Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0F11462g7.354ON49843523210.0
KLTH0H01166g7.354ON50743522130.0
Kwal_56.246547.354ON50743521990.0
KLLA0D12254g7.354ON51343521990.0
NCAS0A141707.354ON51043521750.0
Kpol_530.277.354ON50843521710.0
NDAI0A018807.354ON50343521700.0
TPHA0F030107.354ON50943521620.0
TDEL0C019407.354ON51043521580.0
Smik_12.2577.354ON50843621570.0
Suva_10.2937.354ON50543621560.0
YLR197W (NOP56)7.354ON50443621520.0
Skud_12.2627.354ON50543621510.0
ACL144C7.354ON54943521550.0
ZYRO0F11792g7.354ON51343521410.0
CAGL0A04015g7.354ON50843221400.0
TBLA0E020807.354ON51343521220.0
Ecym_47197.354ON51343521170.0
KAFR0L015107.354ON50043521030.0
KNAG0B025907.354ON49943421020.0
KLTH0H15334g8.787ON5114108501e-108
KNAG0J006508.787ON5244138431e-106
KNAG0G031908.787ON5234148411e-106
ZYRO0F12518g8.787ON5194138331e-105
TBLA0B028308.787ON5174108261e-104
TDEL0B011108.787ON5044148251e-104
KAFR0B035408.787ON4994138201e-103
Smik_15.4918.787ON5164138211e-103
YOR310C (NOP58)8.787ON5114138201e-103
Skud_15.4788.787ON5124118191e-103
KAFR0D015808.787ON5014138191e-103
Suva_8.3618.787ON5054138171e-103
Kpol_1010.58.787ON5144138161e-103
TPHA0G011608.787ON5144118151e-102
TPHA0I006508.787ON5404148171e-102
SAKL0B05874g8.787ON5134138151e-102
NDAI0E005508.787ON5234108121e-102
NCAS0B008708.787ON5154128091e-101
KLLA0F08613g8.787ON5114138061e-101
AFR328C8.787ON5134107915e-99
Ecym_14898.787ON5144137862e-98
Kwal_34.158948.787ON5124107846e-98
CAGL0I09790g8.787ON5133747681e-95
TDEL0F031103.429ON4342401821e-13
KNAG0B011403.429ON4922121821e-13
TPHA0D039303.429ON4712341759e-13
KAFR0K015303.429ON5062241696e-12
Kwal_23.39953.429ON4742151661e-11
ZYRO0C12386g3.429ON4442271651e-11
Kpol_1018.1383.429ON4932391599e-11
TBLA0C023203.429ON5112511581e-10
ADR032W3.429ON4392031562e-10
NDAI0G012903.429ON4961991543e-10
YGR091W (PRP31)3.429ON4941991501e-09
Skud_7.3903.429ON4952211438e-09
NCAS0E011603.429ON4792541392e-08
Ecym_44493.429ON4622081392e-08
Suva_7.3743.429ON5132001365e-08
SAKL0F06050g3.429ON4732211293e-07
Smik_6.1773.429ON4822091285e-07
CAGL0G03025g3.429ON4792581189e-06
KLLA0D14883g3.429ON4672221189e-06
KLTH0F12034g3.429ON5242561143e-05
Kpol_1001.64.340ON1482133705.4
Skud_8.1385.365ON55279696.6
YCL014W (BUD3)1.406ON163687689.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0F11462g
         (498 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0F11462g Chr6 complement(889390..890886) [1497 bp, 498 aa] {...   898   0.0  
KLTH0H01166g Chr8 (116579..118102) [1524 bp, 507 aa] {ON} highly...   857   0.0  
Kwal_56.24654 s56 complement(1090443..1091966) [1524 bp, 507 aa]...   851   0.0  
KLLA0D12254g Chr4 (1045077..1046618) [1542 bp, 513 aa] {ON} high...   851   0.0  
NCAS0A14170 Chr1 complement(2783782..2785314) [1533 bp, 510 aa] ...   842   0.0  
Kpol_530.27 s530 (71285..72811) [1527 bp, 508 aa] {ON} (71285..7...   840   0.0  
NDAI0A01880 Chr1 (422978..424489) [1512 bp, 503 aa] {ON} Anc_7.354    840   0.0  
TPHA0F03010 Chr6 complement(658541..660070) [1530 bp, 509 aa] {O...   837   0.0  
TDEL0C01940 Chr3 (340658..342190) [1533 bp, 510 aa] {ON} Anc_7.3...   835   0.0  
Smik_12.257 Chr12 (493092..494618) [1527 bp, 508 aa] {ON} YLR197...   835   0.0  
Suva_10.293 Chr10 (518873..520390) [1518 bp, 505 aa] {ON} YLR197...   835   0.0  
YLR197W Chr12 (546097..547611) [1515 bp, 504 aa] {ON}  NOP56Esse...   833   0.0  
Skud_12.262 Chr12 (492745..494262) [1518 bp, 505 aa] {ON} YLR197...   833   0.0  
ACL144C Chr3 complement(94809..96458) [1650 bp, 549 aa] {ON} Syn...   834   0.0  
ZYRO0F11792g Chr6 complement(962314..963855) [1542 bp, 513 aa] {...   829   0.0  
CAGL0A04015g Chr1 complement(402070..403596) [1527 bp, 508 aa] {...   828   0.0  
TBLA0E02080 Chr5 complement(505617..507158) [1542 bp, 513 aa] {O...   822   0.0  
Ecym_4719 Chr4 (1410528..1412069) [1542 bp, 513 aa] {ON} similar...   820   0.0  
KAFR0L01510 Chr12 complement(276894..278396) [1503 bp, 500 aa] {...   814   0.0  
KNAG0B02590 Chr2 (503498..504997) [1500 bp, 499 aa] {ON} Anc_7.3...   814   0.0  
KLTH0H15334g Chr8 complement(1329504..1331039) [1536 bp, 511 aa]...   332   e-108
KNAG0J00650 Chr10 (110685..112259) [1575 bp, 524 aa] {ON} Anc_8....   329   e-106
KNAG0G03190 Chr7 complement(687362..688933) [1572 bp, 523 aa] {O...   328   e-106
ZYRO0F12518g Chr6 complement(1017206..1018765) [1560 bp, 519 aa]...   325   e-105
TBLA0B02830 Chr2 (653081..654634) [1554 bp, 517 aa] {ON} Anc_8.7...   322   e-104
TDEL0B01110 Chr2 (204471..205985) [1515 bp, 504 aa] {ON} Anc_8.7...   322   e-104
KAFR0B03540 Chr2 complement(735790..737289) [1500 bp, 499 aa] {O...   320   e-103
Smik_15.491 Chr15 complement(846605..848155) [1551 bp, 516 aa] {...   320   e-103
YOR310C Chr15 complement(896825..898360) [1536 bp, 511 aa] {ON} ...   320   e-103
Skud_15.478 Chr15 complement(836937..837160,837194..838505) [153...   320   e-103
KAFR0D01580 Chr4 complement(313631..315136) [1506 bp, 501 aa] {O...   320   e-103
Suva_8.361 Chr8 complement(637602..637804,637835..639149) [1518 ...   319   e-103
Kpol_1010.5 s1010 (13325..14869) [1545 bp, 514 aa] {ON} (13325.....   318   e-103
TPHA0G01160 Chr7 (234712..236256) [1545 bp, 514 aa] {ON} Anc_8.7...   318   e-102
TPHA0I00650 Chr9 (135050..136672) [1623 bp, 540 aa] {ON} Anc_8.7...   319   e-102
SAKL0B05874g Chr2 complement(499332..500873) [1542 bp, 513 aa] {...   318   e-102
NDAI0E00550 Chr5 (108986..110557) [1572 bp, 523 aa] {ON} Anc_8.787    317   e-102
NCAS0B00870 Chr2 complement(133660..135207) [1548 bp, 515 aa] {O...   316   e-101
KLLA0F08613g Chr6 complement(801623..803158) [1536 bp, 511 aa] {...   315   e-101
AFR328C Chr6 complement(1032025..1033566) [1542 bp, 513 aa] {ON}...   309   5e-99
Ecym_1489 Chr1 complement(1006523..1008067) [1545 bp, 514 aa] {O...   307   2e-98
Kwal_34.15894 s34 (102368..103906) [1539 bp, 512 aa] {ON} YOR310...   306   6e-98
CAGL0I09790g Chr9 complement(935016..936557) [1542 bp, 513 aa] {...   300   1e-95
TDEL0F03110 Chr6 (568933..570237) [1305 bp, 434 aa] {ON} Anc_3.4...    75   1e-13
KNAG0B01140 Chr2 complement(210529..212007) [1479 bp, 492 aa] {O...    75   1e-13
TPHA0D03930 Chr4 (823320..824735) [1416 bp, 471 aa] {ON} Anc_3.4...    72   9e-13
KAFR0K01530 Chr11 (319205..320725) [1521 bp, 506 aa] {ON} Anc_3....    70   6e-12
Kwal_23.3995 s23 complement(517426..518850) [1425 bp, 474 aa] {O...    69   1e-11
ZYRO0C12386g Chr3 (978158..979492) [1335 bp, 444 aa] {ON} simila...    68   1e-11
Kpol_1018.138 s1018 complement(368322..369803) [1482 bp, 493 aa]...    66   9e-11
TBLA0C02320 Chr3 complement(549057..550592) [1536 bp, 511 aa] {O...    65   1e-10
ADR032W Chr4 (763161..764480) [1320 bp, 439 aa] {ON} Syntenic ho...    65   2e-10
NDAI0G01290 Chr7 complement(284145..285635) [1491 bp, 496 aa] {O...    64   3e-10
YGR091W Chr7 (666341..667825) [1485 bp, 494 aa] {ON}  PRP31Splic...    62   1e-09
Skud_7.390 Chr7 (650643..652130) [1488 bp, 495 aa] {ON} YGR091W ...    60   8e-09
NCAS0E01160 Chr5 complement(219669..221108) [1440 bp, 479 aa] {O...    58   2e-08
Ecym_4449 Chr4 complement(919492..920880) [1389 bp, 462 aa] {ON}...    58   2e-08
Suva_7.374 Chr7 (641967..643508) [1542 bp, 513 aa] {ON} YGR091W ...    57   5e-08
SAKL0F06050g Chr6 (454404..455825) [1422 bp, 473 aa] {ON} simila...    54   3e-07
Smik_6.177 Chr6 (289760..291208) [1449 bp, 482 aa] {ON} YGR091W ...    54   5e-07
CAGL0G03025g Chr7 (280230..281669) [1440 bp, 479 aa] {ON} simila...    50   9e-06
KLLA0D14883g Chr4 (1254381..1255784) [1404 bp, 467 aa] {ON} weak...    50   9e-06
KLTH0F12034g Chr6 complement(1015072..1016646) [1575 bp, 524 aa]...    49   3e-05
Kpol_1001.6 s1001 complement(20699..25147) [4449 bp, 1482 aa] {O...    32   5.4  
Skud_8.138 Chr8 (230301..231959) [1659 bp, 552 aa] {ON} YHR078W ...    31   6.6  
YCL014W Chr3 (96281..101191) [4911 bp, 1636 aa] {ON}  BUD3Protei...    31   9.8  

>SAKL0F11462g Chr6 complement(889390..890886) [1497 bp, 498 aa] {ON}
           highly similar to uniprot|Q12460 Saccharomyces
           cerevisiae YLR197W SIK1 Component of the small
           (ribosomal) subunit (SSU) processosome that contains U3
           snoRNA
          Length = 498

 Score =  898 bits (2321), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 435/435 (100%), Positives = 435/435 (100%)

Query: 1   MAPIEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQQQINDFGSFTKLVELVSFAPFKGAA 60
           MAPIEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQQQINDFGSFTKLVELVSFAPFKGAA
Sbjct: 1   MAPIEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQQQINDFGSFTKLVELVSFAPFKGAA 60

Query: 61  QALENANDISEGLVSEHLKALLDLNLPKGSAKSTVTLAISDKNLGPSIKETFPYVDCISN 120
           QALENANDISEGLVSEHLKALLDLNLPKGSAKSTVTLAISDKNLGPSIKETFPYVDCISN
Sbjct: 61  QALENANDISEGLVSEHLKALLDLNLPKGSAKSTVTLAISDKNLGPSIKETFPYVDCISN 120

Query: 121 ELAQDLIRGVRLHGDKLLKDLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
           ELAQDLIRGVRLHGDKLLKDLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL
Sbjct: 121 ELAQDLIRGVRLHGDKLLKDLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLDEESLHDLASIL 240
           DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLDEESLHDLASIL
Sbjct: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLDEESLHDLASIL 240

Query: 241 NDDAGIAERVIDNARISMGQDLSETDMENVCIFAERVVSLADYRRQLYDYLCEKMHTVAP 300
           NDDAGIAERVIDNARISMGQDLSETDMENVCIFAERVVSLADYRRQLYDYLCEKMHTVAP
Sbjct: 241 NDDAGIAERVIDNARISMGQDLSETDMENVCIFAERVVSLADYRRQLYDYLCEKMHTVAP 300

Query: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360
           NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS
Sbjct: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360

Query: 361 GFIAKASAKNKGRISRYLANKCSMASRIDNYSDEPTNVFGSVLKKQVEQRLEFYSTGAPT 420
           GFIAKASAKNKGRISRYLANKCSMASRIDNYSDEPTNVFGSVLKKQVEQRLEFYSTGAPT
Sbjct: 361 GFIAKASAKNKGRISRYLANKCSMASRIDNYSDEPTNVFGSVLKKQVEQRLEFYSTGAPT 420

Query: 421 LKNELAIQEAIELYN 435
           LKNELAIQEAIELYN
Sbjct: 421 LKNELAIQEAIELYN 435

>KLTH0H01166g Chr8 (116579..118102) [1524 bp, 507 aa] {ON} highly
           similar to uniprot|Q12460 Saccharomyces cerevisiae
           YLR197W SIK1 Component of the small (ribosomal) subunit
           (SSU) processosome that contains U3 snoRNA
          Length = 507

 Score =  857 bits (2213), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 412/435 (94%), Positives = 425/435 (97%)

Query: 1   MAPIEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQQQINDFGSFTKLVELVSFAPFKGAA 60
           MAPIEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQ QINDFGSFTKLVELVSFAPFKGAA
Sbjct: 1   MAPIEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQAQINDFGSFTKLVELVSFAPFKGAA 60

Query: 61  QALENANDISEGLVSEHLKALLDLNLPKGSAKSTVTLAISDKNLGPSIKETFPYVDCISN 120
           QALENANDISEGLVSE+LKA+LD+NLPKGS K TVTLAISDKNLGPSIKE FPY+DC+SN
Sbjct: 61  QALENANDISEGLVSEYLKAVLDMNLPKGSNKKTVTLAISDKNLGPSIKEVFPYIDCMSN 120

Query: 121 ELAQDLIRGVRLHGDKLLKDLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
           ELAQDLIRGVRLHGDKLLKDLQ GDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL
Sbjct: 121 ELAQDLIRGVRLHGDKLLKDLQQGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLDEESLHDLASIL 240
           DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFA+LVLFIKDKASL E+SLHDL +IL
Sbjct: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAKLVLFIKDKASLTEDSLHDLTAIL 240

Query: 241 NDDAGIAERVIDNARISMGQDLSETDMENVCIFAERVVSLADYRRQLYDYLCEKMHTVAP 300
           +DDAGIAERVIDNARISMGQDLSETDMENVC+FAERV SLADYRRQLYDYLC KMHTVAP
Sbjct: 241 DDDAGIAERVIDNARISMGQDLSETDMENVCVFAERVTSLADYRRQLYDYLCSKMHTVAP 300

Query: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360
           NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS
Sbjct: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360

Query: 361 GFIAKASAKNKGRISRYLANKCSMASRIDNYSDEPTNVFGSVLKKQVEQRLEFYSTGAPT 420
           GFI KASAKNKGRISRYLANKCS+ASRIDNYSDEP+NVFG+VLKKQVEQRLEFYSTGAPT
Sbjct: 361 GFIGKASAKNKGRISRYLANKCSIASRIDNYSDEPSNVFGTVLKKQVEQRLEFYSTGAPT 420

Query: 421 LKNELAIQEAIELYN 435
           LKNELAIQEAIELYN
Sbjct: 421 LKNELAIQEAIELYN 435

>Kwal_56.24654 s56 complement(1090443..1091966) [1524 bp, 507 aa]
           {ON} YLR197W (SIK1) - homology to microtubule binding
           proteins and to X90565_5.cds [contig 161] FULL
          Length = 507

 Score =  851 bits (2199), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 408/435 (93%), Positives = 427/435 (98%)

Query: 1   MAPIEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQQQINDFGSFTKLVELVSFAPFKGAA 60
           MAPIEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQ QIN+FGSFTKLVELVSFAPFKGAA
Sbjct: 1   MAPIEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQAQINEFGSFTKLVELVSFAPFKGAA 60

Query: 61  QALENANDISEGLVSEHLKALLDLNLPKGSAKSTVTLAISDKNLGPSIKETFPYVDCISN 120
           QALENANDISEGLVS++LKA+LD+NLPKGS+K TVTLAISDKNLGPSIKE FPYVDC+SN
Sbjct: 61  QALENANDISEGLVSDYLKAVLDMNLPKGSSKKTVTLAISDKNLGPSIKEAFPYVDCMSN 120

Query: 121 ELAQDLIRGVRLHGDKLLKDLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
           ELAQDLIRGVRLHGDKLLKDLQ GDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL
Sbjct: 121 ELAQDLIRGVRLHGDKLLKDLQQGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLDEESLHDLASIL 240
           DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASL E+SLHDL++IL
Sbjct: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLSEDSLHDLSAIL 240

Query: 241 NDDAGIAERVIDNARISMGQDLSETDMENVCIFAERVVSLADYRRQLYDYLCEKMHTVAP 300
           ++DAGIAERVIDNARISMGQDLSETDM+NVC+FAERV SLADYRRQLY+YLC KMHTVAP
Sbjct: 241 DNDAGIAERVIDNARISMGQDLSETDMDNVCVFAERVTSLADYRRQLYEYLCSKMHTVAP 300

Query: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360
           NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS
Sbjct: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360

Query: 361 GFIAKASAKNKGRISRYLANKCSMASRIDNYSDEPTNVFGSVLKKQVEQRLEFYSTGAPT 420
           GFI KA+AKNKGRISRYLANKCS+ASRIDNYSDEPTNVFG+VLKKQVEQRLEFYSTG+PT
Sbjct: 361 GFIGKAAAKNKGRISRYLANKCSIASRIDNYSDEPTNVFGTVLKKQVEQRLEFYSTGSPT 420

Query: 421 LKNELAIQEAIELYN 435
           LKNELAIQEAIELYN
Sbjct: 421 LKNELAIQEAIELYN 435

>KLLA0D12254g Chr4 (1045077..1046618) [1542 bp, 513 aa] {ON} highly
           similar to uniprot|Q12460 Saccharomyces cerevisiae
           YLR197W SIK1 Component of the small (ribosomal) subunit
           (SSU) processosome that contains U3 snoRNA
          Length = 513

 Score =  851 bits (2199), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 410/435 (94%), Positives = 426/435 (97%)

Query: 1   MAPIEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQQQINDFGSFTKLVELVSFAPFKGAA 60
           MAPIEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQQQINDFGSFTKLVELVSFAPFKGAA
Sbjct: 1   MAPIEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQQQINDFGSFTKLVELVSFAPFKGAA 60

Query: 61  QALENANDISEGLVSEHLKALLDLNLPKGSAKSTVTLAISDKNLGPSIKETFPYVDCISN 120
           QALENANDISEGLVSEHLKALLDLNLPKGS+K TVTLAISDKNLGPSIKE FP+VDCISN
Sbjct: 61  QALENANDISEGLVSEHLKALLDLNLPKGSSKKTVTLAISDKNLGPSIKEVFPFVDCISN 120

Query: 121 ELAQDLIRGVRLHGDKLLKDLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
           ELAQDLIRGVRLHGDKLLKDLQ GDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL
Sbjct: 121 ELAQDLIRGVRLHGDKLLKDLQPGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLDEESLHDLASIL 240
           DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFA+LVLFIKDKASL+EESLHDL+ IL
Sbjct: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAKLVLFIKDKASLNEESLHDLSEIL 240

Query: 241 NDDAGIAERVIDNARISMGQDLSETDMENVCIFAERVVSLADYRRQLYDYLCEKMHTVAP 300
           ++DAGI+ERVIDNARISMGQDLSETDMENV IFA+RVVSL +YR+QLYDYLCEKMHTVAP
Sbjct: 241 DNDAGISERVIDNARISMGQDLSETDMENVTIFAKRVVSLVEYRKQLYDYLCEKMHTVAP 300

Query: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360
           NLSELIGEVIGARLISH+GSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS
Sbjct: 301 NLSELIGEVIGARLISHSGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360

Query: 361 GFIAKASAKNKGRISRYLANKCSMASRIDNYSDEPTNVFGSVLKKQVEQRLEFYSTGAPT 420
           GFIAKASAKNKGRISRYLANKCSMASRIDNYSDEP+NVFG VLKKQVEQRLEFY++G PT
Sbjct: 361 GFIAKASAKNKGRISRYLANKCSMASRIDNYSDEPSNVFGQVLKKQVEQRLEFYASGTPT 420

Query: 421 LKNELAIQEAIELYN 435
           LKNE AI+EAIELYN
Sbjct: 421 LKNESAIKEAIELYN 435

>NCAS0A14170 Chr1 complement(2783782..2785314) [1533 bp, 510 aa]
           {ON} Anc_7.354
          Length = 510

 Score =  842 bits (2175), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 405/435 (93%), Positives = 423/435 (97%)

Query: 1   MAPIEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQQQINDFGSFTKLVELVSFAPFKGAA 60
           MAPIEYLLFEEPTGY IFKVKLQQDDIGSRLKEVQ+QINDFGSFTKLVELVSFAPFKGAA
Sbjct: 1   MAPIEYLLFEEPTGYAIFKVKLQQDDIGSRLKEVQEQINDFGSFTKLVELVSFAPFKGAA 60

Query: 61  QALENANDISEGLVSEHLKALLDLNLPKGSAKSTVTLAISDKNLGPSIKETFPYVDCISN 120
           +ALENANDISEGLVSE LKA+LDLNLPK S   T+TLAISDKNLGPSIKE FPYVDCI+N
Sbjct: 61  EALENANDISEGLVSESLKAVLDLNLPKASKSKTITLAISDKNLGPSIKEDFPYVDCIAN 120

Query: 121 ELAQDLIRGVRLHGDKLLKDLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
           ELAQDLIRGVRLHGDKL K LQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL
Sbjct: 121 ELAQDLIRGVRLHGDKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLDEESLHDLASIL 240
           DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASL++ESLHDLA+IL
Sbjct: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLNDESLHDLAAIL 240

Query: 241 NDDAGIAERVIDNARISMGQDLSETDMENVCIFAERVVSLADYRRQLYDYLCEKMHTVAP 300
           NDDAGIAERVIDNARISMGQD+SETDMENV +FA+RVVSL +YR+QLYDYLCEKMHTVAP
Sbjct: 241 NDDAGIAERVIDNARISMGQDISETDMENVGVFAQRVVSLVEYRKQLYDYLCEKMHTVAP 300

Query: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360
           NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS
Sbjct: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360

Query: 361 GFIAKASAKNKGRISRYLANKCSMASRIDNYSDEPTNVFGSVLKKQVEQRLEFYSTGAPT 420
           GFIAKASAKNKGRISRYLANKCSMASRIDNYSDEPT+VFG+VLKKQVEQRLEFYSTG PT
Sbjct: 361 GFIAKASAKNKGRISRYLANKCSMASRIDNYSDEPTSVFGAVLKKQVEQRLEFYSTGTPT 420

Query: 421 LKNELAIQEAIELYN 435
           LKNELAI+EA++LYN
Sbjct: 421 LKNELAIKEAMDLYN 435

>Kpol_530.27 s530 (71285..72811) [1527 bp, 508 aa] {ON}
           (71285..72811) [1527 nt, 509 aa]
          Length = 508

 Score =  840 bits (2171), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/435 (92%), Positives = 426/435 (97%)

Query: 1   MAPIEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQQQINDFGSFTKLVELVSFAPFKGAA 60
           MAPIEYLLFEEPTGY +FKVKLQQDDIGSRL+EVQQQIN+FGSFTKLVELVSFAPFKGAA
Sbjct: 1   MAPIEYLLFEEPTGYAVFKVKLQQDDIGSRLQEVQQQINEFGSFTKLVELVSFAPFKGAA 60

Query: 61  QALENANDISEGLVSEHLKALLDLNLPKGSAKSTVTLAISDKNLGPSIKETFPYVDCISN 120
           +ALENANDISEGLVS+ LKA+LDLNLPKGS K +V +AISDKNLGPSIKE FPYVDCISN
Sbjct: 61  EALENANDISEGLVSDSLKAVLDLNLPKGSEKKSVVMAISDKNLGPSIKEVFPYVDCISN 120

Query: 121 ELAQDLIRGVRLHGDKLLKDLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
           ELAQDLIRGVRLHG+KLLK LQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL
Sbjct: 121 ELAQDLIRGVRLHGEKLLKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLDEESLHDLASIL 240
           DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASL+E+SLHDL++IL
Sbjct: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLNEDSLHDLSAIL 240

Query: 241 NDDAGIAERVIDNARISMGQDLSETDMENVCIFAERVVSLADYRRQLYDYLCEKMHTVAP 300
           ++DAG+AERVIDNARISMGQDLSETDM+NVCIFA+RVVSLADYR+QLYDYLCEKMHTVAP
Sbjct: 241 DNDAGVAERVIDNARISMGQDLSETDMDNVCIFAQRVVSLADYRKQLYDYLCEKMHTVAP 300

Query: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360
           NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS
Sbjct: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360

Query: 361 GFIAKASAKNKGRISRYLANKCSMASRIDNYSDEPTNVFGSVLKKQVEQRLEFYSTGAPT 420
           GFI+KASAKNKGRISRYLANKCSMASRIDNYSDEPT+VFG+VLKKQVEQRLEFY+TG PT
Sbjct: 361 GFISKASAKNKGRISRYLANKCSMASRIDNYSDEPTSVFGAVLKKQVEQRLEFYATGTPT 420

Query: 421 LKNELAIQEAIELYN 435
           LKNE+AI EA+ELYN
Sbjct: 421 LKNEVAIHEAMELYN 435

>NDAI0A01880 Chr1 (422978..424489) [1512 bp, 503 aa] {ON} Anc_7.354
          Length = 503

 Score =  840 bits (2170), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 404/435 (92%), Positives = 423/435 (97%)

Query: 1   MAPIEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQQQINDFGSFTKLVELVSFAPFKGAA 60
           MAPIEYLLFEEPTGY IFKVKLQQDDIGSRLKEVQ+QINDFGSFTKLVELVSFAPFKGAA
Sbjct: 1   MAPIEYLLFEEPTGYAIFKVKLQQDDIGSRLKEVQEQINDFGSFTKLVELVSFAPFKGAA 60

Query: 61  QALENANDISEGLVSEHLKALLDLNLPKGSAKSTVTLAISDKNLGPSIKETFPYVDCISN 120
           +ALENAND+SEGLVSE LKA+LDLNLPKGS   TVTLAISDKNLGPSIKE FPYVDC++N
Sbjct: 61  EALENANDVSEGLVSESLKAILDLNLPKGSKGKTVTLAISDKNLGPSIKEEFPYVDCLAN 120

Query: 121 ELAQDLIRGVRLHGDKLLKDLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
           ELAQDLIRGVRLHG+KL K LQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL
Sbjct: 121 ELAQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLDEESLHDLASIL 240
           DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASL++ESLHDLA+IL
Sbjct: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLNDESLHDLAAIL 240

Query: 241 NDDAGIAERVIDNARISMGQDLSETDMENVCIFAERVVSLADYRRQLYDYLCEKMHTVAP 300
            DDAGIA+RVIDNARISMGQD+SETDMENV IFA+RVVSL +YR+QL+DYLCEKMHTVAP
Sbjct: 241 GDDAGIAQRVIDNARISMGQDISETDMENVSIFAQRVVSLVEYRKQLFDYLCEKMHTVAP 300

Query: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360
           NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS
Sbjct: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360

Query: 361 GFIAKASAKNKGRISRYLANKCSMASRIDNYSDEPTNVFGSVLKKQVEQRLEFYSTGAPT 420
           GFIAKASAKNKGRISRYLANKCSMASRIDNYSDEPTNVFGSVLKKQVEQRLEFY+TG PT
Sbjct: 361 GFIAKASAKNKGRISRYLANKCSMASRIDNYSDEPTNVFGSVLKKQVEQRLEFYNTGKPT 420

Query: 421 LKNELAIQEAIELYN 435
           LKNELAIQEA++LYN
Sbjct: 421 LKNELAIQEAMDLYN 435

>TPHA0F03010 Chr6 complement(658541..660070) [1530 bp, 509 aa] {ON}
           Anc_7.354 YLR197W
          Length = 509

 Score =  837 bits (2162), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/435 (91%), Positives = 424/435 (97%)

Query: 1   MAPIEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQQQINDFGSFTKLVELVSFAPFKGAA 60
           MAPIEYLL+EEPTGY IFKVKLQQDDIGSRL EVQQQINDFGSFTKLVELVSFAPFKGAA
Sbjct: 1   MAPIEYLLYEEPTGYAIFKVKLQQDDIGSRLGEVQQQINDFGSFTKLVELVSFAPFKGAA 60

Query: 61  QALENANDISEGLVSEHLKALLDLNLPKGSAKSTVTLAISDKNLGPSIKETFPYVDCISN 120
           +ALENANDISEGLVSE+LKALLDLNLPKGS K +V L ISDKNLGPSIKE FPYVDC++N
Sbjct: 61  EALENANDISEGLVSENLKALLDLNLPKGSEKKSVVLGISDKNLGPSIKEDFPYVDCMAN 120

Query: 121 ELAQDLIRGVRLHGDKLLKDLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
           ELAQDL+RG+RLHG+KL KDLQ+GDL+RAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL
Sbjct: 121 ELAQDLLRGIRLHGEKLFKDLQTGDLDRAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLDEESLHDLASIL 240
           DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNY FA+LVLFIKDKASL++ESLHDL +IL
Sbjct: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYSFARLVLFIKDKASLNDESLHDLTAIL 240

Query: 241 NDDAGIAERVIDNARISMGQDLSETDMENVCIFAERVVSLADYRRQLYDYLCEKMHTVAP 300
           NDDAGI++RVIDNARISMGQDLSETDM+N+C+FA+RVVSL +YRRQLYDYLCEKMHTVAP
Sbjct: 241 NDDAGISQRVIDNARISMGQDLSETDMDNICVFAKRVVSLVEYRRQLYDYLCEKMHTVAP 300

Query: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360
           NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS
Sbjct: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360

Query: 361 GFIAKASAKNKGRISRYLANKCSMASRIDNYSDEPTNVFGSVLKKQVEQRLEFYSTGAPT 420
           GFIAKA+AKNKGRISRYLANKCSMASRIDNYSDEPTNVFGSVLKKQVEQRLEFY+TG+PT
Sbjct: 361 GFIAKAAAKNKGRISRYLANKCSMASRIDNYSDEPTNVFGSVLKKQVEQRLEFYATGSPT 420

Query: 421 LKNELAIQEAIELYN 435
           LKNELAIQEA++LYN
Sbjct: 421 LKNELAIQEAMKLYN 435

>TDEL0C01940 Chr3 (340658..342190) [1533 bp, 510 aa] {ON} Anc_7.354
           YLR197W
          Length = 510

 Score =  835 bits (2158), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/435 (91%), Positives = 421/435 (96%)

Query: 1   MAPIEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQQQINDFGSFTKLVELVSFAPFKGAA 60
           MAPI+YLLFEEPTGY IFKVKLQQD+IGSRL EVQ+QINDFGSFTKLVELVSFAPFKGAA
Sbjct: 1   MAPIQYLLFEEPTGYAIFKVKLQQDNIGSRLGEVQEQINDFGSFTKLVELVSFAPFKGAA 60

Query: 61  QALENANDISEGLVSEHLKALLDLNLPKGSAKSTVTLAISDKNLGPSIKETFPYVDCISN 120
           +ALENANDISEGLVSE LKA+LDLNLPKGS K TVTL ISD+NLGPSIKE FPYVD +SN
Sbjct: 61  EALENANDISEGLVSESLKAILDLNLPKGSKKETVTLGISDRNLGPSIKEEFPYVDSVSN 120

Query: 121 ELAQDLIRGVRLHGDKLLKDLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
           ELAQDLIRGVRLHG+KL K LQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL
Sbjct: 121 ELAQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLDEESLHDLASIL 240
           DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLF+KDKASL++ESLHDLA+IL
Sbjct: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFVKDKASLNDESLHDLAAIL 240

Query: 241 NDDAGIAERVIDNARISMGQDLSETDMENVCIFAERVVSLADYRRQLYDYLCEKMHTVAP 300
           NDDA IA+RVIDNARISMGQDLSETDMENVC+FAERV SLADYRRQLY+YLCEKMHTVAP
Sbjct: 241 NDDAAIAQRVIDNARISMGQDLSETDMENVCVFAERVASLADYRRQLYEYLCEKMHTVAP 300

Query: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360
           NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS
Sbjct: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360

Query: 361 GFIAKASAKNKGRISRYLANKCSMASRIDNYSDEPTNVFGSVLKKQVEQRLEFYSTGAPT 420
           GFIAKA+ KNKGRISRYLANKCSMASRIDNYSDEPTNVFG+VL+KQVEQRLEFYSTG PT
Sbjct: 361 GFIAKAATKNKGRISRYLANKCSMASRIDNYSDEPTNVFGTVLRKQVEQRLEFYSTGQPT 420

Query: 421 LKNELAIQEAIELYN 435
           LKNELAI+EA++LYN
Sbjct: 421 LKNELAIKEAMDLYN 435

>Smik_12.257 Chr12 (493092..494618) [1527 bp, 508 aa] {ON} YLR197W
           (REAL)
          Length = 508

 Score =  835 bits (2157), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/436 (91%), Positives = 424/436 (97%), Gaps = 1/436 (0%)

Query: 1   MAPIEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQQQINDFGSFTKLVELVSFAPFKGAA 60
           MAPIEYLLFEEPTGY +FKVKLQQDDIGSRLKEVQ+QINDFG+FTKLVEL SFAPFKGAA
Sbjct: 1   MAPIEYLLFEEPTGYAVFKVKLQQDDIGSRLKEVQEQINDFGAFTKLVELASFAPFKGAA 60

Query: 61  QALENANDISEGLVSEHLKALLDLNLPKGSAKS-TVTLAISDKNLGPSIKETFPYVDCIS 119
           +ALENANDISEGLVSE LKA+LDLNLPK S+K+  VTLAISDKNLGPSIKE FPYVDCIS
Sbjct: 61  EALENANDISEGLVSESLKAILDLNLPKASSKNKNVTLAISDKNLGPSIKEEFPYVDCIS 120

Query: 120 NELAQDLIRGVRLHGDKLLKDLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL 179
           NELAQDLIRGVRLHG+KL K LQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL
Sbjct: 121 NELAQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL 180

Query: 180 LDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLDEESLHDLASI 239
           LDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNY FA+LVLFIKDKASL+++SLHDLA++
Sbjct: 181 LDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYTFAKLVLFIKDKASLNDDSLHDLAAL 240

Query: 240 LNDDAGIAERVIDNARISMGQDLSETDMENVCIFAERVVSLADYRRQLYDYLCEKMHTVA 299
           LN+D+GIA+RVIDNARISMGQD+SETDMENVC+FA+RV SLADYRRQLYDYLCEKMHTVA
Sbjct: 241 LNEDSGIAQRVIDNARISMGQDISETDMENVCVFAQRVASLADYRRQLYDYLCEKMHTVA 300

Query: 300 PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH 359
           PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH
Sbjct: 301 PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH 360

Query: 360 SGFIAKASAKNKGRISRYLANKCSMASRIDNYSDEPTNVFGSVLKKQVEQRLEFYSTGAP 419
           SGFI+KASAKNKGRISRYLANKCSMASRIDNYSDEP+NVFGSVLKKQVEQRLEFY+TG P
Sbjct: 361 SGFISKASAKNKGRISRYLANKCSMASRIDNYSDEPSNVFGSVLKKQVEQRLEFYNTGKP 420

Query: 420 TLKNELAIQEAIELYN 435
           TLKNELAIQEA+ELYN
Sbjct: 421 TLKNELAIQEAMELYN 436

>Suva_10.293 Chr10 (518873..520390) [1518 bp, 505 aa] {ON} YLR197W
           (REAL)
          Length = 505

 Score =  835 bits (2156), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/436 (91%), Positives = 423/436 (97%), Gaps = 1/436 (0%)

Query: 1   MAPIEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQQQINDFGSFTKLVELVSFAPFKGAA 60
           MAPIEYLLFEEPTGY +FKVKLQQDDIGSRLKEVQ+QINDFG+FTKL+EL SFAPFKGAA
Sbjct: 1   MAPIEYLLFEEPTGYAVFKVKLQQDDIGSRLKEVQEQINDFGAFTKLIELASFAPFKGAA 60

Query: 61  QALENANDISEGLVSEHLKALLDLNLPKGSAKS-TVTLAISDKNLGPSIKETFPYVDCIS 119
           +ALENANDISEGLVSE LKA+LDLNLPK S+K   +TLAISDKNLGPSIKE FPYVDCIS
Sbjct: 61  EALENANDISEGLVSEGLKAILDLNLPKASSKKKNITLAISDKNLGPSIKEQFPYVDCIS 120

Query: 120 NELAQDLIRGVRLHGDKLLKDLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL 179
           NELAQDLIRGVRLHG+KL K LQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL
Sbjct: 121 NELAQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL 180

Query: 180 LDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLDEESLHDLASI 239
           LDQLDKD+NTFAMRVKEWYGWHFPELAKLVPDNY FA+LVLFIKDKASL+E+SLHDLA++
Sbjct: 181 LDQLDKDVNTFAMRVKEWYGWHFPELAKLVPDNYSFAKLVLFIKDKASLNEDSLHDLAAL 240

Query: 240 LNDDAGIAERVIDNARISMGQDLSETDMENVCIFAERVVSLADYRRQLYDYLCEKMHTVA 299
           LNDD+GIA+RVIDNARISMGQDLSETDMENVCIFA+RV SLADYRRQLYDYLCEKMHTVA
Sbjct: 241 LNDDSGIAQRVIDNARISMGQDLSETDMENVCIFAQRVASLADYRRQLYDYLCEKMHTVA 300

Query: 300 PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH 359
           PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH
Sbjct: 301 PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH 360

Query: 360 SGFIAKASAKNKGRISRYLANKCSMASRIDNYSDEPTNVFGSVLKKQVEQRLEFYSTGAP 419
           SGFI+KASAKNKGRISRYLANKCSMASRIDNYSDEP+NVFG+VLKKQVEQRLEFY+TG P
Sbjct: 361 SGFISKASAKNKGRISRYLANKCSMASRIDNYSDEPSNVFGTVLKKQVEQRLEFYNTGKP 420

Query: 420 TLKNELAIQEAIELYN 435
           TLKNELAIQEA+ELYN
Sbjct: 421 TLKNELAIQEAMELYN 436

>YLR197W Chr12 (546097..547611) [1515 bp, 504 aa] {ON}
           NOP56Essential evolutionarily-conserved nucleolar
           protein component of the box C/D snoRNP complexes that
           direct 2'-O-methylation of pre-rRNA during its
           maturation; overexpression causes spindle orientation
           defects
          Length = 504

 Score =  833 bits (2152), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/436 (91%), Positives = 424/436 (97%), Gaps = 1/436 (0%)

Query: 1   MAPIEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQQQINDFGSFTKLVELVSFAPFKGAA 60
           MAPIEYLLFEEPTGY +FKVKLQQDDIGSRLKEVQ+QINDFG+FTKL+ELVSFAPFKGAA
Sbjct: 1   MAPIEYLLFEEPTGYAVFKVKLQQDDIGSRLKEVQEQINDFGAFTKLIELVSFAPFKGAA 60

Query: 61  QALENANDISEGLVSEHLKALLDLNLPKGSAKS-TVTLAISDKNLGPSIKETFPYVDCIS 119
           +ALENANDISEGLVSE LKA+LDLNLPK S+K   +TLAISDKNLGPSIKE FPYVDCIS
Sbjct: 61  EALENANDISEGLVSESLKAILDLNLPKASSKKKNITLAISDKNLGPSIKEEFPYVDCIS 120

Query: 120 NELAQDLIRGVRLHGDKLLKDLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL 179
           NELAQDLIRGVRLHG+KL K LQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL
Sbjct: 121 NELAQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL 180

Query: 180 LDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLDEESLHDLASI 239
           LDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNY FA+LVLFIKDKASL+++SLHDLA++
Sbjct: 181 LDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYTFAKLVLFIKDKASLNDDSLHDLAAL 240

Query: 240 LNDDAGIAERVIDNARISMGQDLSETDMENVCIFAERVVSLADYRRQLYDYLCEKMHTVA 299
           LN+D+GIA+RVIDNARISMGQD+SETDMENVC+FA+RV SLADYRRQLYDYLCEKMHTVA
Sbjct: 241 LNEDSGIAQRVIDNARISMGQDISETDMENVCVFAQRVASLADYRRQLYDYLCEKMHTVA 300

Query: 300 PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH 359
           PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH
Sbjct: 301 PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH 360

Query: 360 SGFIAKASAKNKGRISRYLANKCSMASRIDNYSDEPTNVFGSVLKKQVEQRLEFYSTGAP 419
           SGFI+KASAKNKGRISRYLANKCSMASRIDNYS+EP+NVFGSVLKKQVEQRLEFY+TG P
Sbjct: 361 SGFISKASAKNKGRISRYLANKCSMASRIDNYSEEPSNVFGSVLKKQVEQRLEFYNTGKP 420

Query: 420 TLKNELAIQEAIELYN 435
           TLKNELAIQEA+ELYN
Sbjct: 421 TLKNELAIQEAMELYN 436

>Skud_12.262 Chr12 (492745..494262) [1518 bp, 505 aa] {ON} YLR197W
           (REAL)
          Length = 505

 Score =  833 bits (2151), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/436 (91%), Positives = 423/436 (97%), Gaps = 1/436 (0%)

Query: 1   MAPIEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQQQINDFGSFTKLVELVSFAPFKGAA 60
           MAPIEYLLFEEPTGY +FKVKLQQDDIGSRLKEVQ+QINDFG+FTKLVEL SFAPFKGAA
Sbjct: 1   MAPIEYLLFEEPTGYAVFKVKLQQDDIGSRLKEVQEQINDFGAFTKLVELASFAPFKGAA 60

Query: 61  QALENANDISEGLVSEHLKALLDLNLPKGSAKS-TVTLAISDKNLGPSIKETFPYVDCIS 119
           +ALENANDISEGLVSE LKA+LDLNLPK S+K   +TLAISDKNLGPSIKE FPYVDCIS
Sbjct: 61  EALENANDISEGLVSESLKAILDLNLPKASSKKKNITLAISDKNLGPSIKEDFPYVDCIS 120

Query: 120 NELAQDLIRGVRLHGDKLLKDLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL 179
           NELAQDLIRGVRLHG+KL K LQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL
Sbjct: 121 NELAQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL 180

Query: 180 LDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLDEESLHDLASI 239
           LDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNY FA+LVLFIKDKASL+++SLHDLA++
Sbjct: 181 LDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYAFAKLVLFIKDKASLNDDSLHDLAAL 240

Query: 240 LNDDAGIAERVIDNARISMGQDLSETDMENVCIFAERVVSLADYRRQLYDYLCEKMHTVA 299
           LN+D+GIA+RVIDNARISMGQD+SETDMENVC+FA+RV SLADYRRQLYDYLCEKMHTVA
Sbjct: 241 LNEDSGIAQRVIDNARISMGQDISETDMENVCVFAQRVASLADYRRQLYDYLCEKMHTVA 300

Query: 300 PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH 359
           PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH
Sbjct: 301 PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH 360

Query: 360 SGFIAKASAKNKGRISRYLANKCSMASRIDNYSDEPTNVFGSVLKKQVEQRLEFYSTGAP 419
           SGFI+KASAKNKGRISRYLANKCSMASRIDNYSDEP+NVFGSVLKKQVEQRLEFY+TG P
Sbjct: 361 SGFISKASAKNKGRISRYLANKCSMASRIDNYSDEPSNVFGSVLKKQVEQRLEFYNTGTP 420

Query: 420 TLKNELAIQEAIELYN 435
           T+KNELAIQEA+ELYN
Sbjct: 421 TMKNELAIQEAMELYN 436

>ACL144C Chr3 complement(94809..96458) [1650 bp, 549 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR197W
           (SIK1)
          Length = 549

 Score =  834 bits (2155), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/435 (91%), Positives = 422/435 (97%)

Query: 1   MAPIEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQQQINDFGSFTKLVELVSFAPFKGAA 60
           MAPIEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQ+QINDFGSFTKLVELVSFAPFKGAA
Sbjct: 1   MAPIEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQKQINDFGSFTKLVELVSFAPFKGAA 60

Query: 61  QALENANDISEGLVSEHLKALLDLNLPKGSAKSTVTLAISDKNLGPSIKETFPYVDCISN 120
            ALENANDISEGL+SEHLKA+LDLNLPKGSAK +V LA+SDKNLGPSIKE FPYVDCISN
Sbjct: 61  HALENANDISEGLLSEHLKAVLDLNLPKGSAKKSVVLAVSDKNLGPSIKEEFPYVDCISN 120

Query: 121 ELAQDLIRGVRLHGDKLLKDLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
           ELAQDL+RGVRLHG KLLKDLQ GDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL
Sbjct: 121 ELAQDLLRGVRLHGAKLLKDLQEGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLDEESLHDLASIL 240
           DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFA+LVLFI+DKASL++ESLHDL++IL
Sbjct: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAKLVLFIRDKASLNDESLHDLSAIL 240

Query: 241 NDDAGIAERVIDNARISMGQDLSETDMENVCIFAERVVSLADYRRQLYDYLCEKMHTVAP 300
            +DAGIAERVI NARISMGQDLSE DMENV +FAERVV+L +YRRQLY+YLCEKMHTVAP
Sbjct: 241 GEDAGIAERVISNARISMGQDLSEVDMENVSVFAERVVNLVEYRRQLYEYLCEKMHTVAP 300

Query: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360
           NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS
Sbjct: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360

Query: 361 GFIAKASAKNKGRISRYLANKCSMASRIDNYSDEPTNVFGSVLKKQVEQRLEFYSTGAPT 420
           GFI+KASAKNKGRISRYLANKCSMASRIDNYSD+PTNVFG VLKKQVEQRLEFY+TG+PT
Sbjct: 361 GFISKASAKNKGRISRYLANKCSMASRIDNYSDDPTNVFGQVLKKQVEQRLEFYATGSPT 420

Query: 421 LKNELAIQEAIELYN 435
           LKNE+AIQEAI L+N
Sbjct: 421 LKNEIAIQEAIALFN 435

>ZYRO0F11792g Chr6 complement(962314..963855) [1542 bp, 513 aa] {ON}
           highly similar to uniprot|Q12460 Saccharomyces
           cerevisiae YLR197W SIK1 Component of the small
           (ribosomal) subunit (SSU) processosome that contains U3
           snoRNA
          Length = 513

 Score =  829 bits (2141), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/435 (90%), Positives = 419/435 (96%)

Query: 1   MAPIEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQQQINDFGSFTKLVELVSFAPFKGAA 60
           MAPIEYLLFEEPTGY IFKVKLQQD+IGSRL+EVQ+QINDFGSFTKL+ELVSF+PFKGAA
Sbjct: 1   MAPIEYLLFEEPTGYAIFKVKLQQDNIGSRLEEVQKQINDFGSFTKLLELVSFSPFKGAA 60

Query: 61  QALENANDISEGLVSEHLKALLDLNLPKGSAKSTVTLAISDKNLGPSIKETFPYVDCISN 120
           +ALENANDISEGL+SE LKA+LDLNLPKGS K +VTL ISDKNLGPSIKE FPYVDC SN
Sbjct: 61  EALENANDISEGLLSESLKAVLDLNLPKGSKKQSVTLGISDKNLGPSIKEVFPYVDCFSN 120

Query: 121 ELAQDLIRGVRLHGDKLLKDLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
           EL+QDLIRGVRLHG+KL K LQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL
Sbjct: 121 ELSQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLDEESLHDLASIL 240
           DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNY FA+LVLFIKDK SL E+SLHDLA++L
Sbjct: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYNFAKLVLFIKDKTSLSEDSLHDLAALL 240

Query: 241 NDDAGIAERVIDNARISMGQDLSETDMENVCIFAERVVSLADYRRQLYDYLCEKMHTVAP 300
           NDDA IAERV+DNARISMGQDLS  DMENVCIFA+RVV+LADYRRQLYDYLCEKMHTVAP
Sbjct: 241 NDDAAIAERVMDNARISMGQDLSSADMENVCIFAQRVVNLADYRRQLYDYLCEKMHTVAP 300

Query: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360
           NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS
Sbjct: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360

Query: 361 GFIAKASAKNKGRISRYLANKCSMASRIDNYSDEPTNVFGSVLKKQVEQRLEFYSTGAPT 420
           GFI+KA+AKNKGRISRYLANKC+MASRIDNYSDEPTN+FG+VLKKQVEQRLEFY+TG PT
Sbjct: 361 GFISKAAAKNKGRISRYLANKCTMASRIDNYSDEPTNIFGTVLKKQVEQRLEFYTTGHPT 420

Query: 421 LKNELAIQEAIELYN 435
           LKNELAIQEAIELYN
Sbjct: 421 LKNELAIQEAIELYN 435

>CAGL0A04015g Chr1 complement(402070..403596) [1527 bp, 508 aa] {ON}
           similar to uniprot|Q12460 Saccharomyces cerevisiae
           YLR197w SIK1 involved in pre-rRNA processing
          Length = 508

 Score =  828 bits (2140), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/432 (91%), Positives = 420/432 (97%)

Query: 4   IEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQQQINDFGSFTKLVELVSFAPFKGAAQAL 63
           IEYLLFEEPTGY +FKVKL QD+IGS+LKEVQ+QINDFG FTKLVELVSFAPFKGAA+AL
Sbjct: 3   IEYLLFEEPTGYAVFKVKLNQDNIGSKLKEVQEQINDFGGFTKLVELVSFAPFKGAAEAL 62

Query: 64  ENANDISEGLVSEHLKALLDLNLPKGSAKSTVTLAISDKNLGPSIKETFPYVDCISNELA 123
           ENANDISEGLVSE LK +L+LNLPKGSAKSTVTLAISDKNLGPSIKE FPYVDCI+NELA
Sbjct: 63  ENANDISEGLVSESLKNVLELNLPKGSAKSTVTLAISDKNLGPSIKEAFPYVDCIANELA 122

Query: 124 QDLIRGVRLHGDKLLKDLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALLDQL 183
           QDLIRGVRLHG+KLLK LQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALLDQL
Sbjct: 123 QDLIRGVRLHGEKLLKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALLDQL 182

Query: 184 DKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLDEESLHDLASILNDD 243
           DKDINTFAMRVKEWYGWHFPELAKLVPDNY FA+LVLFIKDKASL+EESLHDLA+++N+D
Sbjct: 183 DKDINTFAMRVKEWYGWHFPELAKLVPDNYTFAKLVLFIKDKASLNEESLHDLAAVVNED 242

Query: 244 AGIAERVIDNARISMGQDLSETDMENVCIFAERVVSLADYRRQLYDYLCEKMHTVAPNLS 303
           AGIAER+IDNARISMGQDLSETDMENVC+FA+RVVSL DYR+QLYDYLCEKMHTVAPNLS
Sbjct: 243 AGIAERIIDNARISMGQDLSETDMENVCVFAQRVVSLVDYRKQLYDYLCEKMHTVAPNLS 302

Query: 304 ELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHSGFI 363
            LIGEVIGARLISHAGSLT+LSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHSGFI
Sbjct: 303 GLIGEVIGARLISHAGSLTSLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHSGFI 362

Query: 364 AKASAKNKGRISRYLANKCSMASRIDNYSDEPTNVFGSVLKKQVEQRLEFYSTGAPTLKN 423
           AKASAKNKGRISRYLANKCSMASRIDNYSDEPTNVFGSVLKKQVEQRLEFY+TG PTLKN
Sbjct: 363 AKASAKNKGRISRYLANKCSMASRIDNYSDEPTNVFGSVLKKQVEQRLEFYATGKPTLKN 422

Query: 424 ELAIQEAIELYN 435
           ELAI EA+EL+N
Sbjct: 423 ELAIHEAMELFN 434

>TBLA0E02080 Chr5 complement(505617..507158) [1542 bp, 513 aa] {ON}
           Anc_7.354 YLR197W
          Length = 513

 Score =  822 bits (2122), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/435 (89%), Positives = 418/435 (96%)

Query: 1   MAPIEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQQQINDFGSFTKLVELVSFAPFKGAA 60
           M+ I+YLLFEEPTGY +F+VKLQQD+IGS+L EVQ+QINDF SFTKLVELVSFAPFKGAA
Sbjct: 1   MSAIQYLLFEEPTGYAVFQVKLQQDNIGSKLAEVQKQINDFASFTKLVELVSFAPFKGAA 60

Query: 61  QALENANDISEGLVSEHLKALLDLNLPKGSAKSTVTLAISDKNLGPSIKETFPYVDCISN 120
           +ALENANDISEGLVSE+LK+LL+LNLPKGS K TV L ISDKNLGPSIKE FPYVDCISN
Sbjct: 61  EALENANDISEGLVSENLKSLLELNLPKGSEKKTVILGISDKNLGPSIKEEFPYVDCISN 120

Query: 121 ELAQDLIRGVRLHGDKLLKDLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
           EL QDL+RG+R HG+KL K LQ GDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL
Sbjct: 121 ELVQDLLRGIRQHGEKLFKGLQQGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLDEESLHDLASIL 240
           DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASL+EESLHDL +IL
Sbjct: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLNEESLHDLTAIL 240

Query: 241 NDDAGIAERVIDNARISMGQDLSETDMENVCIFAERVVSLADYRRQLYDYLCEKMHTVAP 300
           NDDAGIAERVIDNARISMGQDLSETDMENVC+FA+RVVS+ADYR+QLYDYLCEKMHTVAP
Sbjct: 241 NDDAGIAERVIDNARISMGQDLSETDMENVCVFAKRVVSIADYRKQLYDYLCEKMHTVAP 300

Query: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360
           NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS
Sbjct: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360

Query: 361 GFIAKASAKNKGRISRYLANKCSMASRIDNYSDEPTNVFGSVLKKQVEQRLEFYSTGAPT 420
           GFI+KASAKNKGRISRYLANKCSMASRIDNYSDEP++VFG+V+KKQVEQRLEFYSTG PT
Sbjct: 361 GFISKASAKNKGRISRYLANKCSMASRIDNYSDEPSSVFGAVMKKQVEQRLEFYSTGKPT 420

Query: 421 LKNELAIQEAIELYN 435
           LKNE+AI EA+ELYN
Sbjct: 421 LKNEVAIHEAMELYN 435

>Ecym_4719 Chr4 (1410528..1412069) [1542 bp, 513 aa] {ON} similar to
           Ashbya gossypii ACL144C
          Length = 513

 Score =  820 bits (2117), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/435 (89%), Positives = 415/435 (95%)

Query: 1   MAPIEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQQQINDFGSFTKLVELVSFAPFKGAA 60
           MAPIEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQ+QINDFGSFTKLVEL SF PFKGAA
Sbjct: 1   MAPIEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQKQINDFGSFTKLVELASFVPFKGAA 60

Query: 61  QALENANDISEGLVSEHLKALLDLNLPKGSAKSTVTLAISDKNLGPSIKETFPYVDCISN 120
           QALEN NDISEGL+SEHLKA+LDLNLPKGS+K  V LAISDKNLGPSIKE FPYVDCI++
Sbjct: 61  QALENCNDISEGLLSEHLKAVLDLNLPKGSSKKAVVLAISDKNLGPSIKEEFPYVDCIAS 120

Query: 121 ELAQDLIRGVRLHGDKLLKDLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
           ELAQDLIRGVRLHG KLLKDLQ GDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL
Sbjct: 121 ELAQDLIRGVRLHGSKLLKDLQPGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLDEESLHDLASIL 240
           DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFA+LVL I+DK SL ++SLHDLA+IL
Sbjct: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAKLVLHIRDKTSLTDDSLHDLAAIL 240

Query: 241 NDDAGIAERVIDNARISMGQDLSETDMENVCIFAERVVSLADYRRQLYDYLCEKMHTVAP 300
           +DDAGIAERVI NARISMGQDLSE DM+NVC+FAERV +L DYR+QLYDYLC KMHTVAP
Sbjct: 241 DDDAGIAERVISNARISMGQDLSEVDMDNVCVFAERVANLVDYRKQLYDYLCAKMHTVAP 300

Query: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360
           NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS
Sbjct: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360

Query: 361 GFIAKASAKNKGRISRYLANKCSMASRIDNYSDEPTNVFGSVLKKQVEQRLEFYSTGAPT 420
           GFI+KASAKNKGRISRYLANKCS+ASRIDNY+D+PTN FG VLKKQVEQRLEFY+TG PT
Sbjct: 361 GFISKASAKNKGRISRYLANKCSIASRIDNYADDPTNAFGQVLKKQVEQRLEFYATGTPT 420

Query: 421 LKNELAIQEAIELYN 435
           LKNE+AIQEAI+L+N
Sbjct: 421 LKNEVAIQEAIDLFN 435

>KAFR0L01510 Chr12 complement(276894..278396) [1503 bp, 500 aa] {ON}
           Anc_7.354 YLR197W
          Length = 500

 Score =  814 bits (2103), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/435 (89%), Positives = 413/435 (94%)

Query: 1   MAPIEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQQQINDFGSFTKLVELVSFAPFKGAA 60
           MAPIEYLLFEEPTGY +FKVKLQQDDI SRL EVQQQIN+FGSFTKLVELVSFAPFKGAA
Sbjct: 1   MAPIEYLLFEEPTGYAVFKVKLQQDDIASRLAEVQQQINEFGSFTKLVELVSFAPFKGAA 60

Query: 61  QALENANDISEGLVSEHLKALLDLNLPKGSAKSTVTLAISDKNLGPSIKETFPYVDCISN 120
            ALENANDISEGL+S+ LK++L+LNLPK S   TVTL ISDKNLGPSIKE FPYVDCISN
Sbjct: 61  DALENANDISEGLLSDSLKSILELNLPKASKSKTVTLGISDKNLGPSIKEQFPYVDCISN 120

Query: 121 ELAQDLIRGVRLHGDKLLKDLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
           ELAQDL+RGVR HG+KL K LQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL+
Sbjct: 121 ELAQDLLRGVRQHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALV 180

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLDEESLHDLASIL 240
           DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNY FA+LVLFIKDKASL++ESLH+LA  L
Sbjct: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYTFAKLVLFIKDKASLNDESLHELAGHL 240

Query: 241 NDDAGIAERVIDNARISMGQDLSETDMENVCIFAERVVSLADYRRQLYDYLCEKMHTVAP 300
           N+DAGIA+RVIDNARISMGQDLSE DM+NVC+FAERVVSL DYRR LYDYLCEKMHTVAP
Sbjct: 241 NEDAGIAQRVIDNARISMGQDLSEIDMQNVCVFAERVVSLVDYRRGLYDYLCEKMHTVAP 300

Query: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360
           NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS
Sbjct: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360

Query: 361 GFIAKASAKNKGRISRYLANKCSMASRIDNYSDEPTNVFGSVLKKQVEQRLEFYSTGAPT 420
           GFIAKASAKNKGRISRYLANKCS+ASRIDNYSDEP+NVFGSVLKKQVEQRLEFY+ G PT
Sbjct: 361 GFIAKASAKNKGRISRYLANKCSIASRIDNYSDEPSNVFGSVLKKQVEQRLEFYNIGKPT 420

Query: 421 LKNELAIQEAIELYN 435
           LKNELAIQEA+ELYN
Sbjct: 421 LKNELAIQEAMELYN 435

>KNAG0B02590 Chr2 (503498..504997) [1500 bp, 499 aa] {ON} Anc_7.354
           YLR197W
          Length = 499

 Score =  814 bits (2102), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/434 (88%), Positives = 416/434 (95%)

Query: 1   MAPIEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQQQINDFGSFTKLVELVSFAPFKGAA 60
           MA IEYLLFEEPTGY +FKVKLQQDDIGSRL EVQ+QINDFGSFTK+VELVSFAPFKGAA
Sbjct: 1   MAAIEYLLFEEPTGYAVFKVKLQQDDIGSRLAEVQEQINDFGSFTKMVELVSFAPFKGAA 60

Query: 61  QALENANDISEGLVSEHLKALLDLNLPKGSAKSTVTLAISDKNLGPSIKETFPYVDCISN 120
           +ALENAN+ISEGLVSE LK++LDLNLPK S K ++ L ISDKNLGPSIKETFPYVD +SN
Sbjct: 61  EALENANEISEGLVSESLKSVLDLNLPKPSKKKSIALGISDKNLGPSIKETFPYVDSVSN 120

Query: 121 ELAQDLIRGVRLHGDKLLKDLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
           EL QD++RG+RLHG+KL K LQSGDL+RA LGLGHAYSRAKVKFSVQKNDNHIIQAIAL+
Sbjct: 121 ELVQDMLRGIRLHGEKLFKGLQSGDLDRAHLGLGHAYSRAKVKFSVQKNDNHIIQAIALV 180

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLDEESLHDLASIL 240
           DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASL++ESLHDLA++L
Sbjct: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLNDESLHDLAALL 240

Query: 241 NDDAGIAERVIDNARISMGQDLSETDMENVCIFAERVVSLADYRRQLYDYLCEKMHTVAP 300
           NDDAGIA+RVIDNARISMGQDLSETDMENV +FA+RVVSL +YRRQLYDYLCEKMHTVAP
Sbjct: 241 NDDAGIAQRVIDNARISMGQDLSETDMENVGVFAQRVVSLVEYRRQLYDYLCEKMHTVAP 300

Query: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360
           NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS
Sbjct: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360

Query: 361 GFIAKASAKNKGRISRYLANKCSMASRIDNYSDEPTNVFGSVLKKQVEQRLEFYSTGAPT 420
           GFIAKA+AKNKGRISRYLANKCS+ASRIDNYSDEP+NVFG+VLKKQVEQRLEFY+TG PT
Sbjct: 361 GFIAKAAAKNKGRISRYLANKCSIASRIDNYSDEPSNVFGTVLKKQVEQRLEFYATGKPT 420

Query: 421 LKNELAIQEAIELY 434
           LKNELAI EA+ELY
Sbjct: 421 LKNELAIHEAMELY 434

>KLTH0H15334g Chr8 complement(1329504..1331039) [1536 bp, 511 aa]
           {ON} highly similar to uniprot|Q12499 Saccharomyces
           cerevisiae YOR310C NOP58 Protein involved in pre-rRNA
           processing 18S rRNA synthesis and snoRNA synthesis
           component of the small subunit processome complex which
           is required for processing of pre-18S rRNA
          Length = 511

 Score =  332 bits (850), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 180/410 (43%), Positives = 258/410 (62%), Gaps = 14/410 (3%)

Query: 4   IEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQQQINDFGSFTKLVELVSFAPFKGAAQAL 63
           + Y+L E   GY + K     D    +   + Q +N      K  ++ +F+ F  AA+AL
Sbjct: 1   MAYVLTETSAGYALLKA---SDKKIYKSSSLIQDLNTSDKVLKQFKVAAFSKFGSAAEAL 57

Query: 64  ENANDISEGLVSEHLKALLDLNLPKGSAKSTVTLAISDKNLGPSIKETFPYVDCISNELA 123
           E AN I EG VS  L+ LLD    +  A    TL +S+  L  +I +     + +S+ + 
Sbjct: 58  EEANSIVEGKVSSQLQKLLD----ESKADKKATLVVSETKLANAINKLGLNFNVVSDAVT 113

Query: 124 QDLIRGVRLHGDKLLKDLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALLDQL 183
            D+ R V+ H  +LL  L   DL +  LGL H+  R K+KFS  K D  IIQAIALLD L
Sbjct: 114 LDIFRAVKEHLPELLPGLSDNDLSKMSLGLAHSIGRHKLKFSADKVDVMIIQAIALLDDL 173

Query: 184 DKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLDEESLHDLASILNDD 243
           DK++NT+AMR KEWYGWHFPELAK+V D+  FA+++L +  +++  E    DL+ IL ++
Sbjct: 174 DKELNTYAMRCKEWYGWHFPELAKIVTDSVAFARIILTMGVRSNAAET---DLSEILPEE 230

Query: 244 AGIAERVIDNARISMGQDLSETDMENVCIFAERVVSLADYRRQLYDYLCEKMHTVAPNLS 303
             I ERV   A ISMG +++ TD+EN+   A ++   A YR QL +YL  +M  +APNL+
Sbjct: 231 --IEERVKAAAEISMGTEITPTDLENIKALATQITEFAAYREQLSNYLSARMKAIAPNLT 288

Query: 304 ELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHSGFI 363
           +L+GE++GARLI+HAGSL +L+K  AST+QILGAEKALFRALKTK +TPKYGL+YH+  +
Sbjct: 289 QLVGELVGARLIAHAGSLISLAKSPASTIQILGAEKALFRALKTKHDTPKYGLLYHASLV 348

Query: 364 AKASAKNKGRISRYLANKCSMASRIDNYSDEPTNV--FGSVLKKQVEQRL 411
            +A+ KNKG+I+R LA K +++ R D  +++  +    G   + +VE RL
Sbjct: 349 GQATGKNKGKIARVLAAKAAVSLRYDALAEDRDDSGDVGLEARSKVESRL 398

>KNAG0J00650 Chr10 (110685..112259) [1575 bp, 524 aa] {ON} Anc_8.787
           YOR310C
          Length = 524

 Score =  329 bits (843), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 179/413 (43%), Positives = 265/413 (64%), Gaps = 20/413 (4%)

Query: 4   IEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQQQINDFGSFTKLVE---LVSFAPFKGAA 60
           + Y+L E   GY + K          +L +    I D  S  K+++   + +F+ F  AA
Sbjct: 1   MSYVLTETSAGYALLKAS------DKKLYKSATLIQDLDSSEKVLKEFKIAAFSKFNSAA 54

Query: 61  QALENANDISEGLVSEHLKALLDLNLPKGSAKSTVTLAISDKNLGPSIKETFPYVDCISN 120
            ALE AN + EG VS  L+ LLD ++ K       TL +S+  L  SI +     + +S+
Sbjct: 55  NALEEANSVIEGKVSPQLQKLLD-DIKKDK---KATLVVSETKLANSINKLGLNFNVVSD 110

Query: 121 ELAQDLIRGVRLHGDKLLKDLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
            +  D+ R V+ H  +LL  L   DL +  LGL H+  R K+KFS  K D  IIQAIALL
Sbjct: 111 AVTLDIYRAVKEHLPELLPGLSDNDLSKMSLGLAHSIGRHKLKFSADKVDVMIIQAIALL 170

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLDEESLHDLASIL 240
           D LDK++NT+AMR KEWYGWHFPELAK+V D+  +A+++L +  ++   E    D++ IL
Sbjct: 171 DDLDKELNTYAMRCKEWYGWHFPELAKIVTDSVAYARIILTMGVRSKAHE---IDMSEIL 227

Query: 241 NDDAGIAERVIDNARISMGQDLSETDMENVCIFAERVVSLADYRRQLYDYLCEKMHTVAP 300
            ++  I ERV   A +SMG ++++TD++N+   A+++V  A YR QL +YL  +M  +AP
Sbjct: 228 PEE--IEERVKAAAEVSMGTEITQTDLDNIKALADQIVDFAAYREQLSNYLSARMKAIAP 285

Query: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360
           NL++L+GE++GARLI+HAGSLT+L+K  AST+QILGAEKALFRALKTK +TPKYGL+YH+
Sbjct: 286 NLTQLVGELVGARLIAHAGSLTSLAKAPASTIQILGAEKALFRALKTKHDTPKYGLLYHA 345

Query: 361 GFIAKASAKNKGRISRYLANKCSMASRIDNYSDEPTNV--FGSVLKKQVEQRL 411
             + +A+ KNKG+I+R LA K +++ R D ++++  +    G  ++ +VE RL
Sbjct: 346 SLVGQATGKNKGKIARVLAAKAAVSLRYDAFAEDRDDSGDVGLDVRAKVENRL 398

>KNAG0G03190 Chr7 complement(687362..688933) [1572 bp, 523 aa] {ON}
           Anc_8.787 YOR310C
          Length = 523

 Score =  328 bits (841), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 179/414 (43%), Positives = 265/414 (64%), Gaps = 22/414 (5%)

Query: 4   IEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQQQINDFGSFTKLVE---LVSFAPFKGAA 60
           + Y+L E   GY + K          ++ +    I D  +  KL++   + +F+ F  AA
Sbjct: 1   MSYVLTETSAGYALLKAS------DKKIYKSPSLIEDLNTSEKLLKEFKIAAFSKFNSAA 54

Query: 61  QALENANDISEGLVSEHLKALL-DLNLPKGSAKSTVTLAISDKNLGPSIKETFPYVDCIS 119
            ALE AN + EG VS  L+ LL D+   K +     TL +S+  L  SI +     + +S
Sbjct: 55  NALEEANSVIEGKVSPQLEKLLEDIKKDKKA-----TLVVSETKLANSINKLGLNFNVVS 109

Query: 120 NELAQDLIRGVRLHGDKLLKDLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL 179
           + +  D+ R V+ H  +LL  L   DL +  LGL H+  R K+KFS  K D  IIQAIAL
Sbjct: 110 DAVTLDIYRAVKEHLPELLPGLSDNDLSKMSLGLAHSIGRHKLKFSADKVDVMIIQAIAL 169

Query: 180 LDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLDEESLHDLASI 239
           LD LDK++NT+AMR KEWYGWHFPELAK+V D+  +A+++L +  ++   E    D++ I
Sbjct: 170 LDDLDKELNTYAMRCKEWYGWHFPELAKIVTDSVAYARIILTMGVRSKAHET---DMSEI 226

Query: 240 LNDDAGIAERVIDNARISMGQDLSETDMENVCIFAERVVSLADYRRQLYDYLCEKMHTVA 299
           L ++  I ERV   A +SMG ++++TD++N+   A+++V  A YR QL +YL  +M  +A
Sbjct: 227 LPEE--IEERVKAAAEVSMGTEITQTDLDNIKALADQIVDFAAYREQLSNYLSARMKAIA 284

Query: 300 PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH 359
           PNL++L+GE++GARLI+HAGSLT+L+K  AST+QILGAEKALFRALKTK +TPKYGL+YH
Sbjct: 285 PNLTQLVGELVGARLIAHAGSLTSLAKAPASTIQILGAEKALFRALKTKHDTPKYGLLYH 344

Query: 360 SGFIAKASAKNKGRISRYLANKCSMASRIDNYSDEPTNV--FGSVLKKQVEQRL 411
           +  + +A+ KNKG+I+R LA K +++ R D +S++  +    G  ++ +VE RL
Sbjct: 345 ASLVGQATGKNKGKIARVLAAKAAVSLRYDAFSEDRDDSGDVGLDVRVKVENRL 398

>ZYRO0F12518g Chr6 complement(1017206..1018765) [1560 bp, 519 aa]
           {ON} similar to uniprot|Q12499 Saccharomyces cerevisiae
           YOR310C NOP58 Protein involved in pre-rRNA processing
           18S rRNA synthesis and snoRNA synthesis component of the
           small subunit processome complex which is required for
           processing of pre-18S rRNA
          Length = 519

 Score =  325 bits (833), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 179/413 (43%), Positives = 265/413 (64%), Gaps = 20/413 (4%)

Query: 4   IEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQQQINDFGSFTKLVE---LVSFAPFKGAA 60
           + Y+L E   GY + K          ++ +  + I D  S  K+++   + +F+ F  AA
Sbjct: 1   MSYVLTETSAGYALLKAS------DKKIHKSPKLIQDLDSSEKVLDEFKIAAFSKFNSAA 54

Query: 61  QALENANDISEGLVSEHLKALLDLNLPKGSAKSTVTLAISDKNLGPSIKETFPYVDCISN 120
            ALE AN I+EG V+  L++LLD    K   KST  L +S+  L  SI +     + +S+
Sbjct: 55  NALEEANSITEGKVTPQLQSLLDE--VKKDKKST--LIVSETKLANSINKLGLNFNVVSD 110

Query: 121 ELAQDLIRGVRLHGDKLLKDLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
            +  D+ R V+ +  +LL  L   DL +  LGL H+  R K+KFS  K D  IIQAIALL
Sbjct: 111 AVTLDIYRAVKEYLPELLPGLTDNDLNKMSLGLAHSIGRHKLKFSADKVDVMIIQAIALL 170

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLDEESLHDLASIL 240
           D LDK+INT++MR KEWYGWHFPELAK+V D   +A+++L +  ++   E    D+++IL
Sbjct: 171 DDLDKEINTYSMRCKEWYGWHFPELAKIVTDLVAYARIILTMGVRSKAAET---DMSAIL 227

Query: 241 NDDAGIAERVIDNARISMGQDLSETDMENVCIFAERVVSLADYRRQLYDYLCEKMHTVAP 300
            ++  I ERV   A +SMG ++++TD++N+   A+++V  A YR QL +YL  +M  +AP
Sbjct: 228 PEE--IEERVKAAAEVSMGTEITKTDLDNIGALAQQIVDFATYREQLSNYLTARMKAIAP 285

Query: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360
           NL++L+GE++GARLISHAGSL +L+K  AST+QILGAEKALFRALKTK +TPKYGL+YH+
Sbjct: 286 NLTQLVGELVGARLISHAGSLVSLAKSPASTIQILGAEKALFRALKTKHDTPKYGLLYHA 345

Query: 361 GFIAKASAKNKGRISRYLANKCSMASRIDNYSDEPTNV--FGSVLKKQVEQRL 411
             + +A+ KNKG+I+R LA K +++ R D  +++  +    G   + +VE RL
Sbjct: 346 SLVGQATGKNKGKIARVLAAKAAVSLRYDALAEDRDDSGDVGLESRSKVENRL 398

>TBLA0B02830 Chr2 (653081..654634) [1554 bp, 517 aa] {ON} Anc_8.787
           YOR310C
          Length = 517

 Score =  322 bits (826), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 174/410 (42%), Positives = 257/410 (62%), Gaps = 14/410 (3%)

Query: 4   IEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQQQINDFGSFTKLVELVSFAPFKGAAQAL 63
           + Y+L E P GY + K     D    +   + Q ++      K  ++ +F+ F  AA AL
Sbjct: 1   MSYVLTETPAGYALLKA---SDKKIYKSSSLLQDLDTTDKVLKEFKIAAFSKFNSAANAL 57

Query: 64  ENANDISEGLVSEHLKALLDLNLPKGSAKSTVTLAISDKNLGPSIKETFPYVDCISNELA 123
           E +  I EG VS  L+ LLD    +       TL +S+  L  +I +    ++ +S+ + 
Sbjct: 58  EESTAIIEGKVSPQLEKLLD----EIKKDKKTTLIVSETKLANAINKLGLNLNIVSDAVT 113

Query: 124 QDLIRGVRLHGDKLLKDLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALLDQL 183
            D+ R V+ +   LL  L   DL +  LGL H+  R K+KFS  K D  IIQAIALLD L
Sbjct: 114 LDIYRAVKEYLPDLLPGLSDSDLNKMSLGLAHSIGRHKLKFSADKVDVMIIQAIALLDDL 173

Query: 184 DKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLDEESLHDLASILNDD 243
           DK++NT+AMR KEWYGWHFPELAK+V D+  +A+L+L +  ++   E    D++ IL ++
Sbjct: 174 DKELNTYAMRCKEWYGWHFPELAKIVTDSVAYARLILTMGIRSKASET---DMSEILPEE 230

Query: 244 AGIAERVIDNARISMGQDLSETDMENVCIFAERVVSLADYRRQLYDYLCEKMHTVAPNLS 303
             I ERV   A +SMG +++ TD++N+   AE++V  A YR QL +YL  +M  +APNL+
Sbjct: 231 --IEERVKTAAEVSMGTEITPTDLDNIKALAEQIVEFASYREQLSNYLSSRMKAIAPNLT 288

Query: 304 ELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHSGFI 363
           +L+GE++GARLI+H+GSL +L+K  AST+QILGAEKALFRALKTK +TPKYGL+YH+  +
Sbjct: 289 QLVGELVGARLIAHSGSLISLAKSPASTIQILGAEKALFRALKTKHDTPKYGLLYHASLV 348

Query: 364 AKASAKNKGRISRYLANKCSMASRIDNYSDEPTNV--FGSVLKKQVEQRL 411
            +A+ KNKG+I+R LA K +++ R D  +++  +    G   + +VE RL
Sbjct: 349 GQATGKNKGKIARVLAAKAAVSLRYDALAEDRDDAGDVGLEARTKVENRL 398

>TDEL0B01110 Chr2 (204471..205985) [1515 bp, 504 aa] {ON} Anc_8.787
           YOR310C
          Length = 504

 Score =  322 bits (825), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 179/414 (43%), Positives = 263/414 (63%), Gaps = 22/414 (5%)

Query: 4   IEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQQQINDFGSFTKLVE---LVSFAPFKGAA 60
           + Y+L E   GY + K          ++ +  + I D  S  K+++   + +F+ F  AA
Sbjct: 1   MAYVLTETSAGYALLKAS------DKKIYKSTKLIQDLDSSDKVLKEFKIAAFSKFNSAA 54

Query: 61  QALENANDISEGLVSEHLKALL-DLNLPKGSAKSTVTLAISDKNLGPSIKETFPYVDCIS 119
            ALE A+ I EG VS  L+ LL D+   K S     TL +S+  L  +I +     + IS
Sbjct: 55  NALEEASAIIEGKVSPQLQNLLEDIKKDKKS-----TLIVSETKLANAINKLGLNFNVIS 109

Query: 120 NELAQDLIRGVRLHGDKLLKDLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL 179
           + +  D+ R V+ +   LL  L  GDL +  LGL H+  R K+KFS  K D  IIQAIAL
Sbjct: 110 DAVTLDIYRAVKEYLPDLLPGLTDGDLSKMSLGLAHSIGRHKLKFSADKVDVMIIQAIAL 169

Query: 180 LDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLDEESLHDLASI 239
           LD LDK++NT+AMR KEWYGWHFPELAK+V D+  +A+++L I  ++   E    D++SI
Sbjct: 170 LDDLDKELNTYAMRCKEWYGWHFPELAKIVTDSVAYARIILSIGVRSKASET---DMSSI 226

Query: 240 LNDDAGIAERVIDNARISMGQDLSETDMENVCIFAERVVSLADYRRQLYDYLCEKMHTVA 299
           L ++  I ERV   A +SMG ++++ D++N+   AE++V  A YR QL +YL  +M  +A
Sbjct: 227 LPEE--IEERVKTAAEVSMGTEITQVDLDNIKCLAEQIVDFASYREQLSNYLSARMKAIA 284

Query: 300 PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH 359
           PNL++L+GE++GARLI+H+GSL +L+K  AST+QILGAEKALFRALKTK +TPKYGL+YH
Sbjct: 285 PNLTQLVGELVGARLIAHSGSLISLAKSPASTIQILGAEKALFRALKTKHDTPKYGLLYH 344

Query: 360 SGFIAKASAKNKGRISRYLANKCSMASRIDNYSDEPTNV--FGSVLKKQVEQRL 411
           +  + +A+ KNKG+I+R LA K +++ R D  +++  +    G   + +VE RL
Sbjct: 345 ASLVGQATGKNKGKIARVLAAKAAVSLRYDALAEDRDDSGDIGLDSRAKVENRL 398

>KAFR0B03540 Chr2 complement(735790..737289) [1500 bp, 499 aa] {ON}
           Anc_8.787 YOR310C
          Length = 499

 Score =  320 bits (820), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 177/413 (42%), Positives = 263/413 (63%), Gaps = 20/413 (4%)

Query: 4   IEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQQQINDFGSFTKLV---ELVSFAPFKGAA 60
           + Y+L E   GY + K   ++    S L      + D  S  K++   ++ +F+ F  AA
Sbjct: 1   MSYILTETSAGYALLKASDKKIYKSSTL------LQDLDSSEKVLRQFKIAAFSKFSSAA 54

Query: 61  QALENANDISEGLVSEHLKALLDLNLPKGSAKSTVTLAISDKNLGPSIKETFPYVDCISN 120
            ALE AN I EG VS  L+ LLD    K   KST  L +S+  L  +I +    +  +S+
Sbjct: 55  NALEEANSIVEGKVSTQLEKLLDE--IKKDKKST--LVVSETKLANAINKLGLNLSVVSD 110

Query: 121 ELAQDLIRGVRLHGDKLLKDLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
            +  D+ R V+ +  +LL  L   DL +  LGL H+  R K+KFS  K D  IIQAIALL
Sbjct: 111 AVTLDIYRAVKEYLPELLPGLDDSDLSKMSLGLAHSIGRHKLKFSADKVDVMIIQAIALL 170

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLDEESLHDLASIL 240
           D LDK++NT+AMR KEWYGWHFPELAK+V D+  +A+++L +  ++   E    D++ IL
Sbjct: 171 DDLDKELNTYAMRCKEWYGWHFPELAKIVTDSVAYARIILTMGIRSKAAET---DMSEIL 227

Query: 241 NDDAGIAERVIDNARISMGQDLSETDMENVCIFAERVVSLADYRRQLYDYLCEKMHTVAP 300
            ++  + ERV   A +SMG +++++D++N+   AE++V  A YR QL +YL  +M  +AP
Sbjct: 228 PEE--VEERVKTAAEVSMGTEITQSDLDNIKSLAEQIVEFAAYREQLSNYLSNRMKAIAP 285

Query: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360
           NL++L+GE++GARLI+H+GSL +L+K  AST+QILGAEKALFRALKTK +TPKYGL+YH+
Sbjct: 286 NLTQLVGELVGARLIAHSGSLVSLAKSPASTIQILGAEKALFRALKTKHDTPKYGLLYHA 345

Query: 361 GFIAKASAKNKGRISRYLANKCSMASRIDNYSDEPTNV--FGSVLKKQVEQRL 411
             + +A+ KNKG+I+R LA K +++ R D  +++  +    G   + +VE RL
Sbjct: 346 SLVGQATGKNKGKIARVLAAKAAVSLRYDALAEDRDDSGDIGLECRAKVENRL 398

>Smik_15.491 Chr15 complement(846605..848155) [1551 bp, 516 aa] {ON}
           YOR310C (REAL)
          Length = 516

 Score =  320 bits (821), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 177/413 (42%), Positives = 262/413 (63%), Gaps = 20/413 (4%)

Query: 4   IEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQQQINDFGSFTKLVE---LVSFAPFKGAA 60
           + Y+L E   GY + K          ++ +    I D  S  K+++   + +F+ F  AA
Sbjct: 1   MAYVLTETSAGYALLKAS------DKKIYKSSSLIQDLDSSDKVLKEFKIAAFSKFNSAA 54

Query: 61  QALENANDISEGLVSEHLKALLDLNLPKGSAKSTVTLAISDKNLGPSIKETFPYVDCISN 120
            ALE AN I EG VS  L+ LL+    K   KST  L +S+  L  +I +     + +S+
Sbjct: 55  NALEEANSIIEGKVSSQLEKLLEE--IKKDKKST--LIVSETKLANAINKLGLNFNVVSD 110

Query: 121 ELAQDLIRGVRLHGDKLLKDLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
            +  D+ R V+ +  +LL  +   DL +  LGL H+  R K+KFS  K D  IIQAIALL
Sbjct: 111 AVTLDIYRAVKEYLPELLPGMSDNDLSKMSLGLAHSIGRHKLKFSADKVDVMIIQAIALL 170

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLDEESLHDLASIL 240
           D LDK++NT+AMR KEWYGWHFPELAK+V D+  +A+++L +  ++   E    DL+ IL
Sbjct: 171 DDLDKELNTYAMRCKEWYGWHFPELAKIVTDSVAYARIILTMGIRSKASET---DLSEIL 227

Query: 241 NDDAGIAERVIDNARISMGQDLSETDMENVCIFAERVVSLADYRRQLYDYLCEKMHTVAP 300
            ++  I ERV   A +SMG ++++TD++N+   AE++V  A YR QL +YL  +M  +AP
Sbjct: 228 PEE--IEERVKTAAEVSMGTEITQTDLDNINALAEQIVEFAAYREQLSNYLSARMKAIAP 285

Query: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360
           NL++L+GE++GARLI+H+GSL +L+K  AST+QILGAEKALFRALKTK +TPKYGL+YH+
Sbjct: 286 NLTQLVGELVGARLIAHSGSLISLAKSPASTIQILGAEKALFRALKTKHDTPKYGLLYHA 345

Query: 361 GFIAKASAKNKGRISRYLANKCSMASRIDNYSDEPTNV--FGSVLKKQVEQRL 411
             + +A+ KNKG+I+R LA K +++ R D  +++  +    G   + +VE RL
Sbjct: 346 SLVGQATGKNKGKIARVLAAKAAVSLRYDALAEDRDDSGDIGLESRAKVENRL 398

>YOR310C Chr15 complement(896825..898360) [1536 bp, 511 aa] {ON}
           NOP58Protein involved in pre-rRNA processing, 18S rRNA
           synthesis, and snoRNA synthesis; component of the small
           subunit processome complex, which is required for
           processing of pre-18S rRNA
          Length = 511

 Score =  320 bits (820), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 176/413 (42%), Positives = 262/413 (63%), Gaps = 20/413 (4%)

Query: 4   IEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQQQINDFGSFTKLVE---LVSFAPFKGAA 60
           + Y+L E   GY + K          ++ +    I D  S  K+++   + +F+ F  AA
Sbjct: 1   MAYVLTETSAGYALLKAS------DKKIYKSSSLIQDLDSSDKVLKEFKIAAFSKFNSAA 54

Query: 61  QALENANDISEGLVSEHLKALLDLNLPKGSAKSTVTLAISDKNLGPSIKETFPYVDCISN 120
            ALE AN I EG VS  L+ LL+    K   KST  L +S+  L  +I +     + +S+
Sbjct: 55  NALEEANSIIEGKVSSQLEKLLEE--IKKDKKST--LIVSETKLANAINKLGLNFNVVSD 110

Query: 121 ELAQDLIRGVRLHGDKLLKDLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
            +  D+ R ++ +  +LL  +   DL +  LGL H+  R K+KFS  K D  IIQAIALL
Sbjct: 111 AVTLDIYRAIKEYLPELLPGMSDNDLSKMSLGLAHSIGRHKLKFSADKVDVMIIQAIALL 170

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLDEESLHDLASIL 240
           D LDK++NT+AMR KEWYGWHFPELAK+V D+  +A+++L +  ++   E    DL+ IL
Sbjct: 171 DDLDKELNTYAMRCKEWYGWHFPELAKIVTDSVAYARIILTMGIRSKASET---DLSEIL 227

Query: 241 NDDAGIAERVIDNARISMGQDLSETDMENVCIFAERVVSLADYRRQLYDYLCEKMHTVAP 300
            ++  I ERV   A +SMG ++++TD++N+   AE++V  A YR QL +YL  +M  +AP
Sbjct: 228 PEE--IEERVKTAAEVSMGTEITQTDLDNINALAEQIVEFAAYREQLSNYLSARMKAIAP 285

Query: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360
           NL++L+GE++GARLI+H+GSL +L+K  AST+QILGAEKALFRALKTK +TPKYGL+YH+
Sbjct: 286 NLTQLVGELVGARLIAHSGSLISLAKSPASTIQILGAEKALFRALKTKHDTPKYGLLYHA 345

Query: 361 GFIAKASAKNKGRISRYLANKCSMASRIDNYSDEPTNV--FGSVLKKQVEQRL 411
             + +A+ KNKG+I+R LA K +++ R D  +++  +    G   + +VE RL
Sbjct: 346 SLVGQATGKNKGKIARVLAAKAAVSLRYDALAEDRDDSGDIGLESRAKVENRL 398

>Skud_15.478 Chr15 complement(836937..837160,837194..838505) [1536
           bp, 512 aa] {ON} YOR310C (REAL)
          Length = 512

 Score =  320 bits (819), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 177/411 (43%), Positives = 261/411 (63%), Gaps = 20/411 (4%)

Query: 6   YLLFEEPTGYGIFKVKLQQDDIGSRLKEVQQQINDFGSFTKLVE---LVSFAPFKGAAQA 62
           Y+L E   GY + K          ++ +    I D  S  K+++   + +F+ F  AA A
Sbjct: 3   YVLTETSAGYALLKAS------DKKIYKSSSLIQDLDSSDKVLKEFKIAAFSKFNSAANA 56

Query: 63  LENANDISEGLVSEHLKALLDLNLPKGSAKSTVTLAISDKNLGPSIKETFPYVDCISNEL 122
           LE AN I EG VS  L+ LL+    K   KST  L +S+  L  +I +     + +S+ +
Sbjct: 57  LEEANSIIEGKVSSQLEKLLEE--IKKDKKST--LIVSETKLANAINKLGLNFNVVSDAV 112

Query: 123 AQDLIRGVRLHGDKLLKDLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALLDQ 182
             D+ R V+ +  +LL  +   DL +  LGL H+  R K+KFS  K D  IIQAIALLD 
Sbjct: 113 TLDIYRAVKEYLPELLPGMSDNDLSKMSLGLAHSIGRHKLKFSADKVDVMIIQAIALLDD 172

Query: 183 LDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLDEESLHDLASILND 242
           LDK++NT+AMR KEWYGWHFPELAK+V D+  +A+++L +  ++   E    DL+ IL +
Sbjct: 173 LDKELNTYAMRCKEWYGWHFPELAKIVTDSVAYARIILTMGIRSKASET---DLSEILPE 229

Query: 243 DAGIAERVIDNARISMGQDLSETDMENVCIFAERVVSLADYRRQLYDYLCEKMHTVAPNL 302
           +  I ERV   A +SMG ++++TD++N+   AE++V  A YR QL +YL  +M  +APNL
Sbjct: 230 E--IEERVKTAAEVSMGTEITQTDLDNINALAEQIVDFAAYREQLSNYLSARMKAIAPNL 287

Query: 303 SELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHSGF 362
           ++L+GE++GARLI+H+GSL +L+K  AST+QILGAEKALFRALKTK +TPKYGL+YH+  
Sbjct: 288 TQLVGELVGARLIAHSGSLISLAKSPASTIQILGAEKALFRALKTKHDTPKYGLLYHASL 347

Query: 363 IAKASAKNKGRISRYLANKCSMASRIDNYSDEPTNV--FGSVLKKQVEQRL 411
           + +A+ KNKG+I+R LA K +++ R D  +++  +    G   + +VE RL
Sbjct: 348 VGQATGKNKGKIARVLAAKAAVSLRYDALAEDRDDSGDIGLESRAKVENRL 398

>KAFR0D01580 Chr4 complement(313631..315136) [1506 bp, 501 aa] {ON}
           Anc_8.787 YOR310C
          Length = 501

 Score =  320 bits (819), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 174/413 (42%), Positives = 263/413 (63%), Gaps = 20/413 (4%)

Query: 4   IEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQQQINDFGSFTKLVE---LVSFAPFKGAA 60
           + Y+L E   GY + K          ++ +    ++D  S  K+++   + +F+ F  AA
Sbjct: 1   MSYVLTETSAGYALLKAS------DKKIYKSTTLLSDLDSSEKVLKEFKIAAFSKFSSAA 54

Query: 61  QALENANDISEGLVSEHLKALLDLNLPKGSAKSTVTLAISDKNLGPSIKETFPYVDCISN 120
            ALE AN I EG VS  L+ +L+    K   KST  L +S+  L  +I +     + +S+
Sbjct: 55  NALEEANSIIEGKVSSQLEKILEQ--IKKDKKST--LIVSETKLANAINKLGLNFNVVSD 110

Query: 121 ELAQDLIRGVRLHGDKLLKDLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
            +  D+ R V+ H  +LL  L   DL +  LGL H+  R K+KFS  K D  IIQAIALL
Sbjct: 111 AVTLDIYRAVKEHLPELLPGLNDSDLSKMSLGLAHSIGRHKLKFSADKVDVMIIQAIALL 170

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLDEESLHDLASIL 240
           D LDK++NT+AMR KEWYGWHFPELAK+V D+  +A+++L +  ++   E    D++ IL
Sbjct: 171 DDLDKELNTYAMRCKEWYGWHFPELAKIVTDSVAYARIILTMGIRSKAAET---DMSEIL 227

Query: 241 NDDAGIAERVIDNARISMGQDLSETDMENVCIFAERVVSLADYRRQLYDYLCEKMHTVAP 300
            ++  + ERV   A +SMG +++++D++N+   AE++V  A YR QL +YL  +M  +AP
Sbjct: 228 PEE--VEERVKTAAEVSMGTEITQSDLDNIKSLAEQIVEFAAYREQLSNYLSNRMKAIAP 285

Query: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360
           NL++L+GE++GARLI+H+GSL +L+K  AST+QILGAEKALFRALKTK +TPKYGL+YH+
Sbjct: 286 NLTQLVGELVGARLIAHSGSLVSLAKSPASTIQILGAEKALFRALKTKHDTPKYGLLYHA 345

Query: 361 GFIAKASAKNKGRISRYLANKCSMASRIDNYSDEPTNV--FGSVLKKQVEQRL 411
             + +A+ KNKG+I+R LA K +++ R D  +++  +    G   + +VE RL
Sbjct: 346 SLVGQATGKNKGKIARVLAAKAAVSLRYDALAEDRDDSGDIGLECRAKVENRL 398

>Suva_8.361 Chr8 complement(637602..637804,637835..639149) [1518 bp,
           505 aa] {ON} YOR310C (REAL)
          Length = 505

 Score =  319 bits (817), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 176/413 (42%), Positives = 262/413 (63%), Gaps = 20/413 (4%)

Query: 4   IEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQQQINDFGSFTKLVE---LVSFAPFKGAA 60
           + Y+L E   GY + K          ++ +    I D  S  K+++   + +F+ F  AA
Sbjct: 1   MAYVLTETSAGYALLKAS------DKKIYKSSSLIQDLDSSDKVLKEFKIAAFSKFNSAA 54

Query: 61  QALENANDISEGLVSEHLKALLDLNLPKGSAKSTVTLAISDKNLGPSIKETFPYVDCISN 120
            ALE AN I +G VS  L+ LL+    K   KST  L +S+  L  +I +     + +S+
Sbjct: 55  NALEEANSIIDGKVSSQLEKLLEE--IKKDKKST--LIVSETKLANAINKLGLNFNVVSD 110

Query: 121 ELAQDLIRGVRLHGDKLLKDLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
            +  D+ R V+ +  +LL  +   DL +  LGL H+  R K+KFS  K D  IIQAIALL
Sbjct: 111 AVTLDIYRAVKEYLPELLPGMSDNDLSKMSLGLAHSIGRHKLKFSADKVDVMIIQAIALL 170

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLDEESLHDLASIL 240
           D LDK++NT+AMR KEWYGWHFPELAK+V D+  +A+++L +  ++   E    DL+ IL
Sbjct: 171 DDLDKELNTYAMRCKEWYGWHFPELAKIVTDSVAYARIILTMGIRSKASET---DLSEIL 227

Query: 241 NDDAGIAERVIDNARISMGQDLSETDMENVCIFAERVVSLADYRRQLYDYLCEKMHTVAP 300
            ++  I ERV   A +SMG ++++TD++N+   AE++V  A YR QL +YL  +M  +AP
Sbjct: 228 PEE--IEERVKTAAEVSMGTEITQTDLDNINALAEQIVDFAAYREQLSNYLSARMKAIAP 285

Query: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360
           NL++L+GE++GARLI+H+GSL +L+K  AST+QILGAEKALFRALKTK +TPKYGL+YH+
Sbjct: 286 NLTQLVGELVGARLIAHSGSLISLAKSPASTIQILGAEKALFRALKTKHDTPKYGLLYHA 345

Query: 361 GFIAKASAKNKGRISRYLANKCSMASRIDNYSDEPTNV--FGSVLKKQVEQRL 411
             + +A+ KNKG+I+R LA K +++ R D  +++  +    G   + +VE RL
Sbjct: 346 SLVGQATGKNKGKIARVLAAKAAVSLRYDALAEDRDDSGDIGLESRAKVENRL 398

>Kpol_1010.5 s1010 (13325..14869) [1545 bp, 514 aa] {ON}
           (13325..14869) [1545 nt, 515 aa]
          Length = 514

 Score =  318 bits (816), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 176/413 (42%), Positives = 261/413 (63%), Gaps = 20/413 (4%)

Query: 4   IEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQQQINDFGSFTKLVE---LVSFAPFKGAA 60
           + Y+L E   GY + K          ++ +    I D  S  K+++   + +F+ F  AA
Sbjct: 1   MAYVLTETSAGYALLKAS------DKKIYKSSSLIQDLDSSDKVLKEFKIAAFSKFNSAA 54

Query: 61  QALENANDISEGLVSEHLKALLDLNLPKGSAKSTVTLAISDKNLGPSIKETFPYVDCISN 120
            ALE AN I EG VS  L+ LL+    K   KST  L +S+  L  +I +     + +S+
Sbjct: 55  NALEEANSIIEGKVSPQLQKLLEE--AKKDKKST--LVVSETKLANAINKLGLNFNVVSD 110

Query: 121 ELAQDLIRGVRLHGDKLLKDLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
            +  D+ R V+ +   LL  L   DL +  LGL H+  R K+KFS  K D  IIQAIALL
Sbjct: 111 AVTLDIYRAVKEYLPDLLPGLNDTDLSKMSLGLAHSIGRHKLKFSADKVDVMIIQAIALL 170

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLDEESLHDLASIL 240
           D LDK++NT+AMR KEWYGWHFPELAK+V D+  +A+++L +  ++   +    DL+ IL
Sbjct: 171 DDLDKELNTYAMRCKEWYGWHFPELAKIVTDSVAYARIILAMGVRSKCADT---DLSEIL 227

Query: 241 NDDAGIAERVIDNARISMGQDLSETDMENVCIFAERVVSLADYRRQLYDYLCEKMHTVAP 300
            ++  + ERV   A +SMG +++ETD++N+   A+++V  A YR QL +YL  +M  +AP
Sbjct: 228 PEE--VEERVKTAAEVSMGTEITETDLDNIKALADQIVDFAAYREQLSNYLSSRMKAIAP 285

Query: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360
           NL++L+GE++GARLI+H+GSL +L+K  AST+QILGAEKALFRALKTK +TPKYGL+YH+
Sbjct: 286 NLTQLVGELVGARLIAHSGSLISLAKSPASTIQILGAEKALFRALKTKHDTPKYGLLYHA 345

Query: 361 GFIAKASAKNKGRISRYLANKCSMASRIDNYSDEPTNV--FGSVLKKQVEQRL 411
             + +A+ KNKG+I+R LA K +++ R D  +++  +    G   + +VE RL
Sbjct: 346 SLVGQATGKNKGKIARVLAAKAAVSLRYDALAEDRDDSGDIGLEARAKVENRL 398

>TPHA0G01160 Chr7 (234712..236256) [1545 bp, 514 aa] {ON} Anc_8.787
           YOR310C
          Length = 514

 Score =  318 bits (815), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 175/411 (42%), Positives = 259/411 (63%), Gaps = 16/411 (3%)

Query: 4   IEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQQQINDFGSFTKLVELVSFAPFKGAAQAL 63
           + Y+L E   GY + K     D    +   + Q ++      K  ++ +F+ F  AA AL
Sbjct: 1   MAYVLTETSAGYALLKA---SDKKIYKSTSLIQDLDTSDKVLKEFKIAAFSKFSSAANAL 57

Query: 64  ENANDISEGLVSEHLKALL-DLNLPKGSAKSTVTLAISDKNLGPSIKETFPYVDCISNEL 122
           E +N I EG VS  L+ LL D+   K S     TL +S+  L  SI +     + +S+ +
Sbjct: 58  EESNAIIEGKVSSQLQKLLEDIKKDKKS-----TLVVSETKLANSINKLGLNFNVVSDAV 112

Query: 123 AQDLIRGVRLHGDKLLKDLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALLDQ 182
             D+ R V+ +  +LL  L   DL +  LGL H+  R K+KFS  K D  IIQAIALLD 
Sbjct: 113 TLDIYRAVKEYLPELLPGLTDSDLSKMSLGLAHSIGRHKLKFSADKVDVMIIQAIALLDD 172

Query: 183 LDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLDEESLHDLASILND 242
           LDK++NT+AMRVKEWYGWHFPELAK+V D+  +A+++L +  ++   E    D++ IL +
Sbjct: 173 LDKELNTYAMRVKEWYGWHFPELAKIVVDSVAYARIILTMGIRSKASET---DMSEILPE 229

Query: 243 DAGIAERVIDNARISMGQDLSETDMENVCIFAERVVSLADYRRQLYDYLCEKMHTVAPNL 302
           +  I ERV   A +SMG +++  D++N+   A+++V  A YR QL +YL  +M  +APNL
Sbjct: 230 E--IEERVKTAAEVSMGTEITPVDLDNIKALADQIVEFAAYREQLSNYLSARMKAIAPNL 287

Query: 303 SELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHSGF 362
           ++L+GE++GARLI+H+GSL +L+K  AST+QILGAEKALFRALKTK +TPKYGL+YH+  
Sbjct: 288 TQLVGELVGARLIAHSGSLISLAKSPASTIQILGAEKALFRALKTKHDTPKYGLLYHASL 347

Query: 363 IAKASAKNKGRISRYLANKCSMASRIDNYSDEPTNV--FGSVLKKQVEQRL 411
           + +A+ KNKG+I+R LA K +++ R D  +++  +    G   + +VE RL
Sbjct: 348 VGQATGKNKGKIARVLAAKAAVSLRYDALAEDRDDSGDIGLEARAKVENRL 398

>TPHA0I00650 Chr9 (135050..136672) [1623 bp, 540 aa] {ON} Anc_8.787
           YOR310C
          Length = 540

 Score =  319 bits (817), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 176/414 (42%), Positives = 261/414 (63%), Gaps = 16/414 (3%)

Query: 1   MAPIEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQQQINDFGSFTKLVELVSFAPFKGAA 60
           +  + Y+L E   GY + K   ++    S L    Q ++      K  ++ +F+ F  AA
Sbjct: 30  LCKMAYVLTETSAGYALLKASDKKIYKSSTL---IQDLDTSDKVLKEFKIAAFSKFSSAA 86

Query: 61  QALENANDISEGLVSEHLKALL-DLNLPKGSAKSTVTLAISDKNLGPSIKETFPYVDCIS 119
            ALE +N I EG VS  L+ LL D+   K S     TL +S+  L  SI +     + +S
Sbjct: 87  NALEESNAIIEGKVSSQLQKLLEDIKKDKKS-----TLVVSETKLANSINKLGLNFNVVS 141

Query: 120 NELAQDLIRGVRLHGDKLLKDLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL 179
           + +  D+ R V+ +  +LL  L   DL +  LGL H+  R K+KFS  K D  IIQAIAL
Sbjct: 142 DAVTLDIYRAVKEYLPELLPGLTDSDLSKMSLGLAHSIGRHKLKFSADKVDVMIIQAIAL 201

Query: 180 LDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLDEESLHDLASI 239
           LD LDK++NT+AMRVKEWYGWHFPELAK+V D+  +A+++L +  ++   E    D++ I
Sbjct: 202 LDDLDKELNTYAMRVKEWYGWHFPELAKIVVDSVAYARIILTMGIRSKASET---DMSEI 258

Query: 240 LNDDAGIAERVIDNARISMGQDLSETDMENVCIFAERVVSLADYRRQLYDYLCEKMHTVA 299
           L ++  I ERV   A +SMG +++  D++N+   A+++V  A YR QL +YL  +M  +A
Sbjct: 259 LPEE--IEERVKTAAEVSMGTEITPVDLDNIKALADQIVEFAAYREQLSNYLSARMKAIA 316

Query: 300 PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH 359
           PNL++L+GE++GARLI+H+GSL +L+K  AST+QILGAEKALFRALKTK +TPKYGL+YH
Sbjct: 317 PNLTQLVGELVGARLIAHSGSLISLAKSPASTIQILGAEKALFRALKTKHDTPKYGLLYH 376

Query: 360 SGFIAKASAKNKGRISRYLANKCSMASRIDNYSDEPTNV--FGSVLKKQVEQRL 411
           +  + +A+ KNKG+I+R LA K +++ R D  +++  +    G   + +VE RL
Sbjct: 377 ASLVGQATGKNKGKIARVLAAKAAVSLRYDALAEDRDDSGDIGLEARAKVESRL 430

>SAKL0B05874g Chr2 complement(499332..500873) [1542 bp, 513 aa] {ON}
           similar to uniprot|Q12499 Saccharomyces cerevisiae
           YOR310C NOP58 Protein involved in pre-rRNA processing
           18S rRNA synthesis and snoRNA synthesis component of the
           small subunit processome complex which is required for
           processing of pre-18S rRNA
          Length = 513

 Score =  318 bits (815), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 173/413 (41%), Positives = 260/413 (62%), Gaps = 20/413 (4%)

Query: 4   IEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQQQINDFGSFTKLVE---LVSFAPFKGAA 60
           + Y+L E   GY + K          ++ +    I D  S  K+++   + +F+ F  AA
Sbjct: 1   MAYVLTETSAGYALLKAS------DKKIYKSSTLIKDLNSSEKVLKEFKIAAFSKFSSAA 54

Query: 61  QALENANDISEGLVSEHLKALLDLNLPKGSAKSTVTLAISDKNLGPSIKETFPYVDCISN 120
            ALE AN I EG VS  L+ LL     +  A    TL +S+  L  +I +     + IS+
Sbjct: 55  DALEEANSIIEGKVSTQLENLL----KEAKADKKATLVVSETKLANAINKLNLNFNVISD 110

Query: 121 ELAQDLIRGVRLHGDKLLKDLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
            +  D+ R V+ +  +LL  L   DL +  LGL H+  R K+KFS  K D  IIQAIALL
Sbjct: 111 AVTLDIYRAVKEYLPELLPGLSDNDLSKMSLGLAHSIGRHKLKFSADKVDVMIIQAIALL 170

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLDEESLHDLASIL 240
           D LDK++NT+AMR KEWYGWHFPELAK+V D+  +A+++L +  +++  +    D++ IL
Sbjct: 171 DDLDKELNTYAMRCKEWYGWHFPELAKIVTDSVAYARIILTMGVRSNAADT---DMSEIL 227

Query: 241 NDDAGIAERVIDNARISMGQDLSETDMENVCIFAERVVSLADYRRQLYDYLCEKMHTVAP 300
            ++  I ERV   + +SMG ++++ D++N+   A+++V  A YR QL +YL  +M  +AP
Sbjct: 228 PEE--IEERVKSASEVSMGTEITQVDLDNIKCLADQIVDFAAYREQLSNYLSSRMKAIAP 285

Query: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360
           NL++L+GE++GARLI+HAGSL +L+K  AST+QILGAEKALFRALKTK +TPKYGL+YH+
Sbjct: 286 NLTQLVGELVGARLIAHAGSLISLAKAPASTIQILGAEKALFRALKTKHDTPKYGLLYHA 345

Query: 361 GFIAKASAKNKGRISRYLANKCSMASRIDNYSDEPTNV--FGSVLKKQVEQRL 411
             + +A+ KNKG+I+R LA K +++ R D  +++  +    G   + +VE RL
Sbjct: 346 SLVGQATGKNKGKIARVLAAKAAVSLRYDALAEDRDDSGDVGLESRAKVENRL 398

>NDAI0E00550 Chr5 (108986..110557) [1572 bp, 523 aa] {ON} Anc_8.787
          Length = 523

 Score =  317 bits (812), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 175/410 (42%), Positives = 259/410 (63%), Gaps = 14/410 (3%)

Query: 4   IEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQQQINDFGSFTKLVELVSFAPFKGAAQAL 63
           + Y+L E   GY + K     D    +   + Q ++      K  ++ +F+ F  AA AL
Sbjct: 1   MSYVLTETSAGYALLKA---SDKKIYKSSSLIQDLDTSDKVLKEFKIAAFSKFSSAANAL 57

Query: 64  ENANDISEGLVSEHLKALLDLNLPKGSAKSTVTLAISDKNLGPSIKETFPYVDCISNELA 123
           E +N I EG VS  L+ LL+    K   KST  L +S+  L  SI +     + +S+ + 
Sbjct: 58  EESNSIIEGKVSPQLEKLLEE--IKKDKKST--LIVSETKLANSINKLGLNFNVVSDAVT 113

Query: 124 QDLIRGVRLHGDKLLKDLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALLDQL 183
            D+ R V+ +  +LL  L   DL +  LGL H+  R K+KFS  K D  IIQAIALLD L
Sbjct: 114 LDIYRAVKEYLPELLPGLNDSDLNKMSLGLAHSIGRHKLKFSADKVDVMIIQAIALLDDL 173

Query: 184 DKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLDEESLHDLASILNDD 243
           DK++NT+AMR KEWYGWHFPELAK+V D+  +A+L+L +  ++   E    D++ IL ++
Sbjct: 174 DKELNTYAMRCKEWYGWHFPELAKIVTDSVAYARLILTMGVRSKASET---DMSEILPEE 230

Query: 244 AGIAERVIDNARISMGQDLSETDMENVCIFAERVVSLADYRRQLYDYLCEKMHTVAPNLS 303
             I ERV   A +SMG ++++ D++N+   A+++V  A YR QL +YL  +M  +APNL+
Sbjct: 231 --IEERVKTAAEVSMGTEITQIDLDNIKCLADQIVEFAAYREQLSNYLSARMKAIAPNLT 288

Query: 304 ELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHSGFI 363
           +L+GE++GARLI+H+GSL +L+K  AST+QILGAEKALFRALKTK +TPKYGL+YH+  +
Sbjct: 289 QLVGELVGARLIAHSGSLISLAKSPASTIQILGAEKALFRALKTKHDTPKYGLLYHASLV 348

Query: 364 AKASAKNKGRISRYLANKCSMASRIDNYSDEPTNV--FGSVLKKQVEQRL 411
            +A+ KNKG+I+R LA K +++ R D  +++  +    G   + +VE RL
Sbjct: 349 GQATGKNKGKIARVLAAKAAVSLRYDALAEDRDDSGDIGLEARAKVENRL 398

>NCAS0B00870 Chr2 complement(133660..135207) [1548 bp, 515 aa] {ON}
           Anc_8.787
          Length = 515

 Score =  316 bits (809), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 177/412 (42%), Positives = 260/412 (63%), Gaps = 18/412 (4%)

Query: 4   IEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQQQINDFGSFTKLVELVSFAPFKGAAQAL 63
           + Y+L E   GY + K     D    +   + Q ++      K  ++ +F+ F  AA AL
Sbjct: 1   MSYVLTETSAGYALLKA---SDKKIYKSSSLIQDLDTSDKVLKEFKIAAFSKFNSAANAL 57

Query: 64  ENANDISEGLVSEHLKALLDLNLPKGSAKSTVTLAISDKNLGPSIKETFPYVDCISNELA 123
           E AN I EG VS  L+ LL+    K   KST  L +S+  L  +I +     + +S+ + 
Sbjct: 58  EEANSIIEGKVSPQLEKLLEE--IKKDKKST--LIVSETKLANAINKLGLNFNVVSDAVT 113

Query: 124 QDLIRGVRLHGDKLLKDLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALLDQL 183
            D+ R V+ +  +LL  L   DL +  LGL H+  R K+KFS  K D  IIQAIALLD L
Sbjct: 114 LDIYRAVKEYLPELLPGLNDSDLSKMSLGLAHSIGRHKLKFSADKVDVMIIQAIALLDDL 173

Query: 184 DKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLF--IKDKASLDEESLHDLASILN 241
           DK++NT+AMR KEWYGWHFPELAK+V D+  +A+++L   I+ KA+       D++ IL 
Sbjct: 174 DKELNTYAMRCKEWYGWHFPELAKIVTDSVAYARIILTMGIRSKAAD-----TDMSEILP 228

Query: 242 DDAGIAERVIDNARISMGQDLSETDMENVCIFAERVVSLADYRRQLYDYLCEKMHTVAPN 301
           ++  I ERV   A +SMG ++++ D+EN+   A+++V  A YR QL +YL  +M  +APN
Sbjct: 229 EE--IEERVKTAAEVSMGTEITQLDLENIKCLADQIVEFAAYREQLSNYLSARMKAIAPN 286

Query: 302 LSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHSG 361
           L++L+GE++GARLI+H+GSL +L+K  AST+QILGAEKALFRALKTK +TPKYGL+YH+ 
Sbjct: 287 LTQLVGELVGARLIAHSGSLISLAKSPASTIQILGAEKALFRALKTKHDTPKYGLLYHAS 346

Query: 362 FIAKASAKNKGRISRYLANKCSMASRIDNYSDEPTNV--FGSVLKKQVEQRL 411
            + +A+ KNKG+I+R LA K +++ R D  +++  +    G   + +VE RL
Sbjct: 347 LVGQATGKNKGKIARVLAAKAAVSIRYDALAEDRDDAGDIGLESRAKVENRL 398

>KLLA0F08613g Chr6 complement(801623..803158) [1536 bp, 511 aa] {ON}
           similar to uniprot|Q12499 Saccharomyces cerevisiae
           YOR310C NOP58 Protein involved in pre-rRNA processing
           18S rRNA synthesis and snoRNA synthesis component of the
           small subunit processome complex which is required for
           processing of pre-18S rRNA
          Length = 511

 Score =  315 bits (806), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 172/413 (41%), Positives = 257/413 (62%), Gaps = 20/413 (4%)

Query: 4   IEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQQQINDFGSFTKLV---ELVSFAPFKGAA 60
           + Y+L E   GY + K          ++ +    I D  S  K++   ++ +F+ F  AA
Sbjct: 1   MAYVLTETSAGYALLKAS------DKKIYKSSSLIQDLNSSDKVLNQFKIAAFSKFSSAA 54

Query: 61  QALENANDISEGLVSEHLKALLDLNLPKGSAKSTVTLAISDKNLGPSIKETFPYVDCISN 120
            ALE AN + +G VS  L+ LL+    +       TL +S+  L  +I +     + +S+
Sbjct: 55  NALEEANSVIDGKVSSQLEKLLE----ECKTDKKATLVVSETKLANAINKLGLNFNVVSD 110

Query: 121 ELAQDLIRGVRLHGDKLLKDLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
            +  D+ R V+ +  +LL  L   DL +  LGL H+  R K+KFS  K D  IIQAIALL
Sbjct: 111 AVTLDIYRAVKEYLPELLPGLNDQDLSKMSLGLAHSIGRHKLKFSADKVDVMIIQAIALL 170

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLDEESLHDLASIL 240
           D LDK++NT+AMR KEWYGWHFPELAK+V D+  +A+++L +  + +  E    D++ IL
Sbjct: 171 DDLDKELNTYAMRCKEWYGWHFPELAKIVTDSVAYARIILTMGIRVNAAET---DMSEIL 227

Query: 241 NDDAGIAERVIDNARISMGQDLSETDMENVCIFAERVVSLADYRRQLYDYLCEKMHTVAP 300
            ++  I ERV   A +SMG +++  D+ N+   AE++V  A YR QL +YL  +M  +AP
Sbjct: 228 PEE--IEERVKTAAEVSMGTEITPVDLINIKCLAEQIVEFAAYREQLSNYLSSRMKAIAP 285

Query: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360
           NL++L+GE++GARLI+H+GSL +L+K  AST+QILGAEKALFRALKTK +TPKYGL+YH+
Sbjct: 286 NLTQLVGELVGARLIAHSGSLISLAKSPASTIQILGAEKALFRALKTKHDTPKYGLLYHA 345

Query: 361 GFIAKASAKNKGRISRYLANKCSMASRIDNYSDEPTNV--FGSVLKKQVEQRL 411
             + +AS KNKG+I+R LA K +++ R D  +++  +    G   + +VE RL
Sbjct: 346 SLVGQASGKNKGKIARVLAAKAAVSLRYDALAEDRDDSGDIGLESRAKVESRL 398

>AFR328C Chr6 complement(1032025..1033566) [1542 bp, 513 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR310C
           (NOP58)
          Length = 513

 Score =  309 bits (791), Expect = 5e-99,   Method: Compositional matrix adjust.
 Identities = 172/410 (41%), Positives = 258/410 (62%), Gaps = 14/410 (3%)

Query: 4   IEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQQQINDFGSFTKLVELVSFAPFKGAAQAL 63
           + Y+L E   GY + K     D    +   + Q +    +  K  ++ +F+ F  AA AL
Sbjct: 1   MAYVLTETAAGYALLKA---SDKKIYKSSSLVQDLKSSENVLKQFKVAAFSKFASAANAL 57

Query: 64  ENANDISEGLVSEHLKALLDLNLPKGSAKSTVTLAISDKNLGPSIKETFPYVDCISNELA 123
           E AN + EG VS  L+ LL     +  +    TL +S+  L  +I +     + + + + 
Sbjct: 58  EEANSVIEGKVSSQLEKLL----AEAKSDKKSTLVVSETKLANAINKLGLNFNVVCDAVT 113

Query: 124 QDLIRGVRLHGDKLLKDLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALLDQL 183
            D+ R V+ +  +LL  +  GDL +  LGL H+  R K+KFS  K D  IIQAIALLD L
Sbjct: 114 LDIYRAVKEYLPELLPGMTDGDLSKMSLGLAHSIGRHKLKFSADKVDVMIIQAIALLDDL 173

Query: 184 DKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLDEESLHDLASILNDD 243
           DK++NT+AMR KEWYGWHFPELAK+V D+  FA+++L +  +++  E    D++ IL ++
Sbjct: 174 DKELNTYAMRCKEWYGWHFPELAKIVTDSVAFARIILTMGVRSNAAET---DMSEILPEE 230

Query: 244 AGIAERVIDNARISMGQDLSETDMENVCIFAERVVSLADYRRQLYDYLCEKMHTVAPNLS 303
             I ERV   A +SMG ++++ D++N+   AE++V  A YR QL +YL  +M  +APNL+
Sbjct: 231 --IEERVKSAAEVSMGTEITQVDLDNIKSLAEQIVEFAAYREQLSNYLSSRMKAIAPNLT 288

Query: 304 ELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHSGFI 363
           +L+GE++GARLI+HAGSL +L+K  AST+QILGAEKALFRALKTK +TPKYGL+YH+  +
Sbjct: 289 QLVGELVGARLIAHAGSLVSLAKAPASTIQILGAEKALFRALKTKHDTPKYGLLYHASLV 348

Query: 364 AKASAKNKGRISRYLANKCSMASRIDNYSDEPTNV--FGSVLKKQVEQRL 411
            +A+ KNKG+I+R LA K +++ R D  +++  +    G   + +VE RL
Sbjct: 349 GQATGKNKGKIARVLAAKAAVSLRYDALAEDRDDSGDIGLEARAKVESRL 398

>Ecym_1489 Chr1 complement(1006523..1008067) [1545 bp, 514 aa] {ON}
           similar to Ashbya gossypii AFR328C
          Length = 514

 Score =  307 bits (786), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 175/413 (42%), Positives = 257/413 (62%), Gaps = 20/413 (4%)

Query: 4   IEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQQQINDFGS---FTKLVELVSFAPFKGAA 60
           + Y+L E   GY + K          ++ +    IND  S     K  ++ +F+ F  AA
Sbjct: 1   MAYVLTETAAGYALLKAS------DKKIYKSATLINDLKSSESVLKQFKIAAFSKFSSAA 54

Query: 61  QALENANDISEGLVSEHLKALLDLNLPKGSAKSTVTLAISDKNLGPSIKETFPYVDCISN 120
            ALE AN + EG VS  L+ LLD    +       TL +S+  LG +I +     + + +
Sbjct: 55  NALEEANAVIEGKVSSQLQKLLD----EAKTDKKATLVVSETKLGNAINKLGLNFNVVCD 110

Query: 121 ELAQDLIRGVRLHGDKLLKDLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
            +  D+ R V+ +  +LL  L   DL +  LGL H+  R K+KFS  K D  IIQAIALL
Sbjct: 111 AVTLDIYRAVKEYLPELLPGLSGDDLSKMSLGLAHSIGRHKLKFSADKVDVMIIQAIALL 170

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLDEESLHDLASIL 240
           D LDK++NT+AMR KEWYGWHFPELAK+V D+  FA+++L +  +++  +    DL+ +L
Sbjct: 171 DDLDKELNTYAMRCKEWYGWHFPELAKIVTDSVAFARIILTMGVRSNAADT---DLSEVL 227

Query: 241 NDDAGIAERVIDNARISMGQDLSETDMENVCIFAERVVSLADYRRQLYDYLCEKMHTVAP 300
            ++  + ERV   A +SMG +++  D++N+   AE++V  A YR QL  YL  +M  +AP
Sbjct: 228 PEE--VEERVKAAAEVSMGTEITPIDLDNIKCLAEQIVEFAAYREQLSSYLSSRMKAIAP 285

Query: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360
           NL+ L+GE++GARLI+HAGSL +L+K  AST+QILGAEKALFRALKTK +TPKYGL+YH+
Sbjct: 286 NLTNLVGELVGARLIAHAGSLISLAKAPASTIQILGAEKALFRALKTKHDTPKYGLLYHA 345

Query: 361 GFIAKASAKNKGRISRYLANKCSMASRIDNYSD--EPTNVFGSVLKKQVEQRL 411
             + +A+ KNKG+I+R LA K +++ R D  ++  + +  FG   + +VE RL
Sbjct: 346 SLVGQATGKNKGKIARVLAAKAAVSLRYDALAEDRDDSGEFGLESRAKVENRL 398

>Kwal_34.15894 s34 (102368..103906) [1539 bp, 512 aa] {ON} YOR310C
           (NOP58) - 57 kDa nucleolar protein [contig 272] FULL
          Length = 512

 Score =  306 bits (784), Expect = 6e-98,   Method: Compositional matrix adjust.
 Identities = 175/410 (42%), Positives = 256/410 (62%), Gaps = 14/410 (3%)

Query: 4   IEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQQQINDFGSFTKLVELVSFAPFKGAAQAL 63
           + Y+L E   GY + K     D    +   + Q +N      K  ++ +F+ F  AA+AL
Sbjct: 1   MAYVLTETSAGYALLKA---SDKKIYKSSSLIQDLNSSDKVLKQFKIAAFSKFGSAAEAL 57

Query: 64  ENANDISEGLVSEHLKALLDLNLPKGSAKSTVTLAISDKNLGPSIKETFPYVDCISNELA 123
           E AN I EG VS  L+ LL     +  A    TL +S+  L  +I +     + +S+ + 
Sbjct: 58  EEANAIVEGKVSNQLQKLL----SESKADKKATLVVSETKLANAINKLGLNFNVVSDAVT 113

Query: 124 QDLIRGVRLHGDKLLKDLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALLDQL 183
            D+ R V+ +  +LL  +   DL +  LGL H+  R K+KFS  K D  IIQAIALLD L
Sbjct: 114 LDIFRAVKEYLPELLPGMSDNDLSKMSLGLAHSIGRHKLKFSADKVDVMIIQAIALLDDL 173

Query: 184 DKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLDEESLHDLASILNDD 243
           DK++NT+AMR KEWYGWHFPELAK+V D+  FA+++L +  +++  E    DL+ IL ++
Sbjct: 174 DKELNTYAMRCKEWYGWHFPELAKIVTDSVAFARIILTMGVRSNAAET---DLSEILPEE 230

Query: 244 AGIAERVIDNARISMGQDLSETDMENVCIFAERVVSLADYRRQLYDYLCEKMHTVAPNLS 303
             I ERV   A ISMG +++  D++N+   A ++   A YR QL +YL  +M  +APNL+
Sbjct: 231 --IEERVKSAAEISMGTEITSVDLDNIKSLATQITEFAAYREQLSNYLSARMKAIAPNLT 288

Query: 304 ELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHSGFI 363
           +L+GE++GARLI+HAGSL +L+K  AST+QILGAEKALFRALKTK +TPKYGL+YH+  +
Sbjct: 289 QLVGELVGARLIAHAGSLISLAKSPASTIQILGAEKALFRALKTKHDTPKYGLLYHASLV 348

Query: 364 AKASAKNKGRISRYLANKCSMASRIDNYSDEPTNV--FGSVLKKQVEQRL 411
            +A+ KNKG+I+R LA K +++ R D  +++  +    G   + +VE RL
Sbjct: 349 GQATGKNKGKIARVLAAKAAVSLRYDALAEDRDDSGDIGLESRSKVESRL 398

>CAGL0I09790g Chr9 complement(935016..936557) [1542 bp, 513 aa] {ON}
           highly similar to uniprot|Q12499 Saccharomyces
           cerevisiae YOR310c
          Length = 513

 Score =  300 bits (768), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 163/374 (43%), Positives = 238/374 (63%), Gaps = 18/374 (4%)

Query: 4   IEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQQQINDFGSFTKLVE---LVSFAPFKGAA 60
           + Y+L E   GY + K   ++    S L      I D  S  K+++   + +F+ F  AA
Sbjct: 1   MSYVLTETSAGYALLKASDKKIYKSSSL------IMDLDSSEKVLKEFKIAAFSKFNSAA 54

Query: 61  QALENANDISEGLVSEHLKALLDLNLPKGSAKSTVTLAISDKNLGPSIKETFPYVDCISN 120
            ALE A+ I EG VS  L+ LLD    +   +   TL +S+  L  +I +     + +S+
Sbjct: 55  NALEEASAIIEGKVSPQLEKLLD----EIKKEKKATLIVSETKLANAINKLGLNFNVVSD 110

Query: 121 ELAQDLIRGVRLHGDKLLKDLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
            +  D+ R V+ +   LL  +   DL +  LGL H+  R K+KFS  K D  IIQAIALL
Sbjct: 111 AVTLDIYRAVKEYLPDLLPGMSDSDLSKMSLGLAHSIGRHKLKFSADKVDVMIIQAIALL 170

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLDEESLHDLASIL 240
           D LDK++NT++MR KEWYGWHFPELAK+V D+  +A+L+L +  ++   E    D++ IL
Sbjct: 171 DDLDKEVNTYSMRCKEWYGWHFPELAKIVTDSVAYARLILTMGVRSKAAET---DMSEIL 227

Query: 241 NDDAGIAERVIDNARISMGQDLSETDMENVCIFAERVVSLADYRRQLYDYLCEKMHTVAP 300
            ++  I ERV   A +SMG ++++ D+ N+   A+++V  A YR QL +YL  +M  +AP
Sbjct: 228 PEE--IEERVKAAAEVSMGTEITDVDLINIRALADQIVEFAAYREQLSNYLSSRMKAIAP 285

Query: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360
           NL++L+GE++GARLI+HAGSL +L+K  AST+QILGAEKALFRALKTK +TPKYGL+YH+
Sbjct: 286 NLTQLVGELVGARLIAHAGSLISLAKSPASTIQILGAEKALFRALKTKHDTPKYGLLYHA 345

Query: 361 GFIAKASAKNKGRI 374
             + +AS +NKG+I
Sbjct: 346 SLVGQASGRNKGKI 359

>TDEL0F03110 Chr6 (568933..570237) [1305 bp, 434 aa] {ON} Anc_3.429
           YGR091W
          Length = 434

 Score = 74.7 bits (182), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 58/240 (24%), Positives = 111/240 (46%), Gaps = 9/240 (3%)

Query: 178 ALLDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLDEESLHDLA 237
           AL   L  +I       K  Y   F EL  LVPD  K+ +++  I++      E     A
Sbjct: 76  ALSSILQGEIRLLHDYTKILYRQRFAELESLVPDPVKYVEVISIIEEDEQASSERFERDA 135

Query: 238 SILNDDAGIAERVIDNARISMGQDLSETDMENVCIFAER--VVSLADYRRQLYDYLCEKM 295
            +  +   +   ++ + + S+ Q+   TD E   +   R  ++++   R ++  Y+ +++
Sbjct: 136 KLSKEQILV---LMMSMKTSIRQERQITDGERAVLLRARSYMLAIVSVRDKVNGYVVQRV 192

Query: 296 HTVAPNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTK-GNTPKY 354
             +APNL  LIG  I + L+SH G +  LS+  +  +  +G  K L   L T      + 
Sbjct: 193 SHIAPNLCALIGPEITSLLLSHFGGILELSQAPSCNLASIGKNKHLTHELHTSLTGVRQE 252

Query: 355 GLIYHSGFIAKASAKNKGRISRYLANKCSMASRID---NYSDEPTNVFGSVLKKQVEQRL 411
           G IY S  +     +   ++ R +  K S+A+R+D   N S E  ++ G   ++++ +++
Sbjct: 253 GYIYRSQLVQDQPPQYHKQMLRMVCAKISLAARVDAGINSSQESDSLLGDKWRREIMEKV 312

>KNAG0B01140 Chr2 complement(210529..212007) [1479 bp, 492 aa] {ON}
           Anc_3.429 YGR091W
          Length = 492

 Score = 74.7 bits (182), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 50/212 (23%), Positives = 106/212 (50%), Gaps = 10/212 (4%)

Query: 185 KDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLDEESLHDLASILNDDA 244
           +DI      +   Y   F EL  L+P+   +A +V  ++   ++ + + ++LA+I   + 
Sbjct: 132 RDIENLHTFMIMQYRKKFLELDSLLPNPVNYADVVFVLE---TMQDRNSNELATIFESEL 188

Query: 245 GIAER----VIDNARISMGQDLSETDMENVCIFAERVV--SLADYRRQLYDYLCEKMHTV 298
            + +     +  + + S+ QD++   +  + +F  R +   L+D+R ++   +  K+H +
Sbjct: 189 LLKKEQTLVLTLSIKTSLRQDVTLEKLIQIRLFRARAMIRQLSDHRERIVKLVESKIHII 248

Query: 299 APNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTK-GNTPKYGLI 357
           APNL+ L+G    + L+ HAGS+  LS   +  +  +G ++ L   L T      + G I
Sbjct: 249 APNLTALVGAETCSYLVGHAGSVVALSLIPSCNLSSIGKKRHLSHELHTNISGVRQEGAI 308

Query: 358 YHSGFIAKASAKNKGRISRYLANKCSMASRID 389
           YH   + +    ++ ++ R +  K S+A+R+D
Sbjct: 309 YHCALVREQPVTHRKQMLRMVCAKVSLAARVD 340

>TPHA0D03930 Chr4 (823320..824735) [1416 bp, 471 aa] {ON} Anc_3.429
           YGR091W
          Length = 471

 Score = 72.0 bits (175), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 64/234 (27%), Positives = 114/234 (48%), Gaps = 17/234 (7%)

Query: 170 DNHIIQAIALLDQLDKDI-----NTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKD 224
           +N I++  ++L++  K I     N FA  +K  Y   FPEL  L+ +   F +++  +++
Sbjct: 90  ENGIVEVASILNKYSKIIQEESSNVFAY-IKILYKPRFPELETLLTNPIDFIEVLKLLEE 148

Query: 225 KASLDEESLHD-LASILNDDAGIAER----VIDNARISMGQDL--SETDMENVCIFAERV 277
             ++ E S  D +A++L +++ I+      VI + +         +E     +    E +
Sbjct: 149 --NITEISNDDYIATLLENESNISSEKRLVVIMSIKTCFNSSFIFTEDARGKLSSVLELL 206

Query: 278 VSLADYRRQLYDYLCEKMHTVAPNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGA 337
             L + + +   YL  K+ T+APNLS LIG  I + LISH GS+  LSK  +  +  +G 
Sbjct: 207 NILMNSKTEAVQYLSSKIGTIAPNLSTLIGTSIASLLISHTGSILELSKVPSCNLASIGK 266

Query: 338 EKALFRA--LKTKGNTPKYGLIYHSGFIAKASAKNKGRISRYLANKCSMASRID 389
           +K    A  + +     + G IY+S  I         ++ R L  K S+A+R+D
Sbjct: 267 KKYSSSAQHITSVSGVRQEGYIYNSELIQNMPISTHKQLLRMLCAKVSLAARVD 320

>KAFR0K01530 Chr11 (319205..320725) [1521 bp, 506 aa] {ON} Anc_3.429
           YGR091W
          Length = 506

 Score = 69.7 bits (169), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 55/224 (24%), Positives = 111/224 (49%), Gaps = 14/224 (6%)

Query: 177 IALLDQLDKDINTFAMRVKEW----YGWHFPELAKLVPDNYKFAQLVLFIKDKASLDEES 232
           +  L+Q+  ++ T    + E+    Y   F EL  L+    +++  V+++ + +  D E 
Sbjct: 107 LPYLNQISLNLRTETANLHEYLKLSYSARFSELESLIATATQYSN-VIYVLETSEKDTEG 165

Query: 233 LHDLASILNDDAGIAERVIDNARISMGQDLSET-----DMENVCIFA-ERVVSLADYRRQ 286
              L + L   A +++  I    +SM    +E+     +++   + A E +++L + R  
Sbjct: 166 --SLVTSLEQVAQLSKEQILVLMMSMKTSFNESTPLPLEIKQRLLRAREMIITLDELRHT 223

Query: 287 LYDYLCEKMHTVAPNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALK 346
           +  Y+  K++ +APNL  L+G  I A L+SHAG +  LS+     +  +G +K L   L 
Sbjct: 224 IASYISSKVYHIAPNLCALLGSEITALLVSHAGDILQLSQVPNCNLASIGKKKHLSHELH 283

Query: 347 TKGN-TPKYGLIYHSGFIAKASAKNKGRISRYLANKCSMASRID 389
           T  +   + G IY+S  + +    ++ ++ R L  K ++A+R+D
Sbjct: 284 TTASGVRQEGYIYNSELVQETPVGSRKQMLRMLCAKVALAARVD 327

>Kwal_23.3995 s23 complement(517426..518850) [1425 bp, 474 aa] {ON}
           YGR091W (PRP31) - pre-mRNA splicing protein [contig 255]
           FULL
          Length = 474

 Score = 68.6 bits (166), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 55/215 (25%), Positives = 99/215 (46%), Gaps = 2/215 (0%)

Query: 198 YGWHFPELAKLVPDNYKFAQLVLFIKDKASLDEESLHDLASILNDDAGIAERVIDNARIS 257
           Y   FPEL  L+     +AQ+V  + + + ++E +L  L  I++ +  +   +  +    
Sbjct: 111 YERRFPELQSLMTSPKGYAQVVKHL-ETSDINEGNLRGLEDIISKEHFLVLSMAMHTGFK 169

Query: 258 MGQDLSETDMENVCIFAERVVSLADYRRQLYDYLCEKMHTVAPNLSELIGEVIGARLISH 317
               L+  D   V   A+ ++ L D R ++  Y+   +  VAPNL  L+G  I A LI+ 
Sbjct: 170 QDVPLTAEDSRLVIQTADVLLELCDIRDKIERYVASLVSDVAPNLCILVGSQIAASLIAV 229

Query: 318 AGSLTNLSKQAASTVQILGAEKALFRALKTKGN-TPKYGLIYHSGFIAKASAKNKGRISR 376
           AG L+ LS+  +  +  +G  K       T  +   + G IY S  ++      + +  R
Sbjct: 230 AGGLSELSEIPSCNLSSIGKTKNSSHTSDTDASGVRQKGYIYQSDLVSGQPVSFQKQALR 289

Query: 377 YLANKCSMASRIDNYSDEPTNVFGSVLKKQVEQRL 411
            +  K S+ +R D     P+   G+  K+QV ++L
Sbjct: 290 MVCAKVSLCARADRSKSCPSGTLGAKWKEQVLEKL 324

>ZYRO0C12386g Chr3 (978158..979492) [1335 bp, 444 aa] {ON} similar
           to uniprot|P49704 Saccharomyces cerevisiae YGR091W PRP31
           Splicing factor component of the U4/U6-U5 snRNP complex
          Length = 444

 Score = 68.2 bits (165), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 54/227 (23%), Positives = 106/227 (46%), Gaps = 15/227 (6%)

Query: 169 NDNHIIQAIALLDQL----DKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIK- 223
           ND  + Q + +L+ L      +I      +K  YG  F EL  LVP   +FA ++  I+ 
Sbjct: 73  NDEDLAQTLTILNSLTYIAQNEITVLHNLLKLIYGVKFGELESLVPQPQQFADVIRIIET 132

Query: 224 DKASLDEESLHDLASILNDDAGIAERVIDNARISMGQDLSETDMENVCIFAERVVSLADY 283
           ++ + + ++      +L         V++ +  S  Q     D + V    + +++++  
Sbjct: 133 NEGNFETDAQLSKEQVL---------VLNMSMKSSFQAHVNVDKDKVLQLRDLLMTVSRI 183

Query: 284 RRQLYDYLCEKMHTVAPNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFR 343
           R ++  ++  K   VAPNL  LIG  + + L+SH+G +  LS+  +  +  +G  K L  
Sbjct: 184 RNEINSFILSKASLVAPNLCLLIGPEVTSLLLSHSGGVLELSQVPSCNLASIGKNKHLSH 243

Query: 344 ALKTK-GNTPKYGLIYHSGFIAKASAKNKGRISRYLANKCSMASRID 389
            L T      + G IY S  + +   + + ++ R +  K ++A+R+D
Sbjct: 244 ELHTNLTGVRQEGYIYRSSLVQEQPLEFRKQMLRMVCAKVALAARVD 290

>Kpol_1018.138 s1018 complement(368322..369803) [1482 bp, 493 aa]
           {ON} complement(368322..369803) [1482 nt, 494 aa]
          Length = 493

 Score = 65.9 bits (159), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 59/239 (24%), Positives = 111/239 (46%), Gaps = 17/239 (7%)

Query: 183 LDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLDEESLHDL-ASILN 241
           + ++I+ F    K  Y + F EL  L P   +FA+ +  I+   ++D+ S HDL +S L 
Sbjct: 124 IQEEISCFYEYSKHIYKFKFFELETLAPTAVQFAKTIQLIE---TMDDFSQHDLLSSKLE 180

Query: 242 DDAGIAERVIDNARISMGQDLS-----ETDME-NVCIFAERVVSLADYRRQLYDYLCEKM 295
            +  + +  +    I+M   L+     E  M+ ++  F + ++     ++++  ++   +
Sbjct: 181 TEILLTKEQVLVLIIAMKTSLNKEYSFEGSMKTSLKQFTDIIIQHDLLKKEITTFIESNI 240

Query: 296 HTVAPNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTK-GNTPKY 354
            T+APNL  L+G  I + LI HAG +  LS+  +  +  +G  K      +T      + 
Sbjct: 241 ITIAPNLCALVGSEITSLLIGHAGGILELSQIPSCNLASVGKNKYFSHERQTNLSGVRQE 300

Query: 355 GLIYHSGFIAKASAKNKGRISRYLANKCSMASRID------NYSDEPTNVFGSVLKKQV 407
           G IY+S  I         ++ R L  K S+A+R+D        S EP    G   ++++
Sbjct: 301 GYIYNSELIQSQPVDYHKQLLRMLCAKISLAARVDTSVKISTSSTEPAAFLGQKWREEI 359

>TBLA0C02320 Chr3 complement(549057..550592) [1536 bp, 511 aa] {ON}
           Anc_3.429 YGR091W
          Length = 511

 Score = 65.5 bits (158), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 54/251 (21%), Positives = 119/251 (47%), Gaps = 11/251 (4%)

Query: 183 LDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLDEESLHDLASILND 242
           +++DI      VK  Y   FPEL  L+ +  +F  ++  ++   + ++     L   L  
Sbjct: 133 INEDIKLLHSYVKANYQKRFPELESLITNPIQFIDVIRLLESLNNPNKNEESQLEIRLEK 192

Query: 243 DAGIAER----VIDNARISMGQD--LSETDMENVCIFAERVVSLADYRRQLYDYLCEKMH 296
           +  + +     +I + + S  ++   S T   N+   +  +  L  ++ ++  ++ +K+ 
Sbjct: 193 ETTLQKEQILVIIMSVKTSFNKEYQFSNTLRNNLIKASNLISQLWQFKEEINSFVTKKIS 252

Query: 297 TVAPNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTK-GNTPKYG 355
            +APNL  LIG  I + L++++G L NL    +  +  +G  K L   L +      + G
Sbjct: 253 DIAPNLCALIGPYITSLLVAYSGGLANLCSVPSCNLASIGKNKHLSHELHSNLSGVRQNG 312

Query: 356 LIYHSGFIAKASAKNKGRISRYLANKCSMASRID---NYSDEPTNVFGSVLKKQVEQRLE 412
            +Y+S  I    A    ++ R L  K ++ASR+D   + +++ T+  G+  K ++ +++ 
Sbjct: 313 YLYNSELIQSQPANLHKQLLRILCAKVALASRVDAGQSGNNKKTDELGNTWKLEILEKIN 372

Query: 413 FYSTGAPTLKN 423
             +  +P++ N
Sbjct: 373 KLNE-SPSITN 382

>ADR032W Chr4 (763161..764480) [1320 bp, 439 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR091W (PRP31)
          Length = 439

 Score = 64.7 bits (156), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 48/203 (23%), Positives = 93/203 (45%), Gaps = 26/203 (12%)

Query: 202 FPELAKLVPDNYKFAQLVLFIKDKASLDEESLHDLASILNDDAGIAERVIDNARISMGQD 261
           FPELA+LVP    + +++  ++  A LDE    + A ++      A R  D AR      
Sbjct: 93  FPELAELVPSQRTYVRVLRALETGAPLDELLTREQAMLVAMTRPQAPRA-DPAR------ 145

Query: 262 LSETDMENVCIFAERVVSLADYRRQLYD-------YLCEKMHTVAPNLSELIGEVIGARL 314
                      +   +   AD   QL+        ++  + H +AP ++ L+G V+ A L
Sbjct: 146 -----------WPRELAPHADRHEQLHTAVDAIDAHIVRQAHRLAPTVTALVGPVVAAAL 194

Query: 315 ISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKY-GLIYHSGFIAKASAKNKGR 373
           +SHAGS+  L++  A  +  +GA +    A +T  +  +  G ++ +  + +     + +
Sbjct: 195 LSHAGSVRELAQVPACNLAAIGAPRHAAHARRTDASGVRLRGHVWDTPLVQEQPPALQRQ 254

Query: 374 ISRYLANKCSMASRIDNYSDEPT 396
             R L  + ++A+R+D  + +P 
Sbjct: 255 ALRMLCARLALAARVDASAPDPA 277

>NDAI0G01290 Chr7 complement(284145..285635) [1491 bp, 496 aa] {ON}
           Anc_3.429 YGR091W
          Length = 496

 Score = 63.9 bits (154), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 50/199 (25%), Positives = 89/199 (44%), Gaps = 10/199 (5%)

Query: 198 YGWHFPELAKLVPDNYKFAQLVLFIKDKASLDEESLHDLASILNDDAGIAERVIDNARIS 257
           Y   F EL  +     ++A++V   +    L   S  +L ++  ++A + +  I    IS
Sbjct: 131 YSKKFNELDTITSSQLQYARIVKIFESHQDL---SSGELNNLFENEAKLTKEQIIVLNIS 187

Query: 258 MGQD------LSETDMENVCIFAERVVSLADYRRQLYDYLCEKMHTVAPNLSELIGEVIG 311
           M         L     + +    + + +L+  +  +  Y+   +  +APNL  LIG  I 
Sbjct: 188 MKSSFDISFKLDHQKQKEILKSTDMITTLSALQELITHYITSNISHIAPNLCALIGSQIA 247

Query: 312 ARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTK-GNTPKYGLIYHSGFIAKASAKN 370
           A LISHAGS+ +LS+  +  +  +G  K     L T      + G IY    I    ++N
Sbjct: 248 ALLISHAGSILDLSQIPSCNLASIGKSKHQSHELHTSLSGVRQEGYIYDCDLIQDQPSEN 307

Query: 371 KGRISRYLANKCSMASRID 389
             ++ R +  K S+A+R+D
Sbjct: 308 HKQMLRMVCAKASLAARVD 326

>YGR091W Chr7 (666341..667825) [1485 bp, 494 aa] {ON}  PRP31Splicing
           factor, component of the U4/U6-U5 snRNP complex
          Length = 494

 Score = 62.4 bits (150), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 48/199 (24%), Positives = 94/199 (47%), Gaps = 8/199 (4%)

Query: 198 YGWHFPELAKLVPDNYKFAQLVLFIKDKASLDEESLHDLASILNDDAGIAERVIDNARIS 257
           Y   FPEL+ L+P   ++++++  ++++     ES  +L   L + A +    I    +S
Sbjct: 120 YSRRFPELSSLIPSPLQYSKVISILENENYSKNES-DELFFHLENKAKLTREQILVLTMS 178

Query: 258 MGQDLSETDMENV-----CIFAERVV-SLADYRRQLYDYLCEKMHTVAPNLSELIGEVIG 311
           M       +  ++      + A  ++ +L   +  +  Y+  K+  +APN+  L+G  I 
Sbjct: 179 MKTSFKNKEPLDIKTRTQILEANSILENLWKLQEDIGQYIASKISIIAPNVCFLVGPEIA 238

Query: 312 ARLISHAGSLTNLSKQAASTVQILGAEKALFRALKT-KGNTPKYGLIYHSGFIAKASAKN 370
           A+LI+HAG +   S+  +  +  +G  K L   L T +    + G ++ S  I K     
Sbjct: 239 AQLIAHAGGVLEFSRIPSCNIASIGKNKHLSHELHTLESGVRQEGYLFASDMIQKFPVSV 298

Query: 371 KGRISRYLANKCSMASRID 389
             ++ R L  K S+A+R+D
Sbjct: 299 HKQMLRMLCAKVSLAARVD 317

>Skud_7.390 Chr7 (650643..652130) [1488 bp, 495 aa] {ON} YGR091W
           (REAL)
          Length = 495

 Score = 59.7 bits (143), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 47/221 (21%), Positives = 103/221 (46%), Gaps = 12/221 (5%)

Query: 178 ALLDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLDEESLHDLA 237
           A++  +  DI +    +   YG  FPEL+ L+P + +++++   ++ +     ES   L+
Sbjct: 101 AIIPLIKSDIKSLHNFLILLYGKRFPELSSLIPSSLQYSKVASILESEHWSKNES-DKLS 159

Query: 238 SILNDDAGIAERVIDNARISMGQDLSETDMENVCIFAERVVSLAD--------YRRQLYD 289
            +L ++A + +  +    ++M    S  + E + I   + +S A          +  +  
Sbjct: 160 PLLENEANLTKEQV--LVLTMSMKTSFNNKEPLDIGTRKQISEATAMLKNLWVLQEDVGR 217

Query: 290 YLCEKMHTVAPNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKT-K 348
           Y+  K+  +APN+  L+G  + A+L+++AG +   S+  +  +  +G  K L   L T  
Sbjct: 218 YVASKISVIAPNMCLLVGPEVAAQLLAYAGGVLEFSRIPSCNIASIGKNKHLSHELHTLA 277

Query: 349 GNTPKYGLIYHSGFIAKASAKNKGRISRYLANKCSMASRID 389
               + G I+ +  I         ++ R +  K ++A+R+D
Sbjct: 278 SGVRQEGYIFSTDLIQNFPLAIHKQMLRMICAKVTLAARVD 318

>NCAS0E01160 Chr5 complement(219669..221108) [1440 bp, 479 aa] {ON}
           Anc_3.429 YGR091W
          Length = 479

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 51/254 (20%), Positives = 115/254 (45%), Gaps = 13/254 (5%)

Query: 179 LLDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLDEESLHDLAS 238
           L  Q+ ++I+      K  Y   F EL  +    Y++A++   I+  +   ++    L  
Sbjct: 118 LSHQIRREIDILYQYSKNIYSTRFTELDTIAATPYQYAKVTSLIEGTS---DDKAGQLPI 174

Query: 239 ILNDDAGIAERVIDNARISMGQDLS-----ETDMENVCIFA-ERVVSLADYRRQLYDYLC 292
            +  +A +++  +   R+SM          E  ++++ + A   ++ L D +  +  Y+ 
Sbjct: 175 NIEIEAKLSKEQVLVLRMSMQTSFLKNKPLEKKVKHLLLEACSMIIQLTDLQNVILQYIS 234

Query: 293 EKMHTVAPNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTK-GNT 351
             +  +APNL  L+G  + + LI+H G +  L++  +  +  +G  + L   L T     
Sbjct: 235 SNVSDIAPNLCVLVGPEVASLLIAHTGGILQLAEIPSCNLASIGKNRHLSHELHTTLSGV 294

Query: 352 PKYGLIYHSGFIAKASAKNKGRISRYLANKCSMASRID--NYSDEPTNVFGSVLKKQVEQ 409
            + G IY S  +     +N  ++ R +  K ++A+R+D         ++ G   ++++E 
Sbjct: 295 RQEGYIYSSELVQNQPIQNHKQMLRMVCAKVALAARVDAGQRGAAKNDLLGQRWREELET 354

Query: 410 RLEFYSTGAPTLKN 423
           +++   T +P + N
Sbjct: 355 KIQ-KVTESPNISN 367

>Ecym_4449 Chr4 complement(919492..920880) [1389 bp, 462 aa] {ON}
           similar to Ashbya gossypii ADR032W
          Length = 462

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 49/208 (23%), Positives = 95/208 (45%), Gaps = 14/208 (6%)

Query: 198 YGWHFPELAKLVPDNYKFAQLVLFIKDKASLDEESLHDLASILNDDAGIAERVIDNARIS 257
           Y   FPEL  +V +  K+  +V  ++ +  + E     L  +LN +    + ++ +  + 
Sbjct: 101 YNKRFPELPNVVSEQEKYVSVVKELEARPDVPE-----LGKLLNKE----QMLLVSMTMQ 151

Query: 258 MG-QDLSETDMENVCIFAERVVSLADYRRQLYDYLCEKMHTVAPNLSELIGEVIGARLIS 316
            G     + D   +    ++   L   +  +  Y+ +KMHT+APN+  L+G+ + A L++
Sbjct: 152 TGFHKEYKVDSPVIAELIDQYEVLHALKSDITTYISKKMHTIAPNVCALVGQEVAAALLT 211

Query: 317 HAGSLTNLSKQAASTVQILGAEKAL--FRALKTKGNTPKYGLIYHSGFIAKASAKNKGRI 374
           + G +  LS+  +  +  +G  K L   + L T G   K G I+    +       + + 
Sbjct: 212 YTGGMKELSEIPSCNLASIGKTKHLSHVQQLDTSGVRQK-GYIFDCELVQSQPEALQKQA 270

Query: 375 SRYLANKCSMASRIDNYSDEPTNVFGSV 402
            R +  K ++ASR+D Y     N  GS+
Sbjct: 271 LRMICAKLALASRVD-YLHHQENTHGSL 297

>Suva_7.374 Chr7 (641967..643508) [1542 bp, 513 aa] {ON} YGR091W
           (REAL)
          Length = 513

 Score = 57.0 bits (136), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 45/200 (22%), Positives = 98/200 (49%), Gaps = 10/200 (5%)

Query: 198 YGWHFPELAKLVPDNYKFAQLVLFIKDKASLDEESLHDLASI-LNDDAGIAERVIDNARI 256
           Y   FPEL+ L+P   +++++V  ++++     ES  D  SI L + A + +  +    +
Sbjct: 139 YKERFPELSSLIPSPLQYSKVVTILENENWSGNES--DKLSIHLENKANLTKEQLLVLTM 196

Query: 257 SMGQDLSET-----DMENVCIFAERVVS-LADYRRQLYDYLCEKMHTVAPNLSELIGEVI 310
           S+    +       D + +   A  +++ L + ++ +  Y+  K+  +APN+  L+G  +
Sbjct: 197 SLKTSFNNQKPLVGDTKKLVFEAGSMLNNLWELQKDVGQYITSKISLIAPNMCFLVGSEV 256

Query: 311 GARLISHAGSLTNLSKQAASTVQILGAEKALFRALKT-KGNTPKYGLIYHSGFIAKASAK 369
            A+L++HAG +   S+  +  +  +G  K L   L T +    + G ++++  I      
Sbjct: 257 TAQLLAHAGGVLEFSRIPSCNIASIGKNKHLSHELHTLESGVRQEGYLFNTELIQDFPIA 316

Query: 370 NKGRISRYLANKCSMASRID 389
              ++ R L  K ++A+R+D
Sbjct: 317 IHRQMLRILCAKVTLAARVD 336

>SAKL0F06050g Chr6 (454404..455825) [1422 bp, 473 aa] {ON} similar
           to uniprot|P49704 Saccharomyces cerevisiae YGR091W PRP31
           Splicing factor component of the U4/U6-U5 snRNP complex
          Length = 473

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 45/221 (20%), Positives = 100/221 (45%), Gaps = 9/221 (4%)

Query: 194 VKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLDEESLHDLASILNDDAGIAERVIDN 253
           +K  Y   F EL  LV     +++L+ F++   + D   L  L  IL+ +  +   V  +
Sbjct: 113 IKSLYSKKFSELDSLVNPPRSYSKLIKFLE---TSDARDLSTLEGILSKEQILI--VSMS 167

Query: 254 ARISMGQDLSETDMENVCIFA--ERVVSLADYRRQLYDYLCEKMHTVAPNLSELIGEVIG 311
            +    +DL+    E   +    + ++ L D + ++  ++  ++  +APN+  ++G  + 
Sbjct: 168 MKTGFKRDLALPSDEKTYLLTAIDMLIQLYDLQDEITSFIASQVINIAPNVCAIVGPQVA 227

Query: 312 ARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTK-GNTPKYGLIYHSGFIAKASAKN 370
           ++++S AG L  LS+  +  +  +G ++ +   + T      + G +Y    I       
Sbjct: 228 SKILSAAGGLLELSQVPSCNLASIGKDRYMSHEINTDMSGVRQRGYVYSCSLIQDQPPHV 287

Query: 371 KGRISRYLANKCSMASRIDNYSDEPTNVFGSVLKKQVEQRL 411
             +  R +  K S+A+R+D  S+   N  G     ++ ++L
Sbjct: 288 HKQALRMVCAKVSLAARVD-ISNNKDNSLGVKWANEISEKL 327

>Smik_6.177 Chr6 (289760..291208) [1449 bp, 482 aa] {ON} YGR091W
           (REAL)
          Length = 482

 Score = 53.9 bits (128), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 44/209 (21%), Positives = 95/209 (45%), Gaps = 11/209 (5%)

Query: 198 YGWHFPELAKLVPDNYKFAQLVLFIKDKASLDEESLHDLASILNDDAGIAERVIDNARIS 257
           Y   FPEL+ L+P   +++++++ ++ +    +  +  L   L + A +++  +    +S
Sbjct: 120 YKERFPELSTLIPSPLQYSKVIILLEGE-DWQKSEIDKLFPQLENIAHLSKEQVLVLTMS 178

Query: 258 MGQDLSETDMEN----VCIFAERVV--SLADYRRQLYDYLCEKMHTVAPNLSELIGEVIG 311
           M       +  N      I     +  +L   +  L  Y+  K+  +APN+  L+G  + 
Sbjct: 179 MRTSFKSKEPLNFQTRTQILETNTILENLWQIQADLEQYIASKISLIAPNMCFLVGSEVT 238

Query: 312 ARLISHAGSLTNLSKQAASTVQILGAEKALFRALKT-KGNTPKYGLIYHSGFIAKASAKN 370
           A+L+++AG +   S+  +  +  +G  K L   L T +    + G ++ +  I       
Sbjct: 239 AQLLAYAGGVLEFSRIPSCNIASIGKNKHLSHELHTLESGVRQEGYLFTTDLIQSFPVAI 298

Query: 371 KGRISRYLANKCSMASRID---NYSDEPT 396
             ++ R L  K ++A+R+D    Y D+ T
Sbjct: 299 HKQMLRMLCAKVTLAARVDAGQRYDDKNT 327

>CAGL0G03025g Chr7 (280230..281669) [1440 bp, 479 aa] {ON} similar
           to uniprot|P49704 Saccharomyces cerevisiae YGR091w PRP31
           pre-mRNA splicing protein
          Length = 479

 Score = 50.1 bits (118), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 51/258 (19%), Positives = 114/258 (44%), Gaps = 16/258 (6%)

Query: 164 FSVQKNDNHIIQAIALLDQLDKDINTFA-MRVKEWYGWHFPELAKLVPDNYKFAQLVLFI 222
            ++  N+  II+ +  + Q  K I+      + E Y   F EL  ++   +++AQ +  +
Sbjct: 100 IAISSNEPEIIKTLNEIQQYCKVISEKCYFELTEIYEDKFSELKSILRLPHQYAQCISLL 159

Query: 223 KDKASLDEESLHDLASILNDDAGIAERVIDNARISMGQD------LSETDMENVCIFAER 276
           +    L++  L        +    +  +I    +S+  D      L++T+ +++      
Sbjct: 160 EQGLELEQVVLR-----FEELCSTSRELIMVLNMSLRADYKGNYKLTDTNKKSLHKLTSI 214

Query: 277 VVSLADYRRQLYDYLCEKMHTVAPNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILG 336
           +    D  R +   +  ++  +APNL  L+G    + L+SH G L  LSK  +  +  +G
Sbjct: 215 IFEAHDIIRFVSVEIANRIGEIAPNLCALLGTNTASLLVSHTGGLLQLSKIPSCNIANIG 274

Query: 337 AEKALFRALKTKGNTPKYGLIYHSGFIAKASAKNKGRISRYLANKCSMASRIDN--YSDE 394
            +      +    N    G I+ +  +     +N  ++ R L++K S+A+R+D    + +
Sbjct: 275 KKNTKDHNILNFSNPG--GYIFQNELVQNQPIENHKQMMRMLSSKVSLAARVDAGLKTGD 332

Query: 395 PTNVFGSVLKKQVEQRLE 412
             N  G   + ++E++++
Sbjct: 333 KNNKLGKQWRVEIEEKIK 350

>KLLA0D14883g Chr4 (1254381..1255784) [1404 bp, 467 aa] {ON} weakly
           similar to uniprot|P49704 Saccharomyces cerevisiae
           YGR091W PRP31 Splicing factor component of the U4/U6-U5
           snRNP complex
          Length = 467

 Score = 50.1 bits (118), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 45/222 (20%), Positives = 101/222 (45%), Gaps = 16/222 (7%)

Query: 172 HIIQAIALLDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLDEE 231
           ++I+   L+   D +++     + + Y   FP L  +VP+  ++  +V  ++        
Sbjct: 88  NVIKLGQLMPLFDTELSMVFQCIVDTYKAKFPGLETIVPERKQYVDVVKMLQ-------- 139

Query: 232 SLHDLASILNDDAGIAERVIDNARISMGQDLSETDMENVCIFAERVVS---LADYRRQLY 288
              D+ ++  D     E  +    +S+  D  E    +  + ++ +     L + R  + 
Sbjct: 140 --QDIPNVQLDQVLSKEETL-VVSMSLKTDFKEGARIDKDLLSKAIHWFDILYNLRDNVS 196

Query: 289 DYLCEKMHTVAPNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALF-RALKT 347
            Y+  ++  VAPNL  L+G    A+L++H GS+  LS   +  +  +G +K L  ++L  
Sbjct: 197 HYVETRIQMVAPNLCALLGPDTAAKLVTHCGSVKELSVVPSCNLASIGQDKTLHGKSLDI 256

Query: 348 KGNTPKYGLIYHSGFIAKASAKNKGRISRYLANKCSMASRID 389
            G   K G ++++  +     + + +  R ++ K ++A+R D
Sbjct: 257 SGVRQK-GYLFYTDVVQTQPPEFQKQALRMVSAKVALAARAD 297

>KLTH0F12034g Chr6 complement(1015072..1016646) [1575 bp, 524 aa]
           {ON} weakly similar to uniprot|P49704 Saccharomyces
           cerevisiae YGR091W PRP31 Splicing factor component of
           the U4/U6-U5 snRNP complex
          Length = 524

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 61/256 (23%), Positives = 107/256 (41%), Gaps = 13/256 (5%)

Query: 173 IIQAIALLDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLDEES 232
           I Q ++LL +L   I          Y   FPEL  L+     +A++V  ++ K     E 
Sbjct: 139 IQQEVSLLRKLIASI----------YDQKFPELESLIASANSYAKVVRLLETKGGGKLE- 187

Query: 233 LHDLASILNDDAGIAERVIDNARISMGQDLSETDMENVCIFAERVVSLADYRRQLYDYLC 292
           L +L   ++ +  +   +  +       +L+  D E +      ++ L D +  +  Y+ 
Sbjct: 188 LQELQDTISREQLLVLSMAMHTGFRQETNLAPKDSELLMDSINVLLELCDLQDSIAQYVA 247

Query: 293 EKMHTVAPNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALK-TKGNT 351
             +  VAPNL  L+G    A LI+ AG L  LS+  +  +  +G  K +   L   +   
Sbjct: 248 SLISQVAPNLCALVGPATSAALIAAAGGLLELSEMPSCNLASIGNSKRISSELDFHESGV 307

Query: 352 PKYGLIYHSGFIAKASAKNKGRISRYLANKCSMASRIDNYSDEPTNVFGSVLKKQVEQRL 411
            + G IYHS  ++      + +  R +  K S+  R+D   + P    G   ++ V +RL
Sbjct: 308 RQRGHIYHSSLVSGQPVTIQKQALRMVCAKVSLCVRVDVSKNSPGGELGLKWRQDVLKRL 367

Query: 412 EFYSTGAPTLKNELAI 427
                  P L N  A+
Sbjct: 368 RGL-LDPPNLSNTKAL 382

>Kpol_1001.6 s1001 complement(20699..25147) [4449 bp, 1482 aa] {ON}
           complement(20699..25147) [4449 nt, 1483 aa]
          Length = 1482

 Score = 31.6 bits (70), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 33/133 (24%), Positives = 63/133 (47%), Gaps = 15/133 (11%)

Query: 1   MAPIEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQQQINDFGSFTKLVEL-VSFAPFKGA 59
           MA    +L E   GYGI  + L++  +GS+   ++    +  S   + EL +SFA F  +
Sbjct: 271 MAQANPILAESAPGYGIDSLSLEEFTLGSKAPAIRSIKTNSKSGKDITELELSFA-FTPS 329

Query: 60  AQALENANDISEGLVSEHL--KALLDLNLPKGSAKSTVTLAISDKNLGPSIK------ET 111
                + +D++   V E +  + +L + L K     TV + + D N+   ++      +T
Sbjct: 330 -----DVSDMTPREVREKVNPRIVLGVTLGKSFVSKTVPIIVEDINVSGRVRLITKFGQT 384

Query: 112 FPYVDCISNELAQ 124
           FP +  +S +L +
Sbjct: 385 FPNIKTVSVQLLE 397

>Skud_8.138 Chr8 (230301..231959) [1659 bp, 552 aa] {ON} YHR078W
           (REAL)
          Length = 552

 Score = 31.2 bits (69), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 39/79 (49%), Gaps = 8/79 (10%)

Query: 134 GDKLLKDLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALLDQLDKDIN----T 189
            D  L+++ S D  ++ L    AY   K+    Q  +++I Q + +L QL+K+ N    T
Sbjct: 230 SDPSLRNINSNDNSKSLLWTTDAYMEEKI----QDYEHNIEQNVQILTQLEKESNVENST 285

Query: 190 FAMRVKEWYGWHFPELAKL 208
           F   + E   W+  EL KL
Sbjct: 286 FRAELLEKIAWYQLELGKL 304

>YCL014W Chr3 (96281..101191) [4911 bp, 1636 aa] {ON}  BUD3Protein
           involved in bud-site selection and required for axial
           budding pattern; localizes with septins to bud neck in
           mitosis and may constitute an axial landmark for next
           round of budding
          Length = 1636

 Score = 30.8 bits (68), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 43/87 (49%), Gaps = 3/87 (3%)

Query: 159 RAKVKFSVQKNDNHIIQAIALLDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQL 218
           R K +   +K  N+II  I    +LD  +++++ RV    G    ELAK  P   ++  L
Sbjct: 420 RPKNQEMAKKCYNNIIDVIDSFGKLDSPLHSYSTRVFTPSGKILTELAKCWPVELQYKWL 479

Query: 219 ---VLFIKDKASLDEESLHDLASILND 242
              V+ + D   L++E+  +L  I +D
Sbjct: 480 KRRVVGVYDVVDLNDENKRNLLVIFSD 506

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.134    0.374 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 43,526,357
Number of extensions: 1810017
Number of successful extensions: 5760
Number of sequences better than 10.0: 78
Number of HSP's gapped: 5923
Number of HSP's successfully gapped: 78
Length of query: 498
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 384
Effective length of database: 40,409,475
Effective search space: 15517238400
Effective search space used: 15517238400
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)