTHQQLSDEDKLKSGVTEDLIRISIG 419

Query: 357 CEGVEDLIKDLAGALKQL 374
            E ++D+I D   + +++
Sbjct: 420 TEFIDDIIADFEQSFEKV 437

>Smik_10.423 Chr10 complement(654265..656184) [1920 bp, 639 aa] {ON}
           YJR130C (REAL)
          Length = 639

 Score = 72.0 bits (175), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 77/258 (29%), Positives = 120/258 (46%), Gaps = 26/258 (10%)

Query: 141 VHLETPVNPFGTSYDIEDFARKAHAKGALLVIDSTFAPPPLQDVWKFGADVVIHSCTKYF 200
           V +E P NP     D+++  R +      +V+D T       DV  + AD+V  S TK F
Sbjct: 387 VFIEAPSNPLLKMGDLQELKRLSDLYSFYIVVDETVGGFVNIDVLPY-ADIVCSSLTKIF 445

Query: 201 GGHSDLLSGVVVV----KSLEVAKK-MKNDRIYLGTNIANLESYLLLRSLRTFEMRVRKQ 255
            G S++++G +V+    K  E A+K MK +  Y    +   ++  L R+ R F  R  K 
Sbjct: 446 SGDSNVIAGSLVLNPKGKIYEFARKFMKTEDGYEDC-LWCEDALCLERNSRDFVERTIKV 504

Query: 256 SENATALVKYLDDHKSEFNKVLDKIYHSSLQTE------DFVKKQLEGGYGPVFSIVLKS 309
           + N   L+  +     +  K+  KIY+ SL +E      D V    +GGYG +FS+   S
Sbjct: 505 NTNTNILLTKV--LLPQVGKLFKKIYYPSLTSEETKRNYDSVISTKDGGYGGLFSLTFFS 562

Query: 310 KVQCKKLPGKLELFQHATSLGGVESLVEWRALTDPY----------IEQTLIRVSVGCEG 359
             + KK    LEL +   SLG   +L    A+   Y          +E+ L+RVSVG E 
Sbjct: 563 IEEAKKFFNNLELCK-GPSLGTNFTLACPYAIIAHYQELDEIAQYGVEKNLVRVSVGLEN 621

Query: 360 VEDLIKDLAGALKQLQDE 377
            + L K    A+++  +E
Sbjct: 622 SDVLCKVFQRAIEKALEE 639

>KNAG0I02920 Chr9 (573008..574345) [1338 bp, 445 aa] {ON} Anc_4.53
           YLR303W
          Length = 445

 Score = 71.2 bits (173), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 75/293 (25%), Positives = 125/293 (42%), Gaps = 66/293 (22%)

Query: 141 VHLETPVNPFGTSYDIEDFARKAHAKGALLVIDSTFAP-----PPLQDVWKFGADVVIHS 195
           V+LE+  NP     D E     AH  G  +++D+TF        PL    K+GAD+V HS
Sbjct: 151 VYLESIGNPKYNVPDFEKIVAVAHKHGIPVMVDNTFGAGGFFCQPL----KYGADIVTHS 206

Query: 196 CTKYFGGHSDLLSGVVV-----------VKSLEVAKKMK--NDRIY-------------- 228
            TK+ GGH   L G++V            K  + +K  +  +  IY              
Sbjct: 207 ATKWIGGHGTTLGGIIVDSGKFPWKDYPEKFPQFSKPAEGYHGTIYNEAYGNLAYIVHVR 266

Query: 229 ------LGTNIANLESYLLLRSLRTFEMRVRKQSENATALVKYLDDHKSEFNKVLDKIYH 282
                 LG+ I+   ++LL++ + T  +R  +  +NA  L K+L+   S +   +     
Sbjct: 267 TELLRDLGSMISPFAAFLLIQGVETLSLRGERHGQNALKLAKWLE--ASPYVSWVSYPGL 324

Query: 283 SSLQTEDFVKKQLEGGYGPVFSIVLKS-----------KVQCKKLPGKLELFQHATSLGG 331
            S    +  KK L  G+G + S  +K            K+   ++   L+L  +  ++G 
Sbjct: 325 PSHSHHENAKKYLSNGFGGMLSFGVKDLPNAATETDPFKLSGAQVVDNLKLASNLANVGD 384

Query: 332 VESLV------EWRALTD-----PYIEQTLIRVSVGCEGVEDLIKDLAGALKQ 373
            ++LV          L D       + + LIRVSVG E ++D+I+D   A ++
Sbjct: 385 SKTLVIAPFFTTHEQLADEEKLASGVTKDLIRVSVGTEYIDDIIEDFKQAFEK 437

>Kpol_1041.44 s1041 (117344..118678) [1335 bp, 444 aa] {ON}
           (117344..118678) [1335 nt, 445 aa]
          Length = 444

 Score = 71.2 bits (173), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 92/386 (23%), Positives = 151/386 (39%), Gaps = 68/386 (17%)

Query: 55  VYSRLAHPNATRLESIFSEILGGHAVI-YSSGLAAY---FATLTHYNPKKLFIGQSYHGC 110
           +YSR+ +P     E   + + GG A +  SSG AA       L H     +     Y G 
Sbjct: 55  IYSRIMNPTVDVFEKRIAALEGGIAALAVSSGQAAQTLAITGLAHAGDNIVSTSYLYGGT 114

Query: 111 HGIADIFTRNNGMK------QYPLDRIEELASEGDIVHLETPVNPFGTSYDIEDFARKAH 164
           +    +  +  G+         P D  +    +   V+LET  NP     D E     AH
Sbjct: 115 YNQFKVAFKRLGINVKFVEGDDPKDFEKLFDEKTKAVYLETIGNPKYNVPDFEKITEVAH 174

Query: 165 AKGALLVIDSTF-APPPLQDVWKFGADVVIHSCTKYFGGHSDLLSGVVV----------- 212
             G  +V+D+TF A        K+G D+V HS TK+ GGH   ++G ++           
Sbjct: 175 KHGIPVVVDNTFGAGGYFCQPIKYGCDIVTHSATKWIGGHGTTVAGAIIDSGKFPWKDYP 234

Query: 213 VKSLEVAKKMK-------NDRIY---------------LGTNIANLESYLLLRSLRTFEM 250
            +  + +K  +       ND                  LG  +    ++LLL+ + T  +
Sbjct: 235 ERFPQFSKPSEGYHGLVFNDAFGPAAFIGHVRTELLRDLGPCLDAFSAFLLLQGVETLSL 294

Query: 251 RVRKQSENATALVKYLDDHKSEFNKVLDKIYHSSLQTEDFVKKQLEGGYGPVFSIVLKS- 309
           R  +  EN   L K+L+  KS +   +      S    +  KK L  G+G V S  +K  
Sbjct: 295 RGERHGENTLKLAKWLE--KSPYVSWVSYPGLPSHSHHENAKKYLSNGFGGVLSFGVKDL 352

Query: 310 ----------KVQCKKLPGKLELFQHATSLGGVESLVEWRALTD-----------PYIEQ 348
                     K    ++   L+L  +  ++G  ++LV     T              + +
Sbjct: 353 PNASDEKDPFKASGAQVVDNLKLALNLANVGDSKTLVIAPYFTTHQQLNEEEKLASGVTK 412

Query: 349 TLIRVSVGCEGVEDLIKDLAGALKQL 374
            LIRVSVG E ++D+I D   + +++
Sbjct: 413 DLIRVSVGTEYIDDIIADFQQSFEKV 438

>Suva_12.221 Chr12 complement(344667..346586) [1920 bp, 639 aa] {ON}
           YJR130C (REAL)
          Length = 639

 Score = 71.2 bits (173), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 73/257 (28%), Positives = 116/257 (45%), Gaps = 24/257 (9%)

Query: 141 VHLETPVNPFGTSYDIEDFARKAHAKGALLVIDSTFAPPPLQDVWKFGADVVIHSCTKYF 200
           V +E P NP     D+++  R +      +V+D T       DV  + AD+V  S TK F
Sbjct: 387 VFIEAPSNPLLKMGDLQELKRLSDLYSFYIVVDETVGGFVNIDVLPY-ADIVCSSLTKIF 445

Query: 201 GGHSDLLSGVVVV----KSLEVAKKMKNDRIYLGTNIANLESYLLLRSLRTFEMRVRKQS 256
            G S++++G +V+    K  E A+K  +        +   ++  L R+ R F  R  K +
Sbjct: 446 SGDSNVIAGSLVLNPRGKIYEFARKFMSTEDGYEDCLWCEDALCLERNSRDFVERTIKVN 505

Query: 257 ENATALVKYLDDHKSEFNKVLDKIYHSSLQTE------DFVKKQLEGGYGPVFSIVLKSK 310
            N   L+  +     +  K+  KIY+ SL +E      D V    +GGYG +FS+   + 
Sbjct: 506 TNTDVLLTKV--LLPQVGKLFKKIYYPSLTSEETKKNYDNVMSTKDGGYGGLFSLTFFNI 563

Query: 311 VQCKKLPGKLELFQHATSLGGVESLVEWRALTDPY----------IEQTLIRVSVGCEGV 360
            + KK    LEL +   SLG   +L    A+   Y          +E+ L+RVSVG E  
Sbjct: 564 ERAKKFFNSLELCK-GPSLGTNFTLACPYAIIAHYQELDEIAQYGVEKNLVRVSVGLENS 622

Query: 361 EDLIKDLAGALKQLQDE 377
           + L K    A+ +  +E
Sbjct: 623 DVLCKVFQQAIGKASEE 639

>Skud_10.353 Chr10 complement(623771..625693) [1923 bp, 640 aa] {ON}
           YJR130C (REAL)
          Length = 640

 Score = 70.9 bits (172), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 77/274 (28%), Positives = 128/274 (46%), Gaps = 29/274 (10%)

Query: 128 LDRIEELASEGD---IVHLETPVNPFGTSYDIEDFARKAHAKGALLVIDSTFAPPPLQDV 184
           +D ++++   G+    V +E P NP     D+++  R +      +V+D T       DV
Sbjct: 372 MDALKKILHSGEQILAVFIEAPSNPLLKMGDLQELKRLSDLYSFYIVVDETVGGFVNIDV 431

Query: 185 WKFGADVVIHSCTKYFGGHSDLLSGVVVV----KSLEVAKK-MKNDRIYLGTNIANLESY 239
             + AD++  S TK F G S++++G +V+    K  E AKK MK++  Y    +   ++ 
Sbjct: 432 LPY-ADIICSSLTKIFSGDSNVIAGSLVLNPRGKIYEFAKKFMKSENGYEDC-LWCEDAL 489

Query: 240 LLLRSLRTFEMRVRKQSENATALVKYLDDHKSEFNKVLDKIYHSSLQTE------DFVKK 293
            L R+ R F  R  K + N   L+  +     +  K+  KIY+ SL +E      D V  
Sbjct: 490 CLERNSRDFVERTIKVNTNTDILLTKV--LLPQVGKLFKKIYYPSLTSEETKRNYDSVMA 547

Query: 294 QLEGGYGPVFSIVLKSKVQCKKLPGKLELFQHATSLGGVESLVEWRALTDPY-------- 345
             +GGYG +FS+      + KK    LEL +   SLG   +L    A+   Y        
Sbjct: 548 TRDGGYGGLFSLTFFDIEKAKKFFNNLELCK-GPSLGTNFTLACPYAIIAHYQELDEIAQ 606

Query: 346 --IEQTLIRVSVGCEGVEDLIKDLAGALKQLQDE 377
             +E+ L+RVSVG E  + L +    A+++  +E
Sbjct: 607 YGVEKNLVRVSVGLENSDVLCRVFQRAIEKAVEE 640

>SAKL0H23892g Chr8 (2059083..2060411) [1329 bp, 442 aa] {ON} highly
           similar to uniprot|P06106 Saccharomyces cerevisiae
           YLR303W MET17 O-acetyl homoserine-O-acetyl serine
           sulfhydrylase required for sulfur amino acid synthesis
          Length = 442

 Score = 70.5 bits (171), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 76/310 (24%), Positives = 128/310 (41%), Gaps = 70/310 (22%)

Query: 127 PLDRIEELASEGDIVHLETPVNPFGTSYDIEDFARKAHAKGALLVIDSTFAPPPL--QDV 184
           P D  ++   +   ++LE+  NP     D E     AH  G  +V+D+TF       Q +
Sbjct: 136 PEDFEKQFDEKTKALYLESIGNPKYNVPDFEKIVAIAHKHGIPVVVDNTFGAGGFFCQPI 195

Query: 185 WKFGADVVIHSCTKYFGGHSDLLSGVVV-----------VKSLEVAKKMK-------NDR 226
            K+GAD+V HS TK+ GGH   ++G ++            K  + +K  +       ND 
Sbjct: 196 -KWGADIVTHSATKWIGGHGTTIAGAIIDSGKFPWKDYPEKFPQFSKPSEGYHGLVFNDA 254

Query: 227 IY---------------LGTNIANLESYLLLRSLRTFEMRVRKQSENATALVKYLDDHKS 271
                            LG  ++   S+LLL+ L T  +R  + + NA  L ++L+  KS
Sbjct: 255 FGPLAFIGHARTELLRDLGPALSPFSSFLLLQGLETLSLRGERHAYNALKLAQWLE--KS 312

Query: 272 EFNKVLDKIYHSSLQTEDFVKKQLEGGYGPVFSIVLKS-----------KVQCKKLPGKL 320
            +   +      S    +  KK L+ G+G V S  +K            K    ++   L
Sbjct: 313 PYVSWVSYPGLESHTHHENAKKYLQNGFGGVLSFGVKPLPNASEESDPFKASGAQVVDNL 372

Query: 321 ELFQHATSLGGVESLVEWRALTDPY----------------IEQTLIRVSVGCEGVEDLI 364
           +L  +  ++G  ++LV       PY                +   LIRVSVG E ++D+I
Sbjct: 373 KLASNLANVGDSKTLV-----IAPYFTTHQQLSHEEKLASGVTDDLIRVSVGTEFIDDII 427

Query: 365 KDLAGALKQL 374
            D   + +++
Sbjct: 428 ADFEQSFEKI 437

>SAKL0G18172g Chr7 complement(1572652..1574673) [2022 bp, 673 aa]
           {ON} similar to uniprot|P47164 Saccharomyces cerevisiae
           YJR130C STR2 Cystathionine gamma-synthase converts
           cysteine into cystathionine
          Length = 673

 Score = 70.9 bits (172), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 87/311 (27%), Positives = 131/311 (42%), Gaps = 32/311 (10%)

Query: 91  ATLTHYNP---KKLFIGQSYHGCHGIADIFTRNN--GM-KQYPLDRIEELASEGD---IV 141
           A++  Y P   K +  G  Y     I   F   +  GM     +D ++E+   G+    V
Sbjct: 360 ASVVGYGPPYKKTVMFGFPYTDTLSILSKFNHTHFLGMGDSTAMDTLKEILHSGEQILAV 419

Query: 142 HLETPVNPFGTSYDIEDFARKAHAKGALLVIDSTFAPPPLQDVWKFGADVVIHSCTKYFG 201
            +ETP NP     D+ +  R A   G  +V+D T       DV    AD+V  S TK F 
Sbjct: 420 FMETPSNPLLKMGDLLELKRLADIYGFYVVVDETAGGFVNIDVLPH-ADLVCSSLTKIFS 478

Query: 202 GHSDLLSGVVVV----KSLEVAKKMKNDRIYLGTNIANLESYLLLRSLRTFEMRVRKQSE 257
           G S++++G +V+    +  E A++   +  Y    +   ++  L R+ R F  R  K + 
Sbjct: 479 GDSNVMAGSLVLNPNSRLHEFAQEFFRNGEYEDC-LWCEDAIYLERNSRDFVTRTLKVNS 537

Query: 258 NATALVKYLDDHKSEFNKVLDKIYHSSLQTE------DFVKKQLEGGYGPVFSIVLKSKV 311
           NA  L+   D    E   +  KIY+  L +E      D V+ +  GGYG +FS+      
Sbjct: 538 NAEMLLN--DVLIPEEGHLFSKIYYPRLTSEETKQNYDTVRCKPNGGYGGLFSLTFYEIE 595

Query: 312 QCKKLPGKLEL---------FQHATSLGGVESLVEWRALTDPYIEQTLIRVSVGCEGVED 362
           Q KK    LEL         F  A     +    E   +    +E  L+RVSVG E  E 
Sbjct: 596 QAKKFFNALELCKGPSLGTNFTLACPYAVLAHYAELEKVAQYGVEANLVRVSVGLEDAEH 655

Query: 363 LIKDLAGALKQ 373
           L K    A+ +
Sbjct: 656 LRKVFREAISE 666

>YJR130C Chr10 complement(665218..667137) [1920 bp, 639 aa] {ON}
           STR2Cystathionine gamma-synthase, converts cysteine into
           cystathionine
          Length = 639

 Score = 70.1 bits (170), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 75/254 (29%), Positives = 117/254 (46%), Gaps = 26/254 (10%)

Query: 141 VHLETPVNPFGTSYDIEDFARKAHAKGALLVIDSTFAPPPLQDVWKFGADVVIHSCTKYF 200
           V +E P NP     D+++  R +      +V+D T       DV  + AD+V  S TK F
Sbjct: 387 VFIEAPSNPLLKMGDLQELKRLSDLYSFYIVVDETVGGFVNIDVLPY-ADIVCSSLTKIF 445

Query: 201 GGHSDLLSGVVVV----KSLEVAKK-MKNDRIYLGTNIANLESYLLLRSLRTFEMRVRKQ 255
            G S++++G +V+    K  E A+K MK +  Y    +   ++  L R+ R F  R  K 
Sbjct: 446 SGDSNVIAGSLVLNPRGKIYEFARKFMKTEDGYEDC-LWCEDALCLERNSRDFVERTIKV 504

Query: 256 SENATALVKYLDDHKSEFNKVLDKIYHSSLQTEDF------VKKQLEGGYGPVFSIVLKS 309
           + N   L+K +     +  K+  KIY+ SL +ED       V    +GGYG +FS+   +
Sbjct: 505 NTNTDILLKRV--LLPQVGKLFKKIYYPSLTSEDTKRNYDSVMSTKDGGYGGLFSLTFFN 562

Query: 310 KVQCKKLPGKLELFQHATSLGGVESLVEWRALTDPY----------IEQTLIRVSVGCEG 359
             + KK    LEL +   SLG   +L    A+   Y          +E  L+RVSVG E 
Sbjct: 563 IEEAKKFFNNLELCK-GPSLGTNFTLACPYAIIAHYQELDEVAQYGVETNLVRVSVGLEN 621

Query: 360 VEDLIKDLAGALKQ 373
            + L      A+++
Sbjct: 622 SDVLCNVFQRAIEK 635

>YFR055W Chr6 (264204..265226) [1023 bp, 340 aa] {ON}
           IRC7Beta-lyase involved in the production of thiols;
           null mutant displays increased levels of spontaneous
           Rad52p foci; expression induced by nitrogen limitation
           in a GLN3, GAT1-dependent manner and by copper levels in
           a Mac1-dependent manner
          Length = 340

 Score = 68.9 bits (167), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 73/296 (24%), Positives = 123/296 (41%), Gaps = 31/296 (10%)

Query: 56  YSRLAHPNATRLESIFSEILGGHAVIYS-SGLAAY--------------FATLTHYNPKK 100
           Y     P    LE+ ++ + GG   + S SGL +                 T + Y P +
Sbjct: 56  YGTAGSPTIDNLENAWTHLTGGAGTVLSASGLGSISLALLALSKAGDHILMTDSVYVPTR 115

Query: 101 LFIGQSYHGCHGIADIFTRNNGMKQYPLDR-IEELASEGD-IVHLETPVNPFGTSYDIED 158
           +        C G+   F          + + IE+L      ++ LE+P +      DI  
Sbjct: 116 ML-------CDGLLAKFGVETDYYDPSIGKDIEKLVKPNTTVIFLESPGSGTMEVQDIPA 168

Query: 159 FARKAHAKGALLVIDSTFAPPPLQDVWKFGADVVIHSCTKYFGGHSDLLSGVVVVKSLEV 218
               A   G   ++D+T+A P   D    G D+ + + TKY GGHSDLL G+      E 
Sbjct: 169 LVSVAKKHGIKTILDNTWATPLFFDAHAHGIDISVEAGTKYLGGHSDLLIGLASANE-EC 227

Query: 219 AKKMKNDRIYLGTNIANLESYLLLRSLRTFEMRVRKQSENATALVKYLDDHKSEFNKVLD 278
              +++    +       +  L LR +RT  +R+++    A  L  +L + + E  KVL 
Sbjct: 228 WPLLRSTYDAMAMLPGAEDCQLALRGMRTLHLRLKEVERKALDLAAWLGN-RDEVEKVLH 286

Query: 279 KIYHSSLQTEDFVKKQLEGGYGPVFSIVLK---SKVQCKKLPGKLELFQHATSLGG 331
             +      E +V +  +G  G +FSIVLK   ++   +K+   +++ Q   S GG
Sbjct: 287 PAFEDCPGHEYWV-RDYKGSSG-LFSIVLKNGFTRAGLEKMVEGMKVLQLGFSWGG 340

>KAFR0F03070 Chr6 (610571..611908) [1338 bp, 445 aa] {ON} Anc_4.53
           YLR303W
          Length = 445

 Score = 69.7 bits (169), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 72/290 (24%), Positives = 125/290 (43%), Gaps = 60/290 (20%)

Query: 141 VHLETPVNPFGTSYDIEDFARKAHAKGALLVIDSTFAPPPL--QDVWKFGADVVIHSCTK 198
           V+LE+  NP     D E     AH  G  +++D+TF       Q + K+G D+V HS TK
Sbjct: 151 VYLESIGNPKYNVPDFEKIVAVAHKHGIPVMVDNTFGAGGFFCQPI-KYGVDIVTHSATK 209

Query: 199 YFGGHSDLLSGVVV-----------VKSLEVAKKMK--NDRIY----------------- 228
           + GGH   L GV++            K  + +K  +  +  IY                 
Sbjct: 210 WIGGHGTTLGGVIIDSGKFPWKDYPEKFPQFSKPAEGYHGTIYNEAYGNLAYIVHVRTEL 269

Query: 229 ---LGTNIANLESYLLLRSLRTFEMRVRKQSENATALVKYLDDHKSEFNKVLDKIYHSSL 285
              LG+ ++   ++LLL+ + T  +R  +  ENA  L K+L+  +S +   +      S 
Sbjct: 270 LRDLGSLMSPFAAFLLLQGVETLSLRGERHGENALKLAKWLE--QSPYVSWVSYPGLPSH 327

Query: 286 QTEDFVKKQLEGGYGPVFSIVLKS-----------KVQCKKLPGKLELFQHATSLGGVES 334
              +  KK L  G+G + S  +K            K+   ++   L++  +  ++G  ++
Sbjct: 328 SHHENAKKYLSNGFGGMLSFGVKDLPNADTETDPFKLSGAQVVDNLKIASNLANVGDSKT 387

Query: 335 LV------EWRALTDPY-----IEQTLIRVSVGCEGVEDLIKDLAGALKQ 373
           LV        + L D       + + LIRVSVG E ++D+I D   + ++
Sbjct: 388 LVIAPYFTTHQQLNDEEKLASGVTKDLIRVSVGTEFIDDIINDFQQSFER 437

>Ecym_8365 Chr8 complement(732418..733752) [1335 bp, 444 aa] {ON}
           similar to Ashbya gossypii ADL031W
          Length = 444

 Score = 68.6 bits (166), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 96/424 (22%), Positives = 165/424 (38%), Gaps = 93/424 (21%)

Query: 33  YDNNNLIAWNDRENYD-FLETTP--VYSRLAHPNATRLESIFSEILGGHA-VIYSSGLAA 88
           Y  ++ +  N +   D F   TP  +YSR+ +P    LE   + + GG   V  +SG AA
Sbjct: 29  YATSSYVFKNSQHGADLFGLNTPGYLYSRMGNPTVDVLEKRLAALEGGRGCVAVASGQAA 88

Query: 89  Y---FATLTHYNPKKLFIGQSYHGCH----------GIADIFTRNNGMKQYPLDRIEELA 135
                  L       +     Y G +          G+   F+     + Y     E+L 
Sbjct: 89  QAMALGALAQVGDNIVTSSHLYGGTYNQLKVAFKRLGVEVRFSEGGEAEDY-----EQLF 143

Query: 136 SEG-DIVHLETPVNPFGTSYDIEDFARKAHAKGALLVIDSTFAPP-----PLQDVWKFGA 189
            +    +++E+  NP  T  D E     AH  G  +V+D+TF        P++    FGA
Sbjct: 144 DDKTKALYVESIGNPKYTVPDFEKITEVAHKHGIPVVVDNTFGAAGFFCKPIE----FGA 199

Query: 190 DVVIHSCTKYFGGHSDLLSGVVV-------------VKSLEVAKKMKNDRIY-------- 228
           D++ HS TK+  GH   ++G +V                     +  +  +Y        
Sbjct: 200 DIITHSATKWINGHGTAIAGAIVDSGNFPWTQYPDKFPQFSQPAESYHGMVYNDNFGPLA 259

Query: 229 ------------LGTNIANLESYLLLRSLRTFEMRVRKQSENATALVKYLDDHKSEFNKV 276
                       LG+ ++   ++L L+ L T  +R  + + N+  L ++L+D  S +   
Sbjct: 260 FIAYVRLELLRDLGSTMSPFTAFLSLQGLETLSLRCERHARNSIDLARHLED--SPYVAW 317

Query: 277 LDKIYHSSLQTEDFVKKQLEGGYGPVFSIVLK---------------SKVQCKKLPGKLE 321
           +      S  + +  KK L  G G + S  +K               + V   K    L+
Sbjct: 318 VSYPGLDSHPSRNNAKKYLTNGAGGMLSFGIKPFDKTNGEEEASEVDTSVIAAKFVDSLK 377

Query: 322 LFQHATSLGGVESLV------EWRALTD-----PYIEQTLIRVSVGCEGVEDLIKDLAGA 370
           L  +  ++G  ++LV        + LTD        ++ +IRVSVG E ++D+I D   A
Sbjct: 378 LASNLANVGDSKTLVIAPYFTTHQQLTDEEKLKAGADKDVIRVSVGTEYIDDIIADFEQA 437

Query: 371 LKQL 374
            K +
Sbjct: 438 FKTV 441

>Kpol_1028.80 s1028 (179685..181754) [2070 bp, 689 aa] {ON}
           (179685..181754) [2070 nt, 690 aa]
          Length = 689

 Score = 66.6 bits (161), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 72/269 (26%), Positives = 118/269 (43%), Gaps = 47/269 (17%)

Query: 141 VHLETPVNPFGTSYDIEDFARKAHAKGALLVIDSTFAPPPLQDVWKFGADVVIHSCTKYF 200
           V +ETP NP     D+    R A+  G  ++ID T       DV  + AD+V  S TK F
Sbjct: 428 VFVETPSNPLLKMPDLAHLRRLANLYGFYIIIDETMGGFVNIDVLPY-ADIVCSSLTKIF 486

Query: 201 GGHSDLLSGVVVVKSLEVAKKMKNDRIYLGTNIANLESYL-------LLRSLRTFEMRVR 253
            G S++++G +V+   E   K+ +      + +   E +L       L R+ R F  R  
Sbjct: 487 SGSSNVIAGSMVLNPQE---KLYSFAQVFMSQLGEYEDHLWCEDAIYLERNSRDFIARTI 543

Query: 254 KQSENATALVKYLDDHKSEFNKVLDKIYHSSLQTE------DFVKKQL-------EGGYG 300
           K ++N   L+K +   +   +K+  KI++ SL +       D V+ +        EGGYG
Sbjct: 544 KTNQNTEFLLKKVLLAQEGPSKLFKKIFYPSLTSAESKVNYDAVRCKSIDKDSDEEGGYG 603

Query: 301 PVFSIVLKSKVQCKKLPGKLELFQHATSLGGVESLVEWRALTDPY--------------- 345
            +FS+      Q K       +F +  +L    SL     L+ PY               
Sbjct: 604 GLFSLAFNKIEQAK-------IFFNELNLSKGPSLGTNFTLSCPYTVLMYYDKLDEVAKY 656

Query: 346 -IEQTLIRVSVGCEGVEDLIKDLAGALKQ 373
            +E++L+RVS+G E  ++L K    A+ +
Sbjct: 657 EVEESLVRVSIGIESQDELQKAFQHAIDE 685

>KLLA0D04037g Chr4 (336499..337833) [1335 bp, 444 aa] {ON} highly
           similar to uniprot|P06106 Saccharomyces cerevisiae
           YLR303W MET17 O-acetyl homoserine-O-acetyl serine
           sulfhydrylase required for sulfur amino acid synthesis
          Length = 444

 Score = 65.9 bits (159), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 95/384 (24%), Positives = 153/384 (39%), Gaps = 70/384 (18%)

Query: 55  VYSRLAHPNATRLESIFSEILGGHAVIY-SSGLAAY---FATLTHYNPKKLFIGQSYHGC 110
           +YSR+ +P    LE   + + GG A +  SSG AA       L H     +     Y G 
Sbjct: 54  IYSRIMNPTLDVLEKRLAALEGGIAALATSSGQAAQTLAVTGLAHTGDNIVSTSFLYGGT 113

Query: 111 HGIADIFTRNNGMKQYPLD-----RIEELASEG-DIVHLETPVNPFGTSYDIEDFARKAH 164
           +    +  +  G++   +D       E+L  E    ++LE+  NP     D E     AH
Sbjct: 114 YNQFKVAFKRLGIEARFVDGDKPEDFEKLFDEKTKALYLESIGNPKYNVPDFEKIVAVAH 173

Query: 165 AKGALLVIDSTFAPPPL--QDVWKFGADVVIHSCTKY----------------------- 199
             G  +V+D+TF       Q + K+GAD+V HS TK+                       
Sbjct: 174 KHGIPVVVDNTFGAGGFFCQPI-KYGADIVTHSATKWIGGHGVTVGGVIIDSGKFPWKDY 232

Query: 200 ------FGGHSDLLSGVVVVKSLEVAKKMKNDRIY----LGTNIANLESYLLLRSLRTFE 249
                 F   S+   G++   +   A  + + R      LG  ++    +LLL+ L T  
Sbjct: 233 PEKFPQFSQPSEGYHGLIFNDAFGPAAFIGHVRTELLRDLGPVLSPFAGFLLLQGLETLS 292

Query: 250 MRVRKQSENATALVKYLDDHKSEFNKVLDKIYHSSLQTEDFVKKQLEGGYGPVFSIVLKS 309
           +R  +   NA  L +YL+   S +   +      S    +  KK LE G+G V S  +K 
Sbjct: 293 LRGERHGSNALKLAQYLE--SSPYVSWVSYPGLPSHSHHENAKKYLENGFGGVLSFGVKD 350

Query: 310 -----------KVQCKKLPGKLELFQHATSLGGVESLV------EWRALTD-----PYIE 347
                      K    ++   L+L  +  ++G  ++LV        + LTD       + 
Sbjct: 351 LPNASEESDPFKASGAQVVDNLKLASNLANVGDSKTLVIAPYFTTHQQLTDEEKLASGVT 410

Query: 348 QTLIRVSVGCEGVEDLIKDLAGAL 371
           + LIRVSVG E ++D+I D   + 
Sbjct: 411 KDLIRVSVGTEFIDDIIADFEASF 434

>TPHA0L00330 Chr12 (43495..45648) [2154 bp, 717 aa] {ON} Anc_4.354
           YJR130C
          Length = 717

 Score = 65.9 bits (159), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 70/271 (25%), Positives = 119/271 (43%), Gaps = 47/271 (17%)

Query: 141 VHLETPVNPFGTSYDIEDFARKAHAKGALLVIDSTFAPPPLQDVWKFGADVVIHSCTKYF 200
           V +E P NP     D++     A+  G  +VID T       DV  F AD+V  S ++ F
Sbjct: 456 VFIEIPSNPLLKVADLKYLRNLANIYGFYIVIDETLGGFVNIDVLPF-ADIVCSSLSQSF 514

Query: 201 GGHSDLLSGVVVVKSLEVAKKMKNDRIYLGTNIANLESY-------LLLRSLRTFEMRVR 253
           GG S++++G +V+   E  K  +  +++L   +   E+Y       +L R+ R F  R  
Sbjct: 515 GGDSNVMAGSMVLNPQE--KLYQFAQLFL-NQLGEYENYVWCEDAIILERNSRDFIPRSI 571

Query: 254 KQSENATALVKYLDDHKSEFNKVLDKIYHSSLQT----EDFVK---------KQLEGGYG 300
             + N+  L+  +       +K+  KIY+ SL +    E++ K         ++ EGGYG
Sbjct: 572 TINHNSEYLINEVLLPNEGPDKIFKKIYYPSLTSDETKENYDKLRCKKIPNFEKEEGGYG 631

Query: 301 PVFSIVLKSKVQCKKLPGKLELFQHATSLGGVESLVEWRALTDPY--------------- 345
            + S+   +    K+   ++ + +         SL     L  PY               
Sbjct: 632 GIISLTFHNLDTSKRFFDEINITKGP-------SLSTNHTLACPYTILSYFDNLAQVEKF 684

Query: 346 -IEQTLIRVSVGCEGVEDLIKDLAGALKQLQ 375
            +E+ LIR+ +GCE  EDL K    A+++ Q
Sbjct: 685 GVEENLIRIKIGCESKEDLAKVFLHAIEKAQ 715

>KLTH0G00418g Chr7 complement(23130..24836) [1707 bp, 568 aa] {ON}
           similar to uniprot|Q12198 Saccharomyces cerevisiae
           YLL058W Hypothetical ORF
          Length = 568

 Score = 64.7 bits (156), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 65/259 (25%), Positives = 116/259 (44%), Gaps = 35/259 (13%)

Query: 141 VHLETPVNPFGTSYDIEDFARKAHAKGALLVIDSTFAPPPLQDVWKFGADVVIHSCTKYF 200
           V LETP NP     D++     A+  G  +V+D T     + DV  + AD+V  S TK F
Sbjct: 320 VFLETPSNPMLNMPDLKQLRNMANEYGFFIVVDDTIGGLNV-DVLPY-ADIVCTSLTKLF 377

Query: 201 GGHSDLLSGVVVV--KSLEVAKKMKNDRIYLGTNIANLESYLLLRS-LRTFEMRVRKQSE 257
            G S+++ G +++  KS   +  ++  R      +  LE  ++L +  R FE R  + +E
Sbjct: 378 SGSSNVMGGSIILNPKSALYSCALQYFRGGEFEELLWLEDAIILEANSRDFEERTTRTNE 437

Query: 258 NATALVKYLDDHKSEFNKVLDKIYHSSLQTEDFVK-----KQLEGGYGPVFSIVLKSKVQ 312
           N   L++ +     E  K+  K+Y+ ++ +++  K     +   GGYG +FS+   ++  
Sbjct: 438 NTMKLIQEV--LLPEEGKIFKKVYYPTVSSKETFKNFESVRTNGGGYGSLFSLSFFNEED 495

Query: 313 CKKLPGKLELFQHATSLGGVESLVEWRALTDPYI----------------EQTLIRVSVG 356
            KK    L +F+  ++            L  PY+                  +L+RVSVG
Sbjct: 496 AKKFYNSLTVFKGPSNGTNF-------TLACPYVHLAHHFELEEVSTFGAHSSLVRVSVG 548

Query: 357 CEGVEDLIKDLAGALKQLQ 375
            E  + L+   +  +  L+
Sbjct: 549 LENTQWLLNAFSSVINLLR 567

>KLTH0D17930g Chr4 (1486259..1488217) [1959 bp, 652 aa] {ON} similar
           to uniprot|P47164 Saccharomyces cerevisiae YJR130C STR2
           Cystathionine gamma-synthase converts cysteine into
           cystathionine
          Length = 652

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 72/271 (26%), Positives = 123/271 (45%), Gaps = 27/271 (9%)

Query: 125 QYPLDRIEELASEGD---IVHLETPVNPFGTSYDIEDFARKAHAKGALLVIDSTFAPPPL 181
           Q  +D+++++   G+    V +E P NP     D+ +    A+A G  +V+D T      
Sbjct: 378 QKSMDQLKDILHSGEQILAVFMEAPSNPLLKMGDLVELRELANAYGFYIVVDETAGGFVN 437

Query: 182 QDVWKFGADVVIHSCTKYFGGHSDLLSGVVVVKSLEVAKKMKNDRIYLGTNIANL----E 237
            DV    AD+V  S TK F G S++++G VV+            + +   +  +L    +
Sbjct: 438 IDVLPH-ADIVCSSLTKIFSGDSNVMAGSVVLNPRSPLYPFAQ-QFFSSDSFEDLLWCED 495

Query: 238 SYLLLRSLRTFEMRVRKQSENATALVKYLDDHKSEFNKVLDKIYHSSLQTEDFVKKQ--- 294
           +  L R+ R F  R    ++N   L++  D    +  K+  KI+  SL +E+  +     
Sbjct: 496 AIYLERNSRDFATRTLTVNKNTQRLLE--DVLLPQEGKLFKKIFFPSLTSEETKRNYDVV 553

Query: 295 --LEGGYGPVFSIVLKSKVQCKKLPGKLELFQHATSLGGVESLVEWRALTDPY------- 345
              +GGYG +FS+    + Q +     LEL +   SLG   +L    A+   Y       
Sbjct: 554 LCPQGGYGGLFSLTFYREEQARVFFDVLELCK-GPSLGTNFTLACPYAILAHYAELEEVA 612

Query: 346 ---IEQTLIRVSVGCEGVEDLIKDLAGALKQ 373
              +E++L+RVSVG E  E L    + A+K+
Sbjct: 613 KYGVERSLVRVSVGLESAESLNHVFSHAIKE 643

>Suva_13.68 Chr13 (103103..105169) [2067 bp, 688 aa] {ON} YML082W
           (REAL)
          Length = 688

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 70/254 (27%), Positives = 111/254 (43%), Gaps = 24/254 (9%)

Query: 141 VHLETPVNPFGTSYDIEDFARKAHAKGALLVIDSTFAPPPLQDVWKFGADVVIHSCTKYF 200
           V +ETP NP     ++ +  R +   G  ++ID T       D   F AD+V  S TK F
Sbjct: 434 VFIETPSNPLLKMGNLVELKRLSELFGFFIIIDETVGGIVNIDGLPF-ADLVCSSLTKTF 492

Query: 201 GGHSDLLSGVVVVKSLEVAKKMKNDRIYLGTNIANL----ESYLLLRSLRTFEMRVRKQS 256
            G S+++ G +V+       +     + L     +L    ++  L R+ R F  R  + +
Sbjct: 493 SGDSNVIGGSMVLNPQSRVYEFATRFMQLEDEYEDLLWCEDAIYLERNSRDFIARTIRIN 552

Query: 257 ENATALV-KYLDDHKSEFNKVLDKIYHSSLQTE------DFVKKQLEGGYGPVFSIVLKS 309
            N   L+ K +  H  E N +  KIY+ +L ++      D V+ + EGGYG +FS+    
Sbjct: 553 YNTEYLLDKIIKPHVGE-NALFKKIYYPNLTSKETLTNYDMVRCKKEGGYGGLFSLTFHD 611

Query: 310 KVQCKKLPGKLELFQHATSLGGVESLVEWRALTDPY----------IEQTLIRVSVGCEG 359
           +   +     L+L     SLG   +LV    L   Y          +E+ L+R+SVG E 
Sbjct: 612 EDHAEAFYDNLQL-NKGPSLGTNFTLVFPYTLMTYYHEMAMAEKFGVERNLLRISVGLEN 670

Query: 360 VEDLIKDLAGALKQ 373
              L K    A+ Q
Sbjct: 671 QLTLGKIFQKAIDQ 684

>AER164C Chr5 complement(944867..946804) [1938 bp, 645 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJR130C
           (STR2) and YML082W
          Length = 645

 Score = 63.5 bits (153), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 83/314 (26%), Positives = 134/314 (42%), Gaps = 38/314 (12%)

Query: 91  ATLTHYNP---KKLFIGQSYHGCHGIADIFTRNNGM---KQYPLDRIEELASEGD---IV 141
             L  Y P   K +  G  Y     I  +F   + +       + ++E++   G+    V
Sbjct: 332 GALVGYGPPYKKTVMFGFPYTDTLSILRVFNHTHFLGSGDHKAMAQLEDILHSGEPILAV 391

Query: 142 HLETPVNPFGTSYDIEDFARKAHAKGALLVIDSTFAPPPLQDVWKFGADVVIHSCTKYFG 201
            +ETP NP     D++   R A   G  LV+D T       DV    AD+V  S TK F 
Sbjct: 392 FIETPSNPLLKMGDLQALRRLADIYGFYLVVDDTLGGFVNIDVLPH-ADLVCSSLTKIFS 450

Query: 202 GHSDLLSGVVVVKSLEVAKKMKNDRIYLGT--NIANLESYLLL----RSLRTFEMRVRKQ 255
           G S++++G +VV              + G+  ++   E  + L    R   +  +RV K 
Sbjct: 451 GDSNVMAGSLVVNPASRLYDFAQGFFHNGSYEDLLWCEDAIYLERNSRDCASRSLRVNKN 510

Query: 256 SENATALVKYLDDHKSEFNKVLDKIYHSSLQTE------DFVKKQLEGGYGPVFSIVLKS 309
           +E    L K L  H+    K   KI++ +L +E      D V+ + +GGYG +FS+    
Sbjct: 511 TE--LLLEKVLLPHQGSLFK---KIFYPTLTSEETKRNYDAVRCKPDGGYGGLFSLTFHE 565

Query: 310 KVQCKKLPGKLELFQHATSLGGVESL----------VEWRALTDPYIEQTLIRVSVGCEG 359
           + + K     LEL +   SLG   +L           E   + +  +E++L+RVSVG E 
Sbjct: 566 ENRAKVFFDTLELCK-GPSLGTNFTLACPYTVLAHYAEMDVVAEYGLERSLVRVSVGLED 624

Query: 360 VEDLIKDLAGALKQ 373
            + L K    A+ +
Sbjct: 625 FDHLRKVFQRAIDK 638

>Ecym_5169 Chr5 complement(353237..355282) [2046 bp, 681 aa] {ON}
           similar to Ashbya gossypii AER164C
          Length = 681

 Score = 63.2 bits (152), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 71/240 (29%), Positives = 107/240 (44%), Gaps = 29/240 (12%)

Query: 141 VHLETPVNPFGTSYDIEDFARKAHAKGALLVIDSTFAPPPLQDVWKFGADVVIHSCTKYF 200
           V +ETP NP     D+ +  + A A    ++ID T       DV ++ AD+V  S TK F
Sbjct: 427 VFIETPSNPLLKMGDLLELRKLADAYDFYVIIDDTIGGFINVDVLQY-ADIVCSSLTKIF 485

Query: 201 GGHSDLLSGVVVVKSLEVAKKMKNDRIYLGTNIANL----ESYLLLRSLRTFEMRVRKQS 256
            G S++++G +V+       K+   R +   +  +L    +S  L R+ R    R  K +
Sbjct: 486 SGDSNVMAGSLVLNPSSRLYKLAR-RFFASDDYEDLLWCEDSIYLERNSRDCVSRSMKIN 544

Query: 257 ENATALVK--YLDDHKSEFNKVLDKIYHSSLQTE------DFVKKQLEGGYGPVFSIVLK 308
           ENA  L+K   L    + F     KIY+ SL +       D VK Q  GGYG +FS+   
Sbjct: 545 ENAERLLKGTLLPLEGTLFK----KIYYPSLTSSETKANYDAVKCQPNGGYGGLFSLTFF 600

Query: 309 SKVQCKKLPGKLELFQHATSLGGVESLV----------EWRALTDPYIEQTLIRVSVGCE 358
                K     L+L +   SLG   +L           E   +    +E+ L+RVS+G E
Sbjct: 601 DDECAKAFFNSLDLCK-GPSLGTNFTLACPYTILAHYGEMDVVAKYGLEKNLVRVSIGLE 659

>CAGL0D06402g Chr4 (602973..604301) [1329 bp, 442 aa] {ON} highly
           similar to uniprot|P06106 Saccharomyces cerevisiae
           YLR303w MET25 O-acetylhomoserine sulfhydrylase
          Length = 442

 Score = 62.8 bits (151), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 72/297 (24%), Positives = 126/297 (42%), Gaps = 72/297 (24%)

Query: 141 VHLETPVNPFGTSYDIEDFARKAHAKGALLVIDSTFAPPPL--QDVWKFGADVVIHSCTK 198
           V+LE+  NP     D E+    AH  G  +V+D+TF       Q + K+GAD+V HS TK
Sbjct: 151 VYLESIGNPKYNVPDFENIVAVAHKHGIPVVVDNTFGAGGFFCQPI-KYGADIVTHSATK 209

Query: 199 Y-----------------------------FGGHSDLLSGVVVVKS-------LEVAKKM 222
           +                             F   ++   G V  ++       + V  ++
Sbjct: 210 WIGGHGTTIGGIIVDSGKFPWKDYPEKFPQFSKPAEGYHGTVYNETYGNLAYIVHVRTEL 269

Query: 223 KNDRIYLGTNIANLESYLLLRSLRTFEMRVRKQSENATALVKYLDDHKSEFNKVLDKIYH 282
             D   LG  ++   ++LLL+ + T  +R  +  +NA AL K+L     E N  +  + +
Sbjct: 270 LRD---LGPGMSPFAAFLLLQGVETLSLRGERHGQNALALAKWL-----EKNPHVAWVSY 321

Query: 283 SSLQT---EDFVKKQLEGGYGPVFSIVLKS-----------KVQCKKLPGKLELFQHATS 328
             L +    +  KK L  G+G V S  +K            K+   ++   L++  +  +
Sbjct: 322 PGLPSHSHHENAKKYLSNGFGGVLSFGVKDLPNADKETDPFKLAGAQVVDNLKIASNLAN 381

Query: 329 LGGVESLV------EWRALTDPY-----IEQTLIRVSVGCEGVEDLIKDLAGALKQL 374
           +G  ++LV        + L+DP      + + LIRVSVG E ++D+I D   +  ++
Sbjct: 382 VGDSKTLVIAPYFTTHQQLSDPEKLASGVTKDLIRVSVGTEFIDDIIADFEQSFAKV 438

>Smik_13.55 Chr13 (99421..101520) [2100 bp, 699 aa] {ON} YJR130C
           (REAL)
          Length = 699

 Score = 62.8 bits (151), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 70/254 (27%), Positives = 107/254 (42%), Gaps = 24/254 (9%)

Query: 141 VHLETPVNPFGTSYDIEDFARKAHAKGALLVIDSTFAPPPLQDVWKFGADVVIHSCTKYF 200
           V +ETP NP     ++ +  R +   G  ++ID T       D   F AD+V  S TK F
Sbjct: 445 VFIETPSNPLLKMGNLLELKRLSELFGFFIIIDETVGGIVNIDGLPF-ADIVCGSLTKTF 503

Query: 201 GGHSDLLSGVVVVKSLEVAKKMKNDRIYLGTNIANL----ESYLLLRSLRTFEMR-VRKQ 255
            G S+++ G +V+       +     + L     +L    ++  L R+ R F  R +R  
Sbjct: 504 SGDSNVIGGSMVLNPQSRVYEFATRFMQLEDEYEDLLWCEDAIYLERNSRDFIARTIRIN 563

Query: 256 SENATALVKYLDDHKSEFNKVLDKIYHSSLQTE------DFVKKQLEGGYGPVFSIVLKS 309
                 L K L  H  E N +  KIY+ SL ++      D V+ + EGGYG +FS+    
Sbjct: 564 YSTEYLLDKILKAHVGE-NGLFKKIYYPSLTSKETLINYDMVRCKKEGGYGGLFSLTFHD 622

Query: 310 KVQCKKLPGKLELFQHATSLGGVESLVEWRALTDPY----------IEQTLIRVSVGCEG 359
           +         L+L     SLG   +L     L   Y          +E+ L+R+SVG E 
Sbjct: 623 EDHAAAFYNNLQL-NKGPSLGTNFTLAFPYTLMTYYHELTMAEKFGVERNLLRISVGLES 681

Query: 360 VEDLIKDLAGALKQ 373
              L K    A+ +
Sbjct: 682 QSTLGKIFQEAIDK 695

>YML082W Chr13 (101862..103811) [1950 bp, 649 aa] {ON} Putative
           protein predicted to have carbon-sulfur lyase activity;
           transcriptionally regulated by Upc2p via an upstream
           sterol response element; green fluorescent protein
           (GFP)-fusion protein localizes to the nucleus and the
           cytoplasm; YML082W is not an essential gene
          Length = 649

 Score = 62.4 bits (150), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 67/239 (28%), Positives = 104/239 (43%), Gaps = 24/239 (10%)

Query: 141 VHLETPVNPFGTSYDIEDFARKAHAKGALLVIDSTFAPPPLQDVWKFGADVVIHSCTKYF 200
           V +ETP NP     ++ +  R +   G  ++ID T       D   F AD+V  S TK F
Sbjct: 395 VFIETPSNPLLKMGNLLELKRLSELFGFFIIIDETVGGIVNIDGLPF-ADIVCSSLTKTF 453

Query: 201 GGHSDLLSGVVVVKSLEVAKKMKNDRIYLGTNIANL----ESYLLLRSLRTFEMR-VRKQ 255
            G S+++ G +V+       +  +  + L     +L    ++  L R+ R F  R +R  
Sbjct: 454 SGDSNVIGGSMVLNPQSRVYEFASRFMQLEDEYEDLLWCEDAIYLERNSRDFIARTIRIN 513

Query: 256 SENATALVKYLDDHKSEFNKVLDKIYHSSLQTE------DFVKKQLEGGYGPVFSIVLKS 309
                 L K L  H  E NK+  KIY+ +L ++      D V+ + EGGYG +FS+    
Sbjct: 514 YSTEYLLDKILKPHVGE-NKLFKKIYYPNLTSKETLTNYDMVRCKKEGGYGGLFSLTFHD 572

Query: 310 KVQCKKLPGKLELFQHATSLGGVESLVEWRALTDPY----------IEQTLIRVSVGCE 358
           +         L+L     SLG   +L     L   Y          +E+ L+R+SVG E
Sbjct: 573 EDHAAAFYDNLKL-NKGPSLGTNFTLAFPYTLMTYYHELDMAEKFGVERNLLRISVGLE 630

>Skud_12.10 Chr12 (10565..12280) [1716 bp, 571 aa] {ON} YLL058W
           (REAL)
          Length = 571

 Score = 62.4 bits (150), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 68/260 (26%), Positives = 116/260 (44%), Gaps = 45/260 (17%)

Query: 141 VHLETPVNPFGTSYDIEDFARKAHAKGALLVIDSTFAPPPLQDVWKFGADVVIHSCTKYF 200
           V +ETP NP     ++++  R A A G  +VID T     + D+  + AD+V  S TK F
Sbjct: 317 VFVETPSNPLLNMPNLKELRRLADAYGFFIVIDDTIGGLNV-DILPY-ADIVCTSLTKLF 374

Query: 201 GGHSDLLSGVVVV--------KSLEVAKKMKNDRIYLGTNIANLESYLLLRSLRTFEMRV 252
            G S+++ G VV+        ++ E  K  + + +  G +   LE     R+ R FE R 
Sbjct: 375 NGASNVMGGSVVLNPKSALYQRAREYFKSGEFEDLLWGEDAVVLE-----RNSRDFEDRT 429

Query: 253 RKQSENATALVKYLDDHKSEFNKVLDKIYHSSLQTEDFVK-----KQLEGGYGPVFSIVL 307
            + + N   L+K L     E  K   KIY+ ++ +++ +      +   GGYG +FS+  
Sbjct: 430 LRANTNTEKLLKEL--LLPEQGKTCKKIYYPTVNSKETINNYESVRNERGGYGCLFSVAF 487

Query: 308 KSKVQCKKLPGKLELFQHATSLGGVESLVEWRALTDPYI----------------EQTLI 351
            S+   +     L++F+  ++            L  PY+                + ++I
Sbjct: 488 HSEGDAEAFYDSLKVFKGPSNGTNF-------TLACPYVHLAHHSELEEVSKFGADSSII 540

Query: 352 RVSVGCEGVEDLIKDLAGAL 371
           RVSVG E  + L+   + AL
Sbjct: 541 RVSVGLEETQLLLDVFSSAL 560

>TDEL0D00610 Chr4 (109396..111354) [1959 bp, 652 aa] {ON} Anc_4.354
           YJR130C
          Length = 652

 Score = 62.4 bits (150), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 73/260 (28%), Positives = 116/260 (44%), Gaps = 38/260 (14%)

Query: 141 VHLETPVNPFGTSYDIEDFARKAHAKGALLVIDSTFAPPPLQDVWKFGADVVIHSCTKYF 200
           V +E P NP     D+ +  + A+  G  +V+D T       DV    ADVV  S TK F
Sbjct: 397 VFMEAPSNPLLKMGDLLELRQLANLYGFFIVVDETAGGFVNIDVLPH-ADVVCSSLTKIF 455

Query: 201 GGHSDLLSGVVVV----------KSLEVAKKMKNDRIYLGTNIANLESYLLLRSLRTFEM 250
            G S+L++G +V+          +   +A+K   D ++    +A      L R+ R F  
Sbjct: 456 SGDSNLIAGSLVLNPQGKLYDFAQQWLLAQKEYEDTLWCEDALA------LERNSRDFVQ 509

Query: 251 RVRKQSENATALV-KYLDDHKSEFNKVLDKIYHSSLQTE------DFVKKQLEGGYGPVF 303
           R  + + N   L+ K L   +    K+  KIY+ SL +       D VK  ++ GYG +F
Sbjct: 510 RTIQVNHNTEYLLNKVLIPLE---GKLFKKIYYPSLTSPETKRHYDAVKCSIDAGYGGLF 566

Query: 304 SIVLKSKVQCKKLPGKLELFQHATSLGGVESLVEWRALTDPY----------IEQTLIRV 353
           S+   +  Q +     L+L +   SLG   +L    A+   Y          +E++L+RV
Sbjct: 567 SLTFFNLAQARVFFDSLQLCK-GPSLGTNFTLACPYAILAHYQELDEVARYGVEKSLVRV 625

Query: 354 SVGCEGVEDLIKDLAGALKQ 373
           SVG E  E L +    A+ +
Sbjct: 626 SVGLENRESLCQVFQHAIAE 645

>CAGL0M00550g Chr13 (66078..67787) [1710 bp, 569 aa] {ON} similar to
           uniprot|P47164 Saccharomyces cerevisiae YJR130c STR2
          Length = 569

 Score = 62.4 bits (150), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 75/243 (30%), Positives = 110/243 (45%), Gaps = 25/243 (10%)

Query: 141 VHLETPVNPFGTSYDIEDFARKAHAKGALLVIDSTFAPPPLQDVWKFGADVVIHSCTKYF 200
           V LE P NP     D+    + +   G  +V+D T +     D+  +  D+V  S TK F
Sbjct: 318 VFLEAPSNPLLKMCDMSKLKQLSQQYGFFIVVDETVSGFVNIDILSY-CDIVCSSLTKIF 376

Query: 201 GGHSDLLSGVVVV----KSLEVAKKMKNDRIYLGTNIANLESYLLLRSLRTFEMRVRKQS 256
            G S++++G +VV    K  + A    ND       +   +S  L R+ R F  R +K +
Sbjct: 377 SGDSNVIAGSLVVNPASKLHDFAIDFLNDPKRNEDLLWCEDSVYLERNSRDFIDRAQKIN 436

Query: 257 ENATALVKYLDDHKSEFNKVLDKIYHSSLQTE------DFVKKQLEGGYGPVFSIVLKSK 310
           + A  LV  +     E  ++L+KIY+ SL +       D VK    GGYG + SIV K +
Sbjct: 437 KIAEDLVSTV--LLEEEGQLLEKIYYPSLTSPESKLNYDSVKCN-NGGYGGLISIVFKRE 493

Query: 311 VQCKKLPGKLELFQHATSLGGVESLVEWRALTDPYIE----------QTLIRVSVGCEGV 360
            Q K     L L     SLG   +LV   A+   Y E          + L+R+SVG E +
Sbjct: 494 DQAKVFYDNLSL-NKGPSLGTNFTLVCPYAILAHYAELDEVAKYGVVKNLVRISVGLESL 552

Query: 361 EDL 363
           E L
Sbjct: 553 ETL 555

>Kwal_26.7437 s26 complement(365889..367223) [1335 bp, 444 aa] {ON}
           YLR303W (MET17) - O-Acetylhomoserine-O-Acetylserine
           Sulfhydralase [contig 50] FULL
          Length = 444

 Score = 62.0 bits (149), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 69/290 (23%), Positives = 120/290 (41%), Gaps = 58/290 (20%)

Query: 141 VHLETPVNPFGTSYDIEDFARKAHAKGALLVIDSTF-APPPLQDVWKFGADVVIHSCTKY 199
           V+LE+  NP     D E     AH  G  +V+D+TF A       +KFGAD++ HS TK+
Sbjct: 151 VYLESIGNPKYNVPDFEKIVAVAHKHGIPVVVDNTFGAGGFFAQPFKFGADIITHSATKW 210

Query: 200 -----------------------------FGGHSDLLSGVVVVKSLEVAKKMKNDRIY-- 228
                                        F   S+   G++   +L     + + R+   
Sbjct: 211 IGGHGTTIGGVIVDSGKFPWKDYPEKFPQFSQPSEGYHGLIFNDALGPLAYIAHVRVELL 270

Query: 229 --LGTNIANLESYLLLRSLRTFEMRVRKQSENATALVKYLDDHKSEFNKVLDKIYHSSLQ 286
             LG  +    ++ LL+ + T  +R  + + NA  L +YL+   S +   +      S  
Sbjct: 271 RDLGPALNPFAAFQLLQGIETLSLRCERHASNALKLAQYLE--SSPYVSWVSYPGLPSHS 328

Query: 287 TEDFVKKQLEGGYGPVFSIVLKS-----------KVQCKKLPGKLELFQHATSLGGVESL 335
             +  KK L+ G+G V SI +K                 ++   L+L  +  ++G  ++L
Sbjct: 329 HHENAKKYLQNGFGGVLSIGVKDLPNASEETDPFAASGAQVVDSLKLASNLANVGDSKTL 388

Query: 336 V------EWRALTDPY-----IEQTLIRVSVGCEGVEDLIKDLAGALKQL 374
           V        + L+D       + + LIR+SVG E ++D+I D   A +++
Sbjct: 389 VIAPYFTTHQQLSDEEKLASGVTKDLIRISVGTEFIDDIIGDFEQAFEKV 438

>Skud_12.384 Chr12 (673748..675082) [1335 bp, 444 aa] {ON} YLR303W
           (REAL)
          Length = 444

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 104/434 (23%), Positives = 169/434 (38%), Gaps = 81/434 (18%)

Query: 6   TTLIHADDK---DNRVTDIVSPINVATTFRYDNNNLIAWNDRENYDFLETTPVYSRLAHP 62
           T  +HA  +   DN       PI   T++ ++N+     +  + +       VYSR  +P
Sbjct: 7   TVQLHAGQENAGDNAHRSRAVPIYATTSYVFENSK----HGSQLFGLEVPGYVYSRFQNP 62

Query: 63  NATRLES-IFSEILGGHAVIYSSGLAAY---FATLTHYNPKKLFIGQSYHGCHGIADIFT 118
            +  LE  I +   G  A+  SSG AA       L H     +     Y G +    I  
Sbjct: 63  TSNVLEERIAALEGGAAALAVSSGQAAQTLAIQGLAHTGDNIVSTSYLYGGTYNQFKISF 122

Query: 119 RNNGMKQY------PLDRIEELASEGDIVHLETPVNPFGTSYDIEDFARKAHAKGALLVI 172
           +  G++        P D  +        V+LET  NP     D E     AH  G  +V+
Sbjct: 123 KRFGIEARFVEGDNPEDFEKVFDERTKAVYLETIGNPKYNVPDFEKIVAIAHKHGIPVVV 182

Query: 173 DSTF-APPPLQDVWKFGADVVIHSCTKY-----------------------------FGG 202
           D+TF A        K+GAD+V HS TK+                             F  
Sbjct: 183 DNTFGAGGYFCQPIKYGADIVTHSATKWIGGHGTTIGGIIVDSGKFPWKDYPEKFPQFSQ 242

Query: 203 HSDLLSGVVVVKS-------LEVAKKMKNDRIYLGTNIANLESYLLLRSLRTFEMRVRKQ 255
            ++   G +  ++       + V  ++  D   LG  +    S+LLL+ + T  +R  + 
Sbjct: 243 PAEGYHGTIYNEAYGNLAYIVHVRTELLRD---LGPLMNPFASFLLLQGVETLSLRAERH 299

Query: 256 SENATALVKYLDDHKSEFNKVLDKIYHSSLQTEDFVKKQLEGGYGPVFSIVLKS------ 309
            ENA  L K+L++  S +   +     +S    +  KK L  G+G V S  +K       
Sbjct: 300 GENALKLAKWLEE--SPYVSWVSYPGLASHSHHENAKKYLSNGFGGVLSFGVKDLPNADK 357

Query: 310 -----KVQCKKLPGKLELFQHATSLGGVESLV------EWRALTDPY-----IEQTLIRV 353
                K+   ++   L+L  +  ++G  ++LV        + L D       + + LIRV
Sbjct: 358 ETDPFKLSGAQVVDNLKLASNLANVGDAKTLVIAPYFTTHKQLNDKEKLASGVTKDLIRV 417

Query: 354 SVGCEGVEDLIKDL 367
           SVG E ++D+I D 
Sbjct: 418 SVGIEFIDDIIADF 431

>YLR303W Chr12 (732542..733876) [1335 bp, 444 aa] {ON}
           MET17Methionine and cysteine synthase (O-acetyl
           homoserine-O-acetyl serine sulfhydrylase), required for
           sulfur amino acid synthesis
          Length = 444

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 106/434 (24%), Positives = 171/434 (39%), Gaps = 81/434 (18%)

Query: 6   TTLIHADDK---DNRVTDIVSPINVATTFRYDNNNLIAWNDRENYDFLETTPVYSRLAHP 62
           T  +HA  +   DN       PI   T++ ++N+     +  + +       VYSR  +P
Sbjct: 7   TVQLHAGQENPGDNAHRSRAVPIYATTSYVFENSK----HGSQLFGLEVPGYVYSRFQNP 62

Query: 63  NATRLES-IFSEILGGHAVIYSSGLAAY---FATLTHYNPKKLFIGQSYHGCHGIADIFT 118
            +  LE  I +   G  A+  SSG AA       L H     +     Y G +    I  
Sbjct: 63  TSNVLEERIAALEGGAAALAVSSGQAAQTLAIQGLAHTGDNIVSTSYLYGGTYNQFKISF 122

Query: 119 RNNGMKQYPL--DRIEELASEGD----IVHLETPVNPFGTSYDIEDFARKAHAKGALLVI 172
           +  G++   +  D  EE     D     V+LET  NP     D E     AH  G  +V+
Sbjct: 123 KRFGIEARFVEGDNPEEFEKVFDERTKAVYLETIGNPKYNVPDFEKIVAIAHKHGIPVVV 182

Query: 173 DSTF-APPPLQDVWKFGADVVIHSCTKY-----------------------------FGG 202
           D+TF A        K+GAD+V HS TK+                             F  
Sbjct: 183 DNTFGAGGYFCQPIKYGADIVTHSATKWIGGHGTTIGGIIVDSGKFPWKDYPEKFPQFSQ 242

Query: 203 HSDLLSGVVVVKS-------LEVAKKMKNDRIYLGTNIANLESYLLLRSLRTFEMRVRKQ 255
            ++   G +  ++       + V  ++  D   LG  +    S+LLL+ + T  +R  + 
Sbjct: 243 PAEGYHGTIYNEAYGNLAYIVHVRTELLRD---LGPLMNPFASFLLLQGVETLSLRAERH 299

Query: 256 SENATALVKYLDDHKSEFNKVLDKIYHSSLQTEDFVKKQLEGGYGPVFSIVLKS------ 309
            ENA  L K+L+  +S +   +     +S    +  KK L  G+G V S  +K       
Sbjct: 300 GENALKLAKWLE--QSPYVSWVSYPGLASHSHHENAKKYLSNGFGGVLSFGVKDLPNADK 357

Query: 310 -----KVQCKKLPGKLELFQHATSLGGVESLV------EWRALTDPY-----IEQTLIRV 353
                K+   ++   L+L  +  ++G  ++LV        + L D       + + LIRV
Sbjct: 358 ETDPFKLSGAQVVDNLKLASNLANVGDAKTLVIAPYFTTHKQLNDKEKLASGVTKDLIRV 417

Query: 354 SVGCEGVEDLIKDL 367
           SVG E ++D+I D 
Sbjct: 418 SVGIEFIDDIIADF 431

>Smik_12.383 Chr12 (670676..672010) [1335 bp, 444 aa] {ON} YLR303W
           (REAL)
          Length = 444

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 104/434 (23%), Positives = 169/434 (38%), Gaps = 81/434 (18%)

Query: 6   TTLIHADDK---DNRVTDIVSPINVATTFRYDNNNLIAWNDRENYDFLETTPVYSRLAHP 62
           T  +HA  +   DN       PI   T++ ++N+     +  + +       VYSR  +P
Sbjct: 7   TVQLHAGQENPGDNAHRSRAVPIYATTSYVFENSK----HGSQLFGLEVPGYVYSRFQNP 62

Query: 63  NATRLES-IFSEILGGHAVIYSSGLAAY---FATLTHYNPKKLFIGQSYHGCHGIADIFT 118
            +  LE  I +   G  A+  SSG AA       L H     +     Y G +    I  
Sbjct: 63  TSNVLEERIAALEGGAAALAVSSGQAAQTLAIQGLAHTGDNIVSTSYLYGGTYNQFKISF 122

Query: 119 RNNGMKQY------PLDRIEELASEGDIVHLETPVNPFGTSYDIEDFARKAHAKGALLVI 172
           +  G++        P D  +        V+LET  NP     D E     AH  G  +V+
Sbjct: 123 KRFGIEARFVEGDNPEDFEKVFDERTKAVYLETIGNPKYNVPDFEKIVAIAHKHGIPVVV 182

Query: 173 DSTF-APPPLQDVWKFGADVVIHSCTKY-----------------------------FGG 202
           D+TF A        K+GAD+V HS TK+                             F  
Sbjct: 183 DNTFGAGGYFCQPIKYGADIVTHSATKWIGGHGTTIGGIIVDSGKFPWKDYPEKFPQFSQ 242

Query: 203 HSDLLSGVVVVKS-------LEVAKKMKNDRIYLGTNIANLESYLLLRSLRTFEMRVRKQ 255
            ++   G +  ++       + V  ++  D   LG  +    S+LLL+ + T  +R  + 
Sbjct: 243 PAEGYHGTIYNEAYGNLAYIVHVRTELLRD---LGPLMNPFASFLLLQGVETLSLRAERH 299

Query: 256 SENATALVKYLDDHKSEFNKVLDKIYHSSLQTEDFVKKQLEGGYGPVFSIVLKS------ 309
            ENA  L K+L+  +S +   +     +S    +  KK L  G+G V S  +K       
Sbjct: 300 GENALKLAKWLE--QSPYVSWVSYPGLASHSHHENAKKYLSNGFGGVLSFGVKDLPNADK 357

Query: 310 -----KVQCKKLPGKLELFQHATSLGGVESLV------EWRALTDPY-----IEQTLIRV 353
                K+   ++   L+L  +  ++G  ++LV        + L D       + + LIRV
Sbjct: 358 ETDPFKLSGAQVVDNLKLASNLANVGDAKTLVIAPYFTTHKQLNDKEKLASGVTKDLIRV 417

Query: 354 SVGCEGVEDLIKDL 367
           SVG E ++D+I D 
Sbjct: 418 SVGIEFIDDIIADF 431

>Suva_10.397 Chr10 (693647..694981) [1335 bp, 444 aa] {ON} YLR303W
           (REAL)
          Length = 444

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 104/434 (23%), Positives = 169/434 (38%), Gaps = 81/434 (18%)

Query: 6   TTLIHA---DDKDNRVTDIVSPINVATTFRYDNNNLIAWNDRENYDFLETTPVYSRLAHP 62
           T  +HA   +  DN       PI   T++ ++N+     +  + +       VYSR  +P
Sbjct: 7   TVQLHAGQENPSDNAHRTRAVPIYATTSYCFENSK----HGSQLFGLEVPGYVYSRFQNP 62

Query: 63  NATRLES-IFSEILGGHAVIYSSGLAAY---FATLTHYNPKKLFIGQSYHGCHGIADIFT 118
            +  LE  I +   G  A+  SSG AA       L H     +     Y G +    I  
Sbjct: 63  TSNVLEERIAALEGGAAALAVSSGQAAQTLAIQGLAHTGDNIVSTSYLYGGTYNQFKISF 122

Query: 119 RNNGMKQY------PLDRIEELASEGDIVHLETPVNPFGTSYDIEDFARKAHAKGALLVI 172
           +  G++        P D  +        V+LET  NP     D E     AH  G  +V+
Sbjct: 123 KRFGIEARFVEGDNPEDFEKVFDERTKAVYLETIGNPKYNVPDFEKIVAIAHKHGIPVVV 182

Query: 173 DSTF-APPPLQDVWKFGADVVIHSCTKY-----------------------------FGG 202
           D+TF A        K+GAD+V HS TK+                             F  
Sbjct: 183 DNTFGAGGYFCQPIKYGADIVTHSATKWIGGHGTTIGGIIVDSGKFPWKDYPEKFPQFSQ 242

Query: 203 HSDLLSGVVVVKS-------LEVAKKMKNDRIYLGTNIANLESYLLLRSLRTFEMRVRKQ 255
            ++   G +  ++       + V  ++  D   LG  +    S+LLL+ + T  +R  + 
Sbjct: 243 PAEGYHGTIYNEAYGNLAYIVHVRTELLRD---LGPLMNPFASFLLLQGVETLSLRAERH 299

Query: 256 SENATALVKYLDDHKSEFNKVLDKIYHSSLQTEDFVKKQLEGGYGPVFSIVLKS------ 309
            ENA  L K+L+  +S +   +     +S    +  KK L  G+G V S  +K       
Sbjct: 300 GENALKLAKWLE--QSPYVSWVSYPGLASHSHHENAKKYLSNGFGGVLSFGVKDLPNADK 357

Query: 310 -----KVQCKKLPGKLELFQHATSLGGVESLV------EWRALTDPY-----IEQTLIRV 353
                K+   ++   L+L  +  ++G  ++LV        + L D       + + LIRV
Sbjct: 358 ETDPFKLSGAQVVDSLKLASNLANVGDAKTLVIAPYFTTHKQLNDTEKLASGVTKDLIRV 417

Query: 354 SVGCEGVEDLIKDL 367
           SVG E ++D+I D 
Sbjct: 418 SVGIEFIDDIIADF 431

>Kwal_14.791 s14 complement(49074..50789) [1716 bp, 571 aa] {ON}
           YLL058W - Hypothetical ORF [contig 245] FULL
          Length = 571

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 68/253 (26%), Positives = 115/253 (45%), Gaps = 29/253 (11%)

Query: 141 VHLETPVNPFGTSYDIEDFARKAHAKGALLVIDSTFAPPPLQDVWKFGADVVIHSCTKYF 200
           V +ETP NP     D++   + A   G  +VID T     + D+  + AD+V  S TK F
Sbjct: 317 VFVETPSNPLLNVPDLDKLRKLADEYGFFIVIDDTIGGLNV-DILPY-ADIVCTSLTKLF 374

Query: 201 GGHSDLLSGVVVVK---SLEVAKKMKNDRIYLGTNIANLESYLLLRSLRTFEMRVRKQSE 257
            G S+++ G V++    SL    +           + + ++ +L  + R FE R  + +E
Sbjct: 375 SGTSNVMGGSVLLNPDSSLYPYAQEYFQSCEFEDLLWSEDAVVLEANSRDFEARTLRTNE 434

Query: 258 NATALVKYLDDHKSEFNKVLDKIYHSSLQTEDFVK-----KQLEGGYGPVFSIVLKSKVQ 312
           N   L+  +     E  K++ K+Y+ ++ +E+  K     +  +GGYG +FSI   ++  
Sbjct: 435 NTVNLLTKV--LLPEEGKLIKKVYYPTVSSEETFKNYERVRNRQGGYGCLFSIAFHNEED 492

Query: 313 CKKLPGKLELFQHATS------------LGGVESLVEWRAL-TDPYIEQTLIRVSVGCEG 359
            K     L++F+  ++            L     LVE   L  DP     L+RVSVG E 
Sbjct: 493 AKCFYDSLKVFKGPSNGTNFTLACPYVHLAHHFELVEVAELGADP----NLVRVSVGLEE 548

Query: 360 VEDLIKDLAGALK 372
            + L +    AL+
Sbjct: 549 FQGLREVFLNALE 561

>YLL058W Chr12 (23569..25296) [1728 bp, 575 aa] {ON} Putative
           protein of unknown function with similarity to Str2p,
           which is a cystathionine gamma-synthase important in
           sulfur metabolism; YLL058W is not an essential gene
          Length = 575

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 65/256 (25%), Positives = 112/256 (43%), Gaps = 37/256 (14%)

Query: 141 VHLETPVNPFGTSYDIEDFARKAHAKGALLVIDSTFAPPPLQDVWKFGADVVIHSCTKYF 200
           V +ETP NP     D++     A   G  +VID T     + D+  + AD+V  S TK F
Sbjct: 321 VFVETPSNPLLNMPDLKKLRSLADQYGFFIVIDDTIGGLNV-DILPY-ADIVSTSLTKLF 378

Query: 201 GGHSDLLSGVVVVKSLEVAKKMKNDRIYLGTNIANL----ESYLLLRSLRTFEMRVRKQS 256
            G S+++ G VV+           +  +   N  +L    ++ +L R+ R FE R  + +
Sbjct: 379 NGASNVMGGSVVLNPKSSLYPYARE-YFRSANFEDLLWCEDAIVLERNSRDFEDRTLRAN 437

Query: 257 ENATALVKYLDDHKSEFNKVLDKIYHSSLQTEDFVK-----KQLEGGYGPVFSIVLKSKV 311
            N   L+   D    E  K+  KIY+ ++ +++  +     +   GGYG +FS+   ++ 
Sbjct: 438 ANTGILLN--DLLLPEEGKICKKIYYPTVTSKETFENYESVRNERGGYGCLFSVAFFNEG 495

Query: 312 QCKKLPGKLELFQHATSLGGVESLVEWRALTDPYI----------------EQTLIRVSV 355
             K     L++F+  ++            L  PY+                +  +IRVSV
Sbjct: 496 DAKAFYDSLKVFKGPSNGTNF-------TLACPYVHLAHHSELEEVSKFGADPNIIRVSV 548

Query: 356 GCEGVEDLIKDLAGAL 371
           G E ++ L+K  + AL
Sbjct: 549 GLEDIQWLLKVFSSAL 564

>Skud_13.59 Chr13 (101194..103143) [1950 bp, 649 aa] {ON} YML082W
           (REAL)
          Length = 649

 Score = 59.7 bits (143), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 69/254 (27%), Positives = 107/254 (42%), Gaps = 24/254 (9%)

Query: 141 VHLETPVNPFGTSYDIEDFARKAHAKGALLVIDSTFAPPPLQDVWKFGADVVIHSCTKYF 200
           V +ETP NP     ++ +  R +   G  ++ID T       D   F AD+V  S TK F
Sbjct: 395 VFIETPSNPLLKMGNLLELKRLSELFGFFIIIDETVGGIVNIDGLPF-ADIVCSSLTKTF 453

Query: 201 GGHSDLLSGVVVVKSLEVAKKMKNDRIYLGTNIANL----ESYLLLRSLRTFEMR-VRKQ 255
            G S+++ G +V+       +     + L     +L    ++  L R+ R F  R VR  
Sbjct: 454 SGDSNVIGGSMVLNPQSRVYEFATRFMRLEDEYEDLLWCEDAIYLERNSRDFIARTVRIN 513

Query: 256 SENATALVKYLDDHKSEFNKVLDKIYHSSLQTE------DFVKKQLEGGYGPVFSIVLKS 309
                 L K L  H    N++  KIY+ +L ++      D V+ + EGGYG +FS+    
Sbjct: 514 YSTEYLLDKILKPHVGG-NELFKKIYYPNLTSKETLTNYDMVRCKKEGGYGGLFSLTFHD 572

Query: 310 KVQCKKLPGKLELFQHATSLGGVESLVEWRALTDPY----------IEQTLIRVSVGCEG 359
           +         L+L     SLG   +L     L   Y          +E+ L+R+SVG E 
Sbjct: 573 EHHAAAFYDNLQL-NKGPSLGTNFTLAFPYTLMTYYQELAMAEKFGVERNLLRISVGLES 631

Query: 360 VEDLIKDLAGALKQ 373
              L K    A+ +
Sbjct: 632 QSTLGKIFQEAIDK 645

>NCAS0A06270 Chr1 complement(1239445..1241424) [1980 bp, 659 aa]
           {ON} Anc_4.354
          Length = 659

 Score = 58.9 bits (141), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 67/244 (27%), Positives = 107/244 (43%), Gaps = 34/244 (13%)

Query: 141 VHLETPVNPFGTSYDIEDFARKAHAKGALLVIDSTFAPPPLQDVWKFGADVVIHSCTKYF 200
           V +E P NP     D+ +  + +   G  +V+D T       D   F AD+V  S TK F
Sbjct: 407 VFIEAPSNPLLQMCDLIELQKLSEIYGFFIVVDETIGGFVNLDGL-FHADIVCSSLTKVF 465

Query: 201 GGHSDLLSGVVVV----KSLEVAKKMKNDRIYLGTNIANLESYLLLRSLRTF---EMRVR 253
            G S++++G +V+    K  E A++  N    +  +I   +   L ++ R F    +R+ 
Sbjct: 466 NGDSNVIAGSMVLNPKSKIYEFAQQFLNGPDGVTDSIWCEDLIYLEKNSRDFVAKTLRIN 525

Query: 254 KQSENATALVKYLDDH--KSEFNKVLDKIYHSSLQTEDF------VKKQLEGGYGPVFSI 305
             +E       YL D+  K    K+  +IY+ S  +E+       +K + +GGYG VFS+
Sbjct: 526 YTTE-------YLLDNVFKPHVGKLFKRIYYPSQNSEEIKQNYEAIKCKKDGGYGGVFSV 578

Query: 306 VLKSKVQCKKLPGKLELFQHATSLGGVESLV----------EWRALTDPYIEQTLIRVSV 355
                 Q K     L+L +  T LG   + V          E   + +  +E  LIRV V
Sbjct: 579 TFFQLDQAKVFFNNLKLTKQIT-LGNNSTTVCPYTMLKHKDELERVKEYGLEDNLIRVCV 637

Query: 356 GCEG 359
           G E 
Sbjct: 638 GLEN 641

>ZYRO0B08338g Chr2 complement(649933..651855) [1923 bp, 640 aa] {ON}
           similar to uniprot|P47164 Saccharomyces cerevisiae
           YJR130C STR2 Cystathionine gamma-synthase converts
           cysteine into cystathionine
          Length = 640

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 68/251 (27%), Positives = 113/251 (45%), Gaps = 27/251 (10%)

Query: 143 LETPVNPFGTSYDIEDFARKAHAKGALLVIDSTFAPPPLQDVWKFGADVVIHSCTKYFGG 202
           +E P NP     D+ +    A++ G  +V+D T       DV  F AD+V  S TK F G
Sbjct: 392 MEAPSNPLLKMGDLIELRELANSFGFYIVVDDTAGGFVNIDVLPF-ADIVCSSLTKIFSG 450

Query: 203 HSDLLSGVVVVKSLEVAKKMKNDRIYLGTNIANL----ESYLLLRSLRTFEMRVRKQSEN 258
            S++++G +V+     +K       ++     +     ++  L R+ R F  R  K ++N
Sbjct: 451 DSNVIAGSIVLNPQ--SKLYSFAETFMEQQYEDCLWCEDALYLERNSRDFVARTLKVNQN 508

Query: 259 ATALV-KYLDDHKSEFNKVLDKIYHSSLQTEDFVK-----KQLEGGYGPVFSIVLKSKVQ 312
              L+ K L   +    K+  KIY+ SL +++  K     +  +GGYG +FS+   +   
Sbjct: 509 TERLLNKVLLPQE---GKLFKKIYYPSLTSKETKKNYDAVRGHQGGYGGLFSLTFYNLDS 565

Query: 313 CKKLPGKLELFQHATSLGGVESLVEWRALTDPY----------IEQTLIRVSVGCEGVED 362
            K     L+L +   SLG   +L    A+   Y          +E  L+RVSVG E  ++
Sbjct: 566 AKTFFNTLQLCK-GPSLGTNFTLACPYAIIAHYQELDRVAKYGVESNLVRVSVGLEREDE 624

Query: 363 LIKDLAGALKQ 373
           L K    A+ +
Sbjct: 625 LCKVFQTAIDE 635

>TDEL0E05620 Chr5 complement(1043585..1044925) [1341 bp, 446 aa]
           {ON} Anc_4.53 YLR303W
          Length = 446

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 73/297 (24%), Positives = 122/297 (41%), Gaps = 70/297 (23%)

Query: 141 VHLETPVNPFGTSYDIEDFAR---KAHAKGALLVIDSTF-APPPLQDVWKFGADVVIHSC 196
           V+LET  NP    Y++ DF R    AH  G  +V+D+TF A        K+GAD+V HS 
Sbjct: 151 VYLETIGNP---KYNVPDFDRIVEVAHKHGIPVVVDNTFGAGGFFAQPIKYGADIVTHSA 207

Query: 197 TKY-----------------------------FGGHSDLLSGVVVVKSLEVAKKMKNDRI 227
           TK+                             F   S+   G++   +      + + R 
Sbjct: 208 TKWIGGHGTTIGGIIVDSGKFPWKDYPEKFPQFSIPSEGYHGMIFNDAFGPLAFIGHVRT 267

Query: 228 Y----LGTNIANLESYLLLRSLRTFEMRVRKQSENATALVKYLDDHKSEFNKVLDKIYHS 283
                LG  +    ++ LL+ + T  +R  +  ENA  L  +L+  +S +   +      
Sbjct: 268 ELLRDLGPALNPFAAFQLLQGVETLSLRAERHGENALKLAAWLE--QSPYVSWVSYPGLP 325

Query: 284 SLQTEDFVKKQLEGGYGPVFSIVLK-----SKVQCK--------KLPGKLELFQHATSLG 330
           S    +  KK L  G+G V S   K     ++ + K        K+   L+L  +  ++G
Sbjct: 326 SHSHHENAKKYLTNGFGGVLSFGAKDLPNNAEAEAKNPFAAAGAKVVDNLKLASNLANVG 385

Query: 331 GVESLV-------------EWRALTDPYIEQTLIRVSVGCEGVEDLIKDLAGALKQL 374
             ++LV             E +A +   + + LIRVSVG E ++D+I D   + +Q+
Sbjct: 386 DCKTLVIAPYFTTHLQLTHEEKASSG--VTKDLIRVSVGTEFIDDIINDFQQSFEQV 440

>Suva_10.8 Chr10 (9213..10931) [1719 bp, 572 aa] {ON} YLL058W (REAL)
          Length = 572

 Score = 56.6 bits (135), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 64/259 (24%), Positives = 113/259 (43%), Gaps = 43/259 (16%)

Query: 141 VHLETPVNPFGTSYDIEDFARKAHAKGALLVIDSTFAPPPLQDVWKFGADVVIHSCTKYF 200
           V +ETP NP     D+++  R A A G  +V+D T     + DV  + AD+V  S TK F
Sbjct: 318 VFVETPSNPLLNMPDLKELRRLADAYGFFIVVDDTIGGLNV-DVLPY-ADIVCTSLTKLF 375

Query: 201 GGHSDLLSGVVVVK--------SLEVAKKMKNDRIYLGTNIANLESYLLLRSLRTFEMRV 252
            G S+ + G +++         + E  K  + + +    +   LE+     + R F+ R 
Sbjct: 376 NGSSNAMGGSIILNPKSSLYSSACEYFKSAEFEDLLWCEDAVVLEA-----NSRDFQDRT 430

Query: 253 RKQSENATALVKYLDDHKSEFNKVLDKIYHSSLQTEDFVK-----KQLEGGYGPVFSIVL 307
            + + N   L+  +     E  K+  KIY+ ++ +++        +   GGYG +FS+  
Sbjct: 431 LRANINTEKLLNEV--LLPEEGKICKKIYYPTVSSKETFNNYESVRNKHGGYGCLFSMAF 488

Query: 308 KSKVQCKKLPGKLELFQ---------------HATSLGGVESLVEWRALTDPYIEQTLIR 352
            ++   K     L++F+               H      +E + ++ A  DP     LIR
Sbjct: 489 YNEGDAKTFYDTLKVFKGPSNGTNFTLACPYVHLAHHSELEEVSKFGA--DP----NLIR 542

Query: 353 VSVGCEGVEDLIKDLAGAL 371
           VSVG E  + L+   + A+
Sbjct: 543 VSVGLEDTQTLLDVFSSAI 561

>TDEL0E05710 Chr5 complement(1062353..1064023) [1671 bp, 556 aa]
           {ON} 
          Length = 556

 Score = 56.2 bits (134), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 60/252 (23%), Positives = 107/252 (42%), Gaps = 25/252 (9%)

Query: 143 LETPVNPFGTSYDIEDFARKAHAKGALLVIDSTFAPPPLQDVWKFGADVVIHSCTKYFGG 202
           +ETP NP     D+    + A+  G  +VID T     + D+  + AD+V  S TK F G
Sbjct: 304 VETPSNPLLNMPDLTGLRKLANEYGFFIVIDDTIGGLNV-DILPY-ADIVCTSLTKLFNG 361

Query: 203 HSDLLSGVVVVKSLEVAKKMKNDRIYLGTNIANLESYLLLRSLRTFEMRVRKQSENATAL 262
            S+++ G +++     +    + R ++ ++    E  L     +  E+  R   +     
Sbjct: 362 SSNVMGGSLILNP--KSSLYSSARAFVESD--GFEDLLWCEDAKVLEINSRDFEDRTVRA 417

Query: 263 VKYLDDHKSEF-----NKVLDKIYHSSLQTEDFVK-----KQLEGGYGPVFSIVLKSKVQ 312
            K  +   SE       KV  KIY+ ++ +E+  K     +   GGYG +FS+   S+  
Sbjct: 418 NKNTERLLSELILVNEGKVFKKIYYPTVSSEETFKNYEAVRNKLGGYGCMFSMAFYSEED 477

Query: 313 CKKLPGKLELFQHATSLGGVESLVEWRALTDPY---------IEQTLIRVSVGCEGVEDL 363
            K     L++F+  ++         +  L   +          +  LIRVSVG E  + L
Sbjct: 478 SKAFYDSLKVFKGPSNGTNFTLACPYVQLAHRFELEEVSKFGADPNLIRVSVGLEDSQWL 537

Query: 364 IKDLAGALKQLQ 375
           +   + A+  L+
Sbjct: 538 LDVFSDAINMLE 549

>KLLA0B04378g Chr2 (390701..392767) [2067 bp, 688 aa] {ON} similar
           to uniprot|P47164 Saccharomyces cerevisiae YJR130C STR2
           Cystathionine gamma-synthase converts cysteine into
           cystathionine
          Length = 688

 Score = 55.8 bits (133), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 69/259 (26%), Positives = 110/259 (42%), Gaps = 36/259 (13%)

Query: 141 VHLETPVNPFGTSYDIEDFARKAHAKGALLVIDSTFAPPPLQDVWKFGADVVIHSCTKYF 200
           V +E+P NP     D+ +  R +   G  +VID T       DV  + ADVV  S TK F
Sbjct: 431 VFIESPSNPLLKMGDLVELKRLSDLYGFYIVIDETVGGFLNIDVLPY-ADVVCSSLTKIF 489

Query: 201 GGHSDLLSGVVVVKS-----------LEVAKKMKNDRIYLGTNIANLESYLLLRSLRTFE 249
            G S++++G +V+             L + +K   D ++    I       L R+ R F 
Sbjct: 490 SGDSNVMAGSIVLNPRSRLYEFATTMLHLTEKWYEDLLWCEDAIC------LERNSRDFI 543

Query: 250 MRVRKQSENATALVKYLDDHKSEFNKVLDKIYH------SSLQTEDFVKKQLEG-GYGPV 302
            R    +EN  +L++ +   +    K+  K+++       + +  D VK +  G GYG +
Sbjct: 544 SRSILVNENTESLLEKVILPQQGEGKLFKKVFYPKYTNAETKKNYDQVKAKTAGSGYGGL 603

Query: 303 FSIVLKSKVQCKKLPGKLELFQHATSLGGVESLV----------EWRALTDPYIEQTLIR 352
           FS+   +  Q K     L L +   SLG   +L           E   +    +E  L+R
Sbjct: 604 FSVTFYNIEQAKMFFNSLNLCK-GPSLGTNFTLACPYTVLAHYQEMEEVAKFGLEDNLVR 662

Query: 353 VSVGCEGVEDLIKDLAGAL 371
           VSVG E  + L K    A+
Sbjct: 663 VSVGLESKQHLEKVFQTAI 681

>NDAI0D03260 Chr4 complement(774579..776669) [2091 bp, 696 aa] {ON}
           Anc_4.354
          Length = 696

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 84/360 (23%), Positives = 146/360 (40%), Gaps = 80/360 (22%)

Query: 62  PNATRLESIFSEILGGHAVIYSSGLAAYFATLTHYNPKKLFIGQSYHGCHGIADIFTRNN 121
           PN T     F+  L G+   Y   +   F ++       L + Q ++  H ++D    N+
Sbjct: 371 PNGT-----FNNRLIGYGSPYKETVMFGFPSV-----DTLEVLQKFNHTHFLSDNDEENS 420

Query: 122 GMKQYPLDRIEELASEGD---IVHLETPVNPFGTSYDIEDFARKAHAKGALLVIDSTFAP 178
            M      +++E+   G+    V +E P NP     D+ +  R +   G  +++D T A 
Sbjct: 421 AMS-----KLKEILHSGEQILAVFIEAPSNPLLKMGDLIELKRLSDMYGFFIIVDETIA- 474

Query: 179 PPLQDVWKFGADVVIHSCTKYFGGHSDLLSGVVVVKSL----EVAKKM------------ 222
             +       AD++  S TK F G S++++G +V+  +    + AK+             
Sbjct: 475 GFVNIDAIIHADIICSSLTKVFTGDSNVIAGSMVLNPMSKIYDFAKRFLSFPDGFEDCLW 534

Query: 223 --------KNDRIYLG--TNIANLESYLLLRSLRTFEMRVRKQSENATALVKYLDDHKSE 272
                   KN R +L   T I N   YL+   L  +   V K+  N              
Sbjct: 535 CEDILYLEKNSRDFLSKTTRINNTTEYLVNTVLSPY---VGKKEANG------------- 578

Query: 273 FNKVLDKIYHSSLQTE------DFVKKQLEGGYGPVFSIVLKSKVQCKKLPGKLELFQHA 326
             K+  KIY+ +  ++      D +K +  GGYG VFSI      + K     L+L    
Sbjct: 579 --KLFKKIYYPTTTSKETKMCYDAIKCKTYGGYGGVFSITFHDIEKAKLFFNNLKL-SKT 635

Query: 327 TSLGGVESLV----------EWRALTDPYIEQTLIRVSVGCEGVEDLIKDLAGALKQLQD 376
            SLG   + V          E   +++  +++TLIRV VG E    L ++ + A+++  +
Sbjct: 636 ISLGSNYTTVCPYTVLKHGDELEKVSEYGLDETLIRVCVGLENKTSLKENFSRAIEKTMN 695

>KAFR0B06830 Chr2 complement(1421910..1423913) [2004 bp, 667 aa]
           {ON} Anc_4.354 YJR130C
          Length = 667

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 67/261 (25%), Positives = 109/261 (41%), Gaps = 37/261 (14%)

Query: 141 VHLETPVNPFGTSYDIEDFARKAHAKGALLVIDSTFAPPPLQDVWKFGADVVIHSCTKYF 200
           V +E P  P     ++ +    ++  G ++++D T       D     ADVV  S TK F
Sbjct: 410 VLIEAPSTPLLKMGNLLELKELSNLFGFIIIVDETVGGFFNVDAL-VHADVVCTSLTKIF 468

Query: 201 GGH-SDLLSGVVVVKS----LEVAKKMKNDRIYLGTNIANLESYLLLRSLRTFEMRVRKQ 255
            G   ++++G + + S       AK    D      N+   ++ ++ R+ R F  ++ K 
Sbjct: 469 SGDVGNVMAGAMALNSNSTIYNFAKDFLIDNNEFEDNLWCEDAIIMERNSRDFIAKMLKI 528

Query: 256 SENATALV-KYLDDHKSEFNKVLDKIYHSSL------QTEDFVKKQLEGGYGPVFSIVLK 308
           +     L+ K L  H  E N +  KIYH  L      Q  + +K + +GGYG VFSI   
Sbjct: 529 NYTTDYLLDKVLIPHIGEHN-LFKKIYHPRLTSNETKQNYEKIKCKSDGGYGGVFSIDFN 587

Query: 309 SKVQCKKLPGKLELFQHATSLGGVESLVEWRALTDPY----------------IEQTLIR 352
           +  Q K       LF +  ++    SL     L  PY                + ++LIR
Sbjct: 588 NLEQAK-------LFYNCLNVAKGPSLGTTMTLACPYTILYHYADIEKVSKYGLSESLIR 640

Query: 353 VSVGCEGVEDLIKDLAGALKQ 373
           VSVG E  + L +    A+ +
Sbjct: 641 VSVGLENRKQLCQLFQAAIDE 661

>Kwal_47.16644 s47 complement(41349..43307) [1959 bp, 652 aa] {ON}
           YJR130C (STR2) - Cystathionine gamma-synthase [contig
           376] FULL
          Length = 652

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 71/271 (26%), Positives = 124/271 (45%), Gaps = 31/271 (11%)

Query: 128 LDRIEELASEGD---IVHLETPVNPFGTSYDIEDFARKAHAKGALLVIDSTFAPPPLQDV 184
           +++++E+   G+    V +E P NP     ++ +    A A G  +VID T       DV
Sbjct: 385 MEQLKEILHSGEQILAVFMEAPSNPLLKMGNLIELRELADAYGFYVVIDETAGGFVNIDV 444

Query: 185 WKFGADVVIHSCTKYFGGHSDLLSGVVVVKSLEVAKKMKNDRIYLG--TNIANLESYLLL 242
               AD+V  S TK F G S++++G +V+              + G   ++   E  + L
Sbjct: 445 LPH-ADMVCSSLTKIFSGDSNVMAGSLVLNRKSPLYSFAQQFFHDGEFEDLLWCEDVIYL 503

Query: 243 -RSLRTFEMRVRKQSENATALVKYLDDHKSEFNKVLDKIYHSSLQTEDFVKKQLE----- 296
            R+ R F  R    ++N   L++ +   + +  K+  KI++ SL + +  K+  +     
Sbjct: 504 ERNSRDFVTRTLTVNKNTAQLLEEVLIPQEK--KLFKKIFYPSLTSPE-TKRNYDAILCP 560

Query: 297 -GGYGPVFSIVLKSKVQCKKLPGKLELFQHATSLGGVESLVEWRALTDPY---------- 345
            GGYG +FS+   ++ Q +     LEL +   SLG   +L    A+   Y          
Sbjct: 561 KGGYGGLFSLTFYNEKQARVFFDTLELCK-GPSLGTNFTLACPYAILAHYTELEEVAKFG 619

Query: 346 IEQTLIRVSVGCEGVEDL----IKDLAGALK 372
           +E++L+RVSVG E  + L     + +A ALK
Sbjct: 620 VERSLVRVSVGLESPQVLNAVFSRAIAEALK 650

>Smik_12.3 Chr12 (6081..7781) [1701 bp, 566 aa] {ON} YLL058W (REAL)
          Length = 566

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 63/250 (25%), Positives = 114/250 (45%), Gaps = 25/250 (10%)

Query: 141 VHLETPVNPFGTSYDIEDFARKAHAKGALLVIDSTFAPPPLQDVWKFGADVVIHSCTKYF 200
           V +ETP NP     +++D  R A   G  ++ID T     + D+  + AD+V  S TK F
Sbjct: 312 VFVETPSNPLLNMPNLKDLRRLADQYGFFIIIDDTIGGINV-DILPY-ADIVCTSLTKLF 369

Query: 201 GGHSDLLSGVVVVKSLEVAKKMKNDRIYLGTNIANL----ESYLLLRSLRTFEMRVRKQS 256
            G S+++ G +V+           +  +   +  +L    ++ +L R+ R FE R    +
Sbjct: 370 NGASNVMGGSIVLNPKSSIYPYARE-YFKSADFEDLLWCEDAVVLERNSRDFENRTLHAN 428

Query: 257 ENATALVKYLDDHKSEFNKVLDKIYHSSLQTEDFVK-----KQLEGGYGPVFSIVLKSKV 311
            N   L+  +     E  K+  K+Y+ ++ +E+  +     +   GGYG +FS+   ++ 
Sbjct: 429 ANTEKLLNEV--LIPEQGKLCKKVYYPTVTSEETFRNYESVRNERGGYGCLFSVAFYNEG 486

Query: 312 QCKKLPGKLELFQHATSLGGVESLV----------EWRALTDPYIEQTLIRVSVGCEGVE 361
             K     L++F+   S G   +L           E  A++    +  +IRVSVG E  +
Sbjct: 487 DAKAFYDSLKVFK-GPSNGTNFTLACPYVHLAHHSELEAVSKFGADPNIIRVSVGLEDTQ 545

Query: 362 DLIKDLAGAL 371
            L++  + AL
Sbjct: 546 WLLEVFSNAL 555

>KNAG0M00330 Chr13 (48427..50322) [1896 bp, 631 aa] {ON} Anc_4.354
           YJR130C
          Length = 631

 Score = 46.2 bits (108), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 59/249 (23%), Positives = 109/249 (43%), Gaps = 28/249 (11%)

Query: 128 LDRIEELASEGD---IVHLETPVNPFGTSYDIEDFARKAHAKGALLVIDSTFAPPPLQDV 184
           L +++E+   G+    V  ETP N      ++ +  + +   G  +V+D +       D 
Sbjct: 378 LSKLKEILHSGEQILAVITETPTNGLLDVTNLVELKQLSELFGFYIVVDESVGGFVNVDA 437

Query: 185 WKFGADVVIHSCTKYFGGHSDLLSGVVVVKSLE---------VAKKMKNDRIYLGTNIAN 235
             +  D+V  S  K F G  D++SG +VV             +A + +   +    +I  
Sbjct: 438 LVY-CDIVCSSLVKMFSGTEDVVSGSMVVNPQSKLYDFAQTFMASEHEPSSVLWCEDIIQ 496

Query: 236 LESYLLLRSLRTFEMRVRKQSENATALVKYLDDH-KSEFNKVLDKIYHSSLQTE---DFV 291
           LE     ++ R F   V K     TA  + L D    +   +  +++H S+      + +
Sbjct: 497 LE-----QNSRDF---VSKSKRINTATKRLLRDVILPQRGTIFTEVHHPSITDRAQYNLI 548

Query: 292 KKQLEGGYGPVFSIVLKSKVQCKKLPGKLELFQHATSLGGVESLVEWRALTDPY--IEQT 349
           K + +GGYG VF++   +  + +    +L + +    LGG  ++     L + Y  +++T
Sbjct: 549 KGKQDGGYGGVFAVQFSTLERARSFYDRLNVCK-GPGLGGDYTVACPWQLLNQYDEVDKT 607

Query: 350 LIRVSVGCE 358
           LIRVSVG E
Sbjct: 608 LIRVSVGLE 616

>Kwal_26.7197 s26 (258929..259192) [264 bp, 87 aa] {OFF} YAL012W
           (CYS3) - cystathionine gamma-lyase [contig 47] FULL
          Length = 87

 Score = 36.6 bits (83), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 32/61 (52%), Gaps = 11/61 (18%)

Query: 322 LFQHATSLGGVESLVEWRALTD-----------PYIEQTLIRVSVGCEGVEDLIKDLAGA 370
           LF  A SLGG+ESL+E  A+               +   LIR+SVG E  +DL+ D+  A
Sbjct: 22  LFTLAESLGGIESLLEVPAVMTHGGIPKDQREASGVYDDLIRLSVGIEDTDDLLDDIKNA 81

Query: 371 L 371
           L
Sbjct: 82  L 82

>Kwal_33.14365 s33 (640933..642246) [1314 bp, 437 aa] {ON} YDR306C -
           Hypothetical ORF [contig 104] FULL
          Length = 437

 Score = 33.9 bits (76), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 36/114 (31%), Positives = 48/114 (42%), Gaps = 9/114 (7%)

Query: 251 RVRKQSENATALVKYLDDHKSEFNKVLDKIYHSSLQTEDFVKKQLEGGYGPVFSIVLKSK 310
           R ++  EN   L   L     + + V   +   S + E FV  Q   GY P+ S  LKS 
Sbjct: 149 RKKRMGENVVELDLSLIIQSGKNSYVSKLLRRCSPKLESFVAPQTSFGYAPLIS--LKSC 206

Query: 311 VQCKKLPGKLELFQHATSLGGVESLV-EWRALTDPYIEQTLIRVSVGCEGVEDL 363
            Q K L   L L      LG + S + E+ ALT      +  R SV C+G  D 
Sbjct: 207 RQLKYL--DLGLVSETVQLGELLSAINEFPALT----HLSFPRSSVDCKGFRDF 254

>TPHA0P01040 Chr16 (208875..211991) [3117 bp, 1038 aa] {ON} Anc_3.93
           YOL098C
          Length = 1038

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 44/178 (24%), Positives = 76/178 (42%), Gaps = 26/178 (14%)

Query: 108 HGCHGIADIFTRNNGMKQYP--LDRIEEL--------------ASEGDIVHLETPVNPFG 151
           H  H  +D   RNNG+ + P  L+ +  L              AS+   + L T V  F 
Sbjct: 781 HKKHKPSD--KRNNGIPEIPKHLELLTPLGNDLKQKAFIITTPASDSTYMSLVTKVK-FN 837

Query: 152 TSYDIEDFARKAHAKGALLVIDSTFAPPPLQDVWKFGADVVIHSCTKYFGGHSDLLSGVV 211
             Y   D+A  + A   L  ++  F          +GA+++  + +  +     ++ G  
Sbjct: 838 MDYSHPDYAAVSLASEYLQCVEGPFWKGIRGAGLAYGANMMGQTESNIW--EFSIMRGTD 895

Query: 212 VVKSLEVAKKMKNDRIYLGTNIANLESYLLLRSLRTFEMRV--RKQSENATALVKYLD 267
           ++K  E+AKK+ ND      N  N E  LL  +L +   R+   + S  ++A+ KY+D
Sbjct: 896 IIKCFEIAKKIVND---YANNELNFEPKLLEGALSSIINRIATMESSYFSSAISKYID 950

>Kpol_1025.17 s1025 (46552..49041) [2490 bp, 829 aa] {ON}
           (46552..49041) [2490 nt, 830 aa]
          Length = 829

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 47/93 (50%), Gaps = 7/93 (7%)

Query: 183 DVWKFGADVVIHSCTKYFGGHSDLLSGVVVVKSLEVAKKMKNDRIYLGTNIANLESYLLL 242
           +V KF    + +        + +L++ VV+V S E+A+ +K +  YL   I  LE     
Sbjct: 697 EVNKFQTITITNEQLHLLTENKELMNEVVLV-STELAESIKRE-TYLEEKIKLLEEGRRT 754

Query: 243 R-----SLRTFEMRVRKQSENATALVKYLDDHK 270
           +     SL  FE+ +RK+SE    L++ L+D +
Sbjct: 755 KEEEDKSLEYFEIELRKKSEKIVELIQQLNDER 787

>CAGL0I06853g Chr9 complement(664381..666018) [1638 bp, 545 aa] {ON}
           similar to uniprot|P40085 Saccharomyces cerevisiae
           YER140w
          Length = 545

 Score = 31.2 bits (69), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 19/76 (25%), Positives = 35/76 (46%), Gaps = 8/76 (10%)

Query: 50  LETTPVYSRLAHPNATRLESIFSEILGGHAVIYSSGLAAYFATLTHYNPKK--------L 101
           L+T+ VY R+   +  +L  +FS +     ++ S G +     ++H   K+        L
Sbjct: 148 LDTSKVYHRIKRQSTVKLYVLFSLLEMSDQLLSSVGQSLLTVVISHNCYKRLRHRQFFLL 207

Query: 102 FIGQSYHGCHGIADIF 117
           F+G  Y  CHG   ++
Sbjct: 208 FLGVVYLTCHGYVLVY 223

>TPHA0I00540 Chr9 (107264..108934) [1671 bp, 556 aa] {ON} Anc_8.810
           YMR258C
          Length = 556

 Score = 30.4 bits (67), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 42/92 (45%), Gaps = 14/92 (15%)

Query: 296 EGGYGPVFSIVLKSKVQCKKLPGKLELFQHATSLGGVESLVEWRALTDPYIEQ----TLI 351
           E G    F I     +  KK+  K   F H  S  G ES+++   LT  Y+++    +LI
Sbjct: 220 ENGSLRFFQIFSDLNISFKKVGIKKIKFSHMHSKTGYESIIQ--PLTIEYLDKVFDLSLI 277

Query: 352 R---VSVGCEG-----VEDLIKDLAGALKQLQ 375
           +   +S+GCE      +    KDL+  L  LQ
Sbjct: 278 KSLDISIGCENDGCDCLSKFYKDLSNKLLNLQ 309

>CAGL0H03355g Chr8 (312934..313545) [612 bp, 203 aa] {ON} similar to
           uniprot|P53158 Saccharomyces cerevisiae YGL079w
          Length = 203

 Score = 29.6 bits (65), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 30/132 (22%), Positives = 64/132 (48%), Gaps = 17/132 (12%)

Query: 170 LVIDSTFAPPPLQDVWKFGADVVIHSC-----TKYFGGHSDLLSGVVVVKSLEVAKKMKN 224
            + + T  P  L D+ ++  D ++ S      ++ F   +   S V+  KS+E+   ++ 
Sbjct: 78  FIPNDTPDPATLFDITEYIFDSIVQSTNACDFSEAFALQAKT-SAVINSKSMELKNLIEQ 136

Query: 225 DRIYLGTNIANLESYLLLRSLRTFEMRVRKQSENATALVKYLDD-----HKSEFNKVLDK 279
            ++ L    A  ++    ++LRT    +RK  +NA + ++ ++D     +  EFN+  DK
Sbjct: 137 TKVRLPELQAKFKNGT--QTLRT----IRKNLDNAKSRIQVMNDVLQTDYPIEFNQARDK 190

Query: 280 IYHSSLQTEDFV 291
           I   +L +++ V
Sbjct: 191 ILERTLDSDEEV 202

>TDEL0D00190 Chr4 (29971..31629) [1659 bp, 552 aa] {ON} 
          Length = 552

 Score = 30.0 bits (66), Expect = 10.0,   Method: Compositional matrix adjust.
 Identities = 26/94 (27%), Positives = 46/94 (48%), Gaps = 6/94 (6%)

Query: 213 VKSLEVAKKMKNDRIYLGTNIANLESYLLLRSLRTFEMRVRKQSENATALVKYLDDHKSE 272
           + S  V +KMKN+ IY+G    +++       LR  EM   KQ     + +  L D ++ 
Sbjct: 129 IHSDSVFEKMKNNFIYIGKLKGSIDKTYTDEELRIIEM---KQKIPPLSTLFSLSDFENV 185

Query: 273 FNKVLDK---IYHSSLQTEDFVKKQLEGGYGPVF 303
              VL K   +Y+++  +++F  ++    YG VF
Sbjct: 186 AKHVLPKSTFMYYATGSSDEFSIRENHYAYGRVF 219

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.136    0.397 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 41,793,227
Number of extensions: 1840298
Number of successful extensions: 5801
Number of sequences better than 10.0: 136
Number of HSP's gapped: 5757
Number of HSP's successfully gapped: 156
Length of query: 378
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 267
Effective length of database: 40,753,473
Effective search space: 10881177291
Effective search space used: 10881177291
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 66 (30.0 bits)