Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0F11418g7.352ON1151155081e-67
KLTH0H01210g7.352ON113913511e-43
Kwal_56.246487.352ON113923483e-43
KAFR0L014907.352ON107893398e-42
KLLA0D12298g7.352ON115923353e-41
NCAS0E028607.352ON105953265e-40
ACL146C7.352ON107923241e-39
NDAI0E044607.352ON106903127e-38
Skud_12.2647.352ON114953121e-37
Suva_10.2957.352ON114953102e-37
TPHA0F029907.352ON107893093e-37
Smik_12.2597.352ON114893075e-37
KNAG0B026107.352ON119863077e-37
TBLA0E004407.352ON115943069e-37
ZYRO0F11748g7.352ON109873042e-36
TDEL0C019607.352ON107873014e-36
Ecym_47217.352ON107922999e-36
YLR200W (YKE2)7.352ON114952999e-36
CAGL0A03971g7.352ON106872944e-35
Kpol_530.297.352ON107892921e-34
TDEL0F045108.326ON74348642.2
SAKL0H24200g4.46ON96347642.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0F11418g
         (115 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0F11418g Chr6 complement(887825..888172) [348 bp, 115 aa] {O...   200   1e-67
KLTH0H01210g Chr8 (119243..119584) [342 bp, 113 aa] {ON} similar...   139   1e-43
Kwal_56.24648 s56 complement(1088138..1088479) [342 bp, 113 aa] ...   138   3e-43
KAFR0L01490 Chr12 complement(275355..275678) [324 bp, 107 aa] {O...   135   8e-42
KLLA0D12298g Chr4 (1048089..1048436) [348 bp, 115 aa] {ON} simil...   133   3e-41
NCAS0E02860 Chr5 (561551..561868) [318 bp, 105 aa] {ON} Anc_7.35...   130   5e-40
ACL146C Chr3 complement(93269..93592) [324 bp, 107 aa] {ON} Synt...   129   1e-39
NDAI0E04460 Chr5 (1005674..1005994) [321 bp, 106 aa] {ON} Anc_7....   124   7e-38
Skud_12.264 Chr12 (495654..495998) [345 bp, 114 aa] {ON} YLR200W...   124   1e-37
Suva_10.295 Chr10 (521814..522158) [345 bp, 114 aa] {ON} YLR200W...   124   2e-37
TPHA0F02990 Chr6 complement(656466..656789) [324 bp, 107 aa] {ON...   123   3e-37
Smik_12.259 Chr12 (496033..496377) [345 bp, 114 aa] {ON} YLR200W...   122   5e-37
KNAG0B02610 Chr2 (507118..507477) [360 bp, 119 aa] {ON} Anc_7.35...   122   7e-37
TBLA0E00440 Chr5 (82880..83227) [348 bp, 115 aa] {ON} Anc_7.352 ...   122   9e-37
ZYRO0F11748g Chr6 complement(960734..961063) [330 bp, 109 aa] {O...   121   2e-36
TDEL0C01960 Chr3 (343261..343584) [324 bp, 107 aa] {ON} Anc_7.35...   120   4e-36
Ecym_4721 Chr4 (1413362..1413685) [324 bp, 107 aa] {ON} similar ...   119   9e-36
YLR200W Chr12 (549012..549356) [345 bp, 114 aa] {ON}  YKE2Subuni...   119   9e-36
CAGL0A03971g Chr1 complement(400291..400611) [321 bp, 106 aa] {O...   117   4e-35
Kpol_530.29 s530 (74361..74684) [324 bp, 107 aa] {ON} (74361..74...   117   1e-34
TDEL0F04510 Chr6 complement(846575..848806) [2232 bp, 743 aa] {O...    29   2.2  
SAKL0H24200g Chr8 complement(2086545..2089436) [2892 bp, 963 aa]...    29   2.3  

>SAKL0F11418g Chr6 complement(887825..888172) [348 bp, 115 aa] {ON}
           similar to uniprot|P52553 Saccharomyces cerevisiae
           YLR200W YKE2 Yeast nuclear gene
          Length = 115

 Score =  200 bits (508), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 103/115 (89%), Positives = 103/115 (89%)

Query: 1   MAELNAQKLSMQYTTMQSELEDLVIARQKLETQLQENKIVQDEFDTLRDESQVYKLTGGV 60
           MAELNAQKLSMQYTTMQSELEDLVIARQKLETQLQENKIVQDEFDTLRDESQVYKLTGGV
Sbjct: 1   MAELNAQKLSMQYTTMQSELEDLVIARQKLETQLQENKIVQDEFDTLRDESQVYKLTGGV 60

Query: 61  LLPVEQEEAKGNVEKRLQFIKNEITRCEENIKEKQTQXXXXXXXXXXXXTAKLPV 115
           LLPVEQEEAKGNVEKRLQFIKNEITRCEENIKEKQTQ            TAKLPV
Sbjct: 61  LLPVEQEEAKGNVEKRLQFIKNEITRCEENIKEKQTQLERLRNELVRLRTAKLPV 115

>KLTH0H01210g Chr8 (119243..119584) [342 bp, 113 aa] {ON} similar
          to uniprot|P52553 Saccharomyces cerevisiae YLR200W YKE2
          Yeast nuclear gene
          Length = 113

 Score =  139 bits (351), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 71/91 (78%), Positives = 77/91 (84%)

Query: 5  NAQKLSMQYTTMQSELEDLVIARQKLETQLQENKIVQDEFDTLRDESQVYKLTGGVLLPV 64
          +AQ L+M Y T Q ELE+LVIARQKLETQLQENKIVQDEFD LR+E+QVYKLTG VLLPV
Sbjct: 4  SAQDLTMNYNTSQHELEELVIARQKLETQLQENKIVQDEFDGLREETQVYKLTGNVLLPV 63

Query: 65 EQEEAKGNVEKRLQFIKNEITRCEENIKEKQ 95
          EQ EAK NV KRL+FI  EI RCEENIK KQ
Sbjct: 64 EQFEAKSNVSKRLEFITAEINRCEENIKTKQ 94

>Kwal_56.24648 s56 complement(1088138..1088479) [342 bp, 113 aa]
          {ON} YLR200W (YKE2) - Polypeptide 6 of a Yeast
          Non-native Actin Binding Complex, homolog of a
          component of the bovine NABC complex [contig 161] FULL
          Length = 113

 Score =  138 bits (348), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 68/92 (73%), Positives = 80/92 (86%)

Query: 5  NAQKLSMQYTTMQSELEDLVIARQKLETQLQENKIVQDEFDTLRDESQVYKLTGGVLLPV 64
          +AQ+L+M YTT Q ELE+LV ARQ+LETQLQENKIVQDEFD+L++E+QVYKLTG VLLPV
Sbjct: 4  SAQELTMNYTTAQQELEELVTARQRLETQLQENKIVQDEFDSLKEETQVYKLTGKVLLPV 63

Query: 65 EQEEAKGNVEKRLQFIKNEITRCEENIKEKQT 96
          EQ EAK NV KRL+FI  EI RCE+NIK KQ+
Sbjct: 64 EQFEAKSNVSKRLEFINTEIKRCEDNIKNKQS 95

>KAFR0L01490 Chr12 complement(275355..275678) [324 bp, 107 aa]
          {ON} Anc_7.352 YLR200W
          Length = 107

 Score =  135 bits (339), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 64/89 (71%), Positives = 80/89 (89%)

Query: 9  LSMQYTTMQSELEDLVIARQKLETQLQENKIVQDEFDTLRDESQVYKLTGGVLLPVEQEE 68
          L+ QY  +QSELE+L++ARQKLETQLQENKIV DEF +L++E+QVYKLTG VLLP+EQ+E
Sbjct: 4  LAAQYQKLQSELEELIVARQKLETQLQENKIVNDEFKSLKEETQVYKLTGNVLLPIEQDE 63

Query: 69 AKGNVEKRLQFIKNEITRCEENIKEKQTQ 97
          A+GNV+KRL+FI+ EITRCE NIK KQT+
Sbjct: 64 ARGNVDKRLEFIEKEITRCEGNIKSKQTE 92

>KLLA0D12298g Chr4 (1048089..1048436) [348 bp, 115 aa] {ON}
          similar to uniprot|P52553 Saccharomyces cerevisiae
          YLR200W YKE2 Yeast nuclear gene
          Length = 115

 Score =  133 bits (335), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 64/92 (69%), Positives = 80/92 (86%)

Query: 4  LNAQKLSMQYTTMQSELEDLVIARQKLETQLQENKIVQDEFDTLRDESQVYKLTGGVLLP 63
          ++A++ + +YT +Q ELE+L++ARQKLETQLQENKIV DEF +L+D++ VYKLTGGVLLP
Sbjct: 1  MSAEETTQKYTKLQGELEELIVARQKLETQLQENKIVSDEFSSLKDDATVYKLTGGVLLP 60

Query: 64 VEQEEAKGNVEKRLQFIKNEITRCEENIKEKQ 95
          VEQ EAKGNVEKRL+FI+ EI RCE NIK KQ
Sbjct: 61 VEQFEAKGNVEKRLEFIEIEIKRCETNIKSKQ 92

>NCAS0E02860 Chr5 (561551..561868) [318 bp, 105 aa] {ON} Anc_7.352
          YLR200W
          Length = 105

 Score =  130 bits (326), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 66/95 (69%), Positives = 81/95 (85%), Gaps = 5/95 (5%)

Query: 1  MAELNAQKLSMQYTTMQSELEDLVIARQKLETQLQENKIVQDEFDTLRDESQVYKLTGGV 60
          MA+L AQ     Y ++QSELE  +IARQKLETQLQENKIV DEF+ L DE++VYKLTG V
Sbjct: 1  MADLPAQ-----YQSLQSELESFIIARQKLETQLQENKIVMDEFEQLVDETKVYKLTGNV 55

Query: 61 LLPVEQEEAKGNVEKRLQFIKNEITRCEENIKEKQ 95
          LLPVEQ+EA+ NVEKRL+FI++EIT+CE+NIK+KQ
Sbjct: 56 LLPVEQDEARSNVEKRLEFIQSEITKCEKNIKQKQ 90

>ACL146C Chr3 complement(93269..93592) [324 bp, 107 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YLR200W
          (YKE2)
          Length = 107

 Score =  129 bits (324), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 62/92 (67%), Positives = 80/92 (86%)

Query: 4  LNAQKLSMQYTTMQSELEDLVIARQKLETQLQENKIVQDEFDTLRDESQVYKLTGGVLLP 63
          ++A++++ +YT +Q ELE+LV+ RQKLETQLQENKIV +E   L+ E+QVYKLTGGVLLP
Sbjct: 1  MSAEQVATKYTQLQGELEELVVTRQKLETQLQENKIVNEELQALQPETQVYKLTGGVLLP 60

Query: 64 VEQEEAKGNVEKRLQFIKNEITRCEENIKEKQ 95
          VEQEEA+GNV KRL+FI+ EI RCE+NIK+KQ
Sbjct: 61 VEQEEAEGNVSKRLEFIEGEIRRCEQNIKQKQ 92

>NDAI0E04460 Chr5 (1005674..1005994) [321 bp, 106 aa] {ON}
          Anc_7.352 YLR200W
          Length = 106

 Score =  124 bits (312), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 62/90 (68%), Positives = 73/90 (81%)

Query: 6  AQKLSMQYTTMQSELEDLVIARQKLETQLQENKIVQDEFDTLRDESQVYKLTGGVLLPVE 65
          A  L  +Y  +Q ELEDL++ARQKLETQLQENKIV +EF+ L  ESQVYKLTG VLLPV+
Sbjct: 2  ASNLPSKYQVLQGELEDLIMARQKLETQLQENKIVIEEFNQLPSESQVYKLTGNVLLPVD 61

Query: 66 QEEAKGNVEKRLQFIKNEITRCEENIKEKQ 95
          QEEA  NV+KRL+FI+ EI+RCE NIK KQ
Sbjct: 62 QEEAHSNVDKRLEFIQTEISRCENNIKNKQ 91

>Skud_12.264 Chr12 (495654..495998) [345 bp, 114 aa] {ON} YLR200W
          (REAL)
          Length = 114

 Score =  124 bits (312), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 62/95 (65%), Positives = 77/95 (81%), Gaps = 5/95 (5%)

Query: 1  MAELNAQKLSMQYTTMQSELEDLVIARQKLETQLQENKIVQDEFDTLRDESQVYKLTGGV 60
          M+EL A+     Y  +QSELE+ ++ARQKLETQLQENKIV +EFD + D++ VYKLTG V
Sbjct: 1  MSELGAE-----YQHLQSELEEFIVARQKLETQLQENKIVNEEFDQIGDDTPVYKLTGNV 55

Query: 61 LLPVEQEEAKGNVEKRLQFIKNEITRCEENIKEKQ 95
          LLPVEQ EA+GNV+KRL+FI+ EI RCE NI+EKQ
Sbjct: 56 LLPVEQSEARGNVDKRLEFIETEIKRCERNIREKQ 90

>Suva_10.295 Chr10 (521814..522158) [345 bp, 114 aa] {ON} YLR200W
          (REAL)
          Length = 114

 Score =  124 bits (310), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 62/95 (65%), Positives = 78/95 (82%), Gaps = 5/95 (5%)

Query: 1  MAELNAQKLSMQYTTMQSELEDLVIARQKLETQLQENKIVQDEFDTLRDESQVYKLTGGV 60
          M+EL A+     Y  +QSELE+ ++ARQKLETQLQENKIV +EFD L++++ VYKLTG V
Sbjct: 1  MSELGAK-----YQHLQSELEEFIVARQKLETQLQENKIVNEEFDQLKEDTPVYKLTGNV 55

Query: 61 LLPVEQEEAKGNVEKRLQFIKNEITRCEENIKEKQ 95
          LLPVEQ EA+GNVEKRL+FI+ EI RCE+NI+ KQ
Sbjct: 56 LLPVEQSEARGNVEKRLEFIETEIKRCEKNIRGKQ 90

>TPHA0F02990 Chr6 complement(656466..656789) [324 bp, 107 aa] {ON}
          Anc_7.352 YLR200W
          Length = 107

 Score =  123 bits (309), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 59/89 (66%), Positives = 76/89 (85%)

Query: 9  LSMQYTTMQSELEDLVIARQKLETQLQENKIVQDEFDTLRDESQVYKLTGGVLLPVEQEE 68
          ++ +Y ++Q ELE+L+IARQKLETQLQENKIV DEF+ L +++ +YKLTG V+LP+EQ E
Sbjct: 4  VAAKYQSVQGELEELIIARQKLETQLQENKIVNDEFNDLNEDTPIYKLTGNVMLPIEQFE 63

Query: 69 AKGNVEKRLQFIKNEITRCEENIKEKQTQ 97
          AK NVEKRL+FI+NEI RCEENIK KQ +
Sbjct: 64 AKSNVEKRLEFIENEIKRCEENIKTKQDE 92

>Smik_12.259 Chr12 (496033..496377) [345 bp, 114 aa] {ON} YLR200W
          (REAL)
          Length = 114

 Score =  122 bits (307), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 59/89 (66%), Positives = 74/89 (83%)

Query: 9  LSMQYTTMQSELEDLVIARQKLETQLQENKIVQDEFDTLRDESQVYKLTGGVLLPVEQEE 68
          L  +Y  +Q ELE+ ++ARQKLETQLQENKIV +EFD L + + VYKLTG VLLPV+Q E
Sbjct: 4  LGTKYQHLQGELEEFIVARQKLETQLQENKIVNEEFDQLEENTPVYKLTGNVLLPVDQSE 63

Query: 69 AKGNVEKRLQFIKNEITRCEENIKEKQTQ 97
          A+GNV+KRL+FI+ EITRCE+NIK+KQ Q
Sbjct: 64 ARGNVDKRLEFIEAEITRCEKNIKDKQEQ 92

>KNAG0B02610 Chr2 (507118..507477) [360 bp, 119 aa] {ON} Anc_7.352
          YLR200W
          Length = 119

 Score =  122 bits (307), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 59/86 (68%), Positives = 74/86 (86%)

Query: 10 SMQYTTMQSELEDLVIARQKLETQLQENKIVQDEFDTLRDESQVYKLTGGVLLPVEQEEA 69
          + +Y   QS LE+L++ARQKLETQLQENKIV +EFD L+++S+VYKLTG VLLPV+Q+EA
Sbjct: 5  AAKYQKAQSALEELIVARQKLETQLQENKIVIEEFDALKEDSKVYKLTGSVLLPVDQDEA 64

Query: 70 KGNVEKRLQFIKNEITRCEENIKEKQ 95
          + NV+KRL+FI  EI RCEENIKEKQ
Sbjct: 65 RTNVDKRLEFINGEIDRCEENIKEKQ 90

>TBLA0E00440 Chr5 (82880..83227) [348 bp, 115 aa] {ON} Anc_7.352
          YLR200W
          Length = 115

 Score =  122 bits (306), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 55/94 (58%), Positives = 79/94 (84%)

Query: 4  LNAQKLSMQYTTMQSELEDLVIARQKLETQLQENKIVQDEFDTLRDESQVYKLTGGVLLP 63
          +++ +L+ +Y T Q+ELE  ++ RQKLETQLQENKIV DEF+ L++E++V+KLTG VLLP
Sbjct: 1  MSSNELATKYQTFQNELEGFIVTRQKLETQLQENKIVNDEFEKLKEETKVFKLTGNVLLP 60

Query: 64 VEQEEAKGNVEKRLQFIKNEITRCEENIKEKQTQ 97
          +EQ+EA+ N++KRL+FI+ EI RCE+NIK KQ +
Sbjct: 61 IEQDEARSNIDKRLEFIQTEIDRCEKNIKAKQAE 94

>ZYRO0F11748g Chr6 complement(960734..961063) [330 bp, 109 aa]
          {ON} highly similar to uniprot|P52553 Saccharomyces
          cerevisiae YLR200W YKE2 Yeast nuclear gene
          Length = 109

 Score =  121 bits (304), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 58/87 (66%), Positives = 72/87 (82%)

Query: 9  LSMQYTTMQSELEDLVIARQKLETQLQENKIVQDEFDTLRDESQVYKLTGGVLLPVEQEE 68
          L+ QY  +Q ELE+ ++ARQKLETQLQENKIV DEF+ L+ +S+VYKLTG VLLPVEQ++
Sbjct: 4  LAAQYQKLQGELENFIVARQKLETQLQENKIVDDEFNGLKSDSKVYKLTGNVLLPVEQDD 63

Query: 69 AKGNVEKRLQFIKNEITRCEENIKEKQ 95
          A+ NV KRL+FI+ EI RCE NIK KQ
Sbjct: 64 ARTNVSKRLEFIQTEIDRCENNIKGKQ 90

>TDEL0C01960 Chr3 (343261..343584) [324 bp, 107 aa] {ON} Anc_7.352
          YLR200W
          Length = 107

 Score =  120 bits (301), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 60/87 (68%), Positives = 70/87 (80%)

Query: 9  LSMQYTTMQSELEDLVIARQKLETQLQENKIVQDEFDTLRDESQVYKLTGGVLLPVEQEE 68
          L+  Y  +QSELE LVIARQKLETQLQENKIV +EF  L++++QVYKLTG VLLPVEQ E
Sbjct: 4  LAAAYQALQSELEVLVIARQKLETQLQENKIVSEEFSELKEDTQVYKLTGNVLLPVEQSE 63

Query: 69 AKGNVEKRLQFIKNEITRCEENIKEKQ 95
          A  NV KRL+FI+ EI RCE N+K KQ
Sbjct: 64 ANSNVAKRLEFIQTEIGRCENNLKAKQ 90

>Ecym_4721 Chr4 (1413362..1413685) [324 bp, 107 aa] {ON} similar
          to Ashbya gossypii ACL146C
          Length = 107

 Score =  119 bits (299), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 57/92 (61%), Positives = 74/92 (80%)

Query: 4  LNAQKLSMQYTTMQSELEDLVIARQKLETQLQENKIVQDEFDTLRDESQVYKLTGGVLLP 63
          ++ ++++ +YT +Q ELE L++ RQKLETQLQENKIV +E  +L+++ QVYKLTGGVLLP
Sbjct: 1  MSVEQVAAKYTQLQGELEQLIVTRQKLETQLQENKIVNEELQSLKEDKQVYKLTGGVLLP 60

Query: 64 VEQEEAKGNVEKRLQFIKNEITRCEENIKEKQ 95
          VE EEA  NV KRL+FI+ EI RCE NIK KQ
Sbjct: 61 VEHEEANSNVSKRLEFIQGEIDRCEGNIKNKQ 92

>YLR200W Chr12 (549012..549356) [345 bp, 114 aa] {ON}  YKE2Subunit
          of the heterohexameric Gim/prefoldin protein complex
          involved in the folding of alpha-tubulin, beta-tubulin,
          and actin
          Length = 114

 Score =  119 bits (299), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 60/95 (63%), Positives = 78/95 (82%), Gaps = 5/95 (5%)

Query: 1  MAELNAQKLSMQYTTMQSELEDLVIARQKLETQLQENKIVQDEFDTLRDESQVYKLTGGV 60
          M+EL A+     Y  +Q+ELE+ ++ARQKLETQLQENKIV +EFD L +++ VYKLTG V
Sbjct: 1  MSELGAK-----YQQLQNELEEFIVARQKLETQLQENKIVNEEFDQLEEDTPVYKLTGNV 55

Query: 61 LLPVEQEEAKGNVEKRLQFIKNEITRCEENIKEKQ 95
          LLPVEQ EA+ NV+KRL+FI+ EITRCE+NI++KQ
Sbjct: 56 LLPVEQSEARTNVDKRLEFIETEITRCEKNIRDKQ 90

>CAGL0A03971g Chr1 complement(400291..400611) [321 bp, 106 aa]
          {ON} similar to uniprot|P52553 Saccharomyces cerevisiae
          YLR200w YKE2 Gim complex component
          Length = 106

 Score =  117 bits (294), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 57/87 (65%), Positives = 73/87 (83%)

Query: 9  LSMQYTTMQSELEDLVIARQKLETQLQENKIVQDEFDTLRDESQVYKLTGGVLLPVEQEE 68
          L  +Y ++Q+ELE+LV ARQKLETQLQENKIV +EF TL++++ VYKLTG VLLPVE ++
Sbjct: 5  LGAKYQSLQNELEELVTARQKLETQLQENKIVNEEFATLKEDTVVYKLTGNVLLPVEHDD 64

Query: 69 AKGNVEKRLQFIKNEITRCEENIKEKQ 95
          AK NV+KRL+FI  EI RCE+NI+ KQ
Sbjct: 65 AKNNVDKRLEFIGEEIKRCEDNIRSKQ 91

>Kpol_530.29 s530 (74361..74684) [324 bp, 107 aa] {ON}
          (74361..74684) [324 nt, 108 aa]
          Length = 107

 Score =  117 bits (292), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 56/89 (62%), Positives = 77/89 (86%)

Query: 9  LSMQYTTMQSELEDLVIARQKLETQLQENKIVQDEFDTLRDESQVYKLTGGVLLPVEQEE 68
          L+ +Y  +Q ELE++++AR++LETQLQENKIV +EF+ L++++QVYKLTG VLLPVEQ E
Sbjct: 4  LANKYQKIQGELEEVIVARRQLETQLQENKIVNEEFEGLKEDTQVYKLTGNVLLPVEQFE 63

Query: 69 AKGNVEKRLQFIKNEITRCEENIKEKQTQ 97
          A+ NVEKRL+FI+ EI +CE+NIK KQT+
Sbjct: 64 ARSNVEKRLEFIEAEIKKCEDNIKSKQTE 92

>TDEL0F04510 Chr6 complement(846575..848806) [2232 bp, 743 aa] {ON}
           Anc_8.326 YLR131C
          Length = 743

 Score = 29.3 bits (64), Expect = 2.2,   Method: Composition-based stats.
 Identities = 16/48 (33%), Positives = 25/48 (52%)

Query: 6   AQKLSMQYTTMQSELEDLVIARQKLETQLQENKIVQDEFDTLRDESQV 53
            Q L  Q   ++  LE      ++LE QLQENK+ Q+    + DE ++
Sbjct: 162 GQTLLKQQEQLRLALERQHEVNKRLEQQLQENKLQQERLQRVLDEQEM 209

>SAKL0H24200g Chr8 complement(2086545..2089436) [2892 bp, 963 aa]
           {ON} similar to uniprot|Q06704 Saccharomyces cerevisiae
           YLR309C IMH1 Protein involved in vesicular transport
           mediates transport between an endosomal compartment and
           the Golgi contains a Golgi-localization (GRIP) domain
           that interacts with activated Arl1p-GTP to localize
           Imh1p to the Golgi
          Length = 963

 Score = 29.3 bits (64), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 31/47 (65%), Gaps = 3/47 (6%)

Query: 3   ELNAQKLSMQYTTMQSELEDLVIARQKLETQLQENKIVQDEFDTLRD 49
           E  A++LS Q   +QSE EDL +A + L++ L+ +KI  +E D ++D
Sbjct: 393 EARAKQLSEQLAGLQSEYEDLQVAHKDLQSSLK-SKI--EELDNVKD 436

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.309    0.126    0.322 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 9,862,402
Number of extensions: 386766
Number of successful extensions: 2053
Number of sequences better than 10.0: 140
Number of HSP's gapped: 2048
Number of HSP's successfully gapped: 144
Length of query: 115
Length of database: 53,481,399
Length adjustment: 85
Effective length of query: 30
Effective length of database: 43,734,789
Effective search space: 1312043670
Effective search space used: 1312043670
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 59 (27.3 bits)