Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0F11396g7.351ON25425412611e-178
KLLA0D12320g7.351ON2502487751e-104
KLTH0H01232g7.351ON2572557671e-102
TDEL0C019707.351ON2602537541e-100
Kwal_56.246447.351ON2582587445e-99
ZYRO0F11726g7.351ON2512537323e-97
Kpol_530.307.351ON2602457212e-95
YLR201C (COQ9)7.351ON2602467124e-94
Suva_10.2967.351ON2602457064e-93
ACL147W7.351ON2462477001e-92
Skud_12.2657.351ON2602556831e-89
KNAG0B026207.351ON2652496733e-88
TBLA0E004507.351ON2792436727e-88
Smik_12.2607.351ON2602466431e-83
Ecym_47227.351ON2532446351e-82
TPHA0F029807.351ON2642536334e-82
NCAS0E028707.351ON2612476318e-82
CAGL0A03949g7.351ON2682466292e-81
NDAI0E044707.351ON2642476074e-78
KAFR0L014807.351ON2642465771e-73
YDR096W (GIS1)8.234ON89427675.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0F11396g
         (254 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0F11396g Chr6 (886970..887734) [765 bp, 254 aa] {ON} similar...   490   e-178
KLLA0D12320g Chr4 complement(1048556..1049308) [753 bp, 250 aa] ...   303   e-104
KLTH0H01232g Chr8 complement(119673..120446) [774 bp, 257 aa] {O...   300   e-102
TDEL0C01970 Chr3 complement(343645..344427) [783 bp, 260 aa] {ON...   295   e-100
Kwal_56.24644 s56 (1087270..1088046) [777 bp, 258 aa] {ON} YLR20...   291   5e-99
ZYRO0F11726g Chr6 (959943..960698) [756 bp, 251 aa] {ON} similar...   286   3e-97
Kpol_530.30 s530 complement(75011..75793) [783 bp, 260 aa] {ON} ...   282   2e-95
YLR201C Chr12 complement(549511..550293) [783 bp, 260 aa] {ON}  ...   278   4e-94
Suva_10.296 Chr10 complement(522345..523127) [783 bp, 260 aa] {O...   276   4e-93
ACL147W Chr3 (92477..93217) [741 bp, 246 aa] {ON} Syntenic homol...   274   1e-92
Skud_12.265 Chr12 complement(496162..496944) [783 bp, 260 aa] {O...   267   1e-89
KNAG0B02620 Chr2 complement(507597..508394) [798 bp, 265 aa] {ON...   263   3e-88
TBLA0E00450 Chr5 complement(83483..84322) [840 bp, 279 aa] {ON} ...   263   7e-88
Smik_12.260 Chr12 complement(496547..497329) [783 bp, 260 aa] {O...   252   1e-83
Ecym_4722 Chr4 complement(1413860..1414621) [762 bp, 253 aa] {ON...   249   1e-82
TPHA0F02980 Chr6 (655375..656169) [795 bp, 264 aa] {ON} Anc_7.35...   248   4e-82
NCAS0E02870 Chr5 complement(561968..562753) [786 bp, 261 aa] {ON...   247   8e-82
CAGL0A03949g Chr1 (399220..400026) [807 bp, 268 aa] {ON} similar...   246   2e-81
NDAI0E04470 Chr5 complement(1006109..1006903) [795 bp, 264 aa] {...   238   4e-78
KAFR0L01480 Chr12 (274514..275308) [795 bp, 264 aa] {ON} Anc_7.3...   226   1e-73
YDR096W Chr4 (637139..639823) [2685 bp, 894 aa] {ON}  GIS1JmjC d...    30   5.5  

>SAKL0F11396g Chr6 (886970..887734) [765 bp, 254 aa] {ON} similar to
           uniprot|Q05779 Saccharomyces cerevisiae YLR201C FMP53
          Length = 254

 Score =  490 bits (1261), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 241/254 (94%), Positives = 241/254 (94%)

Query: 1   MFKQAFSKIARRGYHPNNLEHASSKVLPPLIYSKDSPQWKILANALDEQVPKYGFNERAL 60
           MFKQAFSKIARRGYHPNNLEHASSKVLPPLIYSKDSPQWKILANALDEQVPKYGFNERAL
Sbjct: 1   MFKQAFSKIARRGYHPNNLEHASSKVLPPLIYSKDSPQWKILANALDEQVPKYGFNERAL 60

Query: 61  TSSCSDLGYSSSFLSVLGXXXXXXXXXXXXXVLELLKFHLVSKRYSLTDGVADGTLESPS 120
           TSSCSDLGYSSSFLSVLG             VLELLKFHLVSKRYSLTDGVADGTLESPS
Sbjct: 61  TSSCSDLGYSSSFLSVLGASNSPSFFNSSPAVLELLKFHLVSKRYSLTDGVADGTLESPS 120

Query: 121 LENLFLKRLEMNKPIAAHLSQLLSCLALPGAFLAEYAIPELHRLSDDMVYFSNEPDHNDF 180
           LENLFLKRLEMNKPIAAHLSQLLSCLALPGAFLAEYAIPELHRLSDDMVYFSNEPDHNDF
Sbjct: 121 LENLFLKRLEMNKPIAAHLSQLLSCLALPGAFLAEYAIPELHRLSDDMVYFSNEPDHNDF 180

Query: 181 AWYSKRLAISTAYVSSELFMAQDKSIDYQDTVKFAKEKLKNIKQLGEAYNNVEEYAWYTL 240
           AWYSKRLAISTAYVSSELFMAQDKSIDYQDTVKFAKEKLKNIKQLGEAYNNVEEYAWYTL
Sbjct: 181 AWYSKRLAISTAYVSSELFMAQDKSIDYQDTVKFAKEKLKNIKQLGEAYNNVEEYAWYTL 240

Query: 241 LSSISLAKSQMTRS 254
           LSSISLAKSQMTRS
Sbjct: 241 LSSISLAKSQMTRS 254

>KLLA0D12320g Chr4 complement(1048556..1049308) [753 bp, 250 aa]
           {ON} similar to uniprot|Q05779 Saccharomyces cerevisiae
           YLR201C FMP53,
          Length = 250

 Score =  303 bits (775), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 147/248 (59%), Positives = 189/248 (76%), Gaps = 1/248 (0%)

Query: 7   SKIARRGYHPNNLEHASSKVLPPLIYSKDSPQWKILANALDEQVPKYGFNERALTSSCSD 66
           S++  R YHPNNLEHA  K++ PL Y  DS Q+K+L+NAL++ VP+YGFNERA+  S ++
Sbjct: 2   SRVFTRLYHPNNLEHALPKIIKPLTYGTDSVQFKVLSNALNKHVPQYGFNERAIVQSLNE 61

Query: 67  LGYSSSFLSVLGXXXXXXXXXXXXXVLELLKFHLVSKRYSL-TDGVADGTLESPSLENLF 125
           LG  SS+LSVLG             VLEL+KFHLVSKR  L TD   D     P L+ LF
Sbjct: 62  LGMGSSYLSVLGSSNSPSFFNVSPSVLELVKFHLVSKRNQLITDLPLDSDKPLPDLKTLF 121

Query: 126 LKRLEMNKPIAAHLSQLLSCLALPGAFLAEYAIPELHRLSDDMVYFSNEPDHNDFAWYSK 185
           L+RL++N+ +A HLSQLLS +++PG FLA  A+ ELH+L+DDM+++SNE DHNDFAWYSK
Sbjct: 122 LQRLKLNEHVAPHLSQLLSIMSVPGEFLASTALSELHKLTDDMIFYSNEQDHNDFAWYSK 181

Query: 186 RLAISTAYVSSELFMAQDKSIDYQDTVKFAKEKLKNIKQLGEAYNNVEEYAWYTLLSSIS 245
           R+A+STAYVSSELFMAQDKS ++Q+T++FA+ KL  + QLG  YNN EEY W+TLLSSI+
Sbjct: 182 RIALSTAYVSSELFMAQDKSHNFQETMEFAQSKLNKVSQLGSMYNNTEEYLWFTLLSSIN 241

Query: 246 LAKSQMTR 253
           LAKSQ+TR
Sbjct: 242 LAKSQITR 249

>KLTH0H01232g Chr8 complement(119673..120446) [774 bp, 257 aa] {ON}
           similar to uniprot|Q05779 Saccharomyces cerevisiae
           YLR201C FMP53
          Length = 257

 Score =  300 bits (767), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 150/255 (58%), Positives = 185/255 (72%), Gaps = 5/255 (1%)

Query: 5   AFSKI-ARRGYHPNNLEHASSKVLPPLIYSKDSPQWKILANALDEQVPKYGFNERALTSS 63
           A S+I ARR YHP+ LEH  +    PL Y   S Q+K+L +AL++ VP YGFNERAL +S
Sbjct: 3   ALSRILARRLYHPSALEHQLAHSFAPLTYGPGSTQFKVLEHALNKHVPSYGFNERALVAS 62

Query: 64  CSDLGYSSSFLSVLGXXXXXXXXXXXXXVLELLKFHLVSKRYSLTDGV----ADGTLESP 119
            +DL    S LSV+G             VLEL+KFHLV+KRY+LT  +         E P
Sbjct: 63  LNDLDLGPSLLSVIGASNSPSFLNASPAVLELIKFHLVTKRYALTKELDPARTSSPAEPP 122

Query: 120 SLENLFLKRLEMNKPIAAHLSQLLSCLALPGAFLAEYAIPELHRLSDDMVYFSNEPDHND 179
           +LE LF +RLE+NKPIA HL+QLLS L++PG FL + A+PELHRLSDDMVYFS EPD ND
Sbjct: 123 ALETLFHRRLELNKPIAPHLTQLLSSLSIPGEFLVQTALPELHRLSDDMVYFSKEPDAND 182

Query: 180 FAWYSKRLAISTAYVSSELFMAQDKSIDYQDTVKFAKEKLKNIKQLGEAYNNVEEYAWYT 239
           FAWYSKR+A+S A+VSSELFMAQD+S +Y DT +FA EKL N+ +LG+ YNN EEY WYT
Sbjct: 183 FAWYSKRIALSCAFVSSELFMAQDRSANYADTFEFAAEKLHNVSKLGQYYNNTEEYMWYT 242

Query: 240 LLSSISLAKSQMTRS 254
           LL S++LAKSQ+TRS
Sbjct: 243 LLMSVNLAKSQLTRS 257

>TDEL0C01970 Chr3 complement(343645..344427) [783 bp, 260 aa] {ON}
           Anc_7.351 YLR201C
          Length = 260

 Score =  295 bits (754), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 146/253 (57%), Positives = 187/253 (73%), Gaps = 3/253 (1%)

Query: 5   AFSKIARRGYHPNNLEHASS-KVLPPLIYSKDSPQWKILANALDEQVPKYGFNERALTSS 63
           A S+I  RGY P   E+ +      PL Y KDSPQ+K+L++ L + VP YGFNERA+ +S
Sbjct: 8   AGSRIFARGYRPAGFEYINPINSRGPLKYGKDSPQYKVLSHTLAKSVPMYGFNERAIVNS 67

Query: 64  CSDLGYSSSFLSVLGXXXXXXXXXXXXXVLELLKFHLVSKRYSLTDGVADGTL--ESPSL 121
            ++LGY S+ LSV+G             ++ELLKFHLV KR +LT+ ++  T   + PSL
Sbjct: 68  LNELGYPSTMLSVIGSSNGPSFFHSSPALMELLKFHLVDKRLNLTENISLETPVDQLPSL 127

Query: 122 ENLFLKRLEMNKPIAAHLSQLLSCLALPGAFLAEYAIPELHRLSDDMVYFSNEPDHNDFA 181
           E+L +KRLEMN P+A HLSQLLS L++PG FL +Y++PELHRLSDDM+YFS E DHNDFA
Sbjct: 128 EHLVIKRLEMNVPVAKHLSQLLSQLSIPGPFLVDYSMPELHRLSDDMIYFSTEKDHNDFA 187

Query: 182 WYSKRLAISTAYVSSELFMAQDKSIDYQDTVKFAKEKLKNIKQLGEAYNNVEEYAWYTLL 241
           WYSKRLA+S AYVSSELFMAQD+S DY++T +FA+EKL  +  LGE YNN EE+AWYTLL
Sbjct: 188 WYSKRLAVSCAYVSSELFMAQDRSPDYKETFEFAREKLHRVSTLGEYYNNTEEFAWYTLL 247

Query: 242 SSISLAKSQMTRS 254
           S+I+L KSQ+ R 
Sbjct: 248 STINLVKSQLARG 260

>Kwal_56.24644 s56 (1087270..1088046) [777 bp, 258 aa] {ON} YLR201C
           - Hypothetical ORF [contig 161] FULL
          Length = 258

 Score =  291 bits (744), Expect = 5e-99,   Method: Compositional matrix adjust.
 Identities = 146/258 (56%), Positives = 180/258 (69%), Gaps = 4/258 (1%)

Query: 1   MFKQAFSKIARRGYHPNNLEHASSKVLPPLIYSKDSPQWKILANALDEQVPKYGFNERAL 60
           M  ++F  + RR Y PN LE+  +  L PL Y   S Q+K+L +AL   VP YGFNERAL
Sbjct: 1   MLARSFRTLGRRFYQPNPLEYQLTTKLAPLAYGTQSIQFKVLDHALKNHVPSYGFNERAL 60

Query: 61  TSSCSDLGYSSSFLSVLGXXXXXXXXXXXXXVLELLKFHLVSKRYSLTDGV----ADGTL 116
            +S +DLG  S  LS +G             VLEL+KFHLV+KRY+LT  +         
Sbjct: 61  VASLNDLGLGSQVLSSIGAPNSPPLLNSSPAVLELVKFHLVTKRYALTKDLDIARCASPA 120

Query: 117 ESPSLENLFLKRLEMNKPIAAHLSQLLSCLALPGAFLAEYAIPELHRLSDDMVYFSNEPD 176
           E P+LE LF KRLE+N PIA H++QLL+ LA+PG FL + A+PELHRLSDDM+YFS EPD
Sbjct: 121 EPPALETLFHKRLELNIPIAQHMTQLLAILAMPGEFLLQSALPELHRLSDDMIYFSKEPD 180

Query: 177 HNDFAWYSKRLAISTAYVSSELFMAQDKSIDYQDTVKFAKEKLKNIKQLGEAYNNVEEYA 236
            NDFAWYSKR AIS A+VSSELFMAQDKS +Y DT +FA +KL N+ +LG+ Y N EEY 
Sbjct: 181 ANDFAWYSKRAAISCAFVSSELFMAQDKSPNYADTFEFAADKLHNVTKLGQYYTNTEEYM 240

Query: 237 WYTLLSSISLAKSQMTRS 254
           WYTLL S++LAKSQ+TRS
Sbjct: 241 WYTLLMSVNLAKSQITRS 258

>ZYRO0F11726g Chr6 (959943..960698) [756 bp, 251 aa] {ON} similar to
           uniprot|Q05779 Saccharomyces cerevisiae YLR201C FMP53
          Length = 251

 Score =  286 bits (732), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 143/253 (56%), Positives = 185/253 (73%), Gaps = 3/253 (1%)

Query: 1   MFKQAFSKIARRGYHPNNLEHASSKVLPPLIYSKDSPQWKILANALDEQVPKYGFNERAL 60
           MFK+   +++ R YHP+  EH +S  L PL Y  DSPQ+ +L++AL   VP  GFNERA+
Sbjct: 1   MFKR-LCQVSLRRYHPSKGEHLNSSRLGPLNYGLDSPQYAVLSHALKVSVPVVGFNERAI 59

Query: 61  TSSCSDLGYSSSFLSVLGXXXXXXXXXXXXXVLELLKFHLVSKRYSLTDGVADGTLESPS 120
             S + L Y S+ LSV+G             V+EL+KFHLV KR  L+  ++  + E PS
Sbjct: 60  VHSLNQLNYPSTMLSVIGASNSPSLLHSSPAVMELVKFHLVQKRLQLSQDLS--SEEKPS 117

Query: 121 LENLFLKRLEMNKPIAAHLSQLLSCLALPGAFLAEYAIPELHRLSDDMVYFSNEPDHNDF 180
           LE+LF+KRLE+N PIA HLSQLLS +++PG F  + A+PELHRLSDD++Y+SNE DH+DF
Sbjct: 118 LEDLFIKRLELNVPIAGHLSQLLSHVSVPGPFTVDTALPELHRLSDDLIYYSNEKDHHDF 177

Query: 181 AWYSKRLAISTAYVSSELFMAQDKSIDYQDTVKFAKEKLKNIKQLGEAYNNVEEYAWYTL 240
           AWYSKRL IS AYVSSELFMAQDKS +Y++T +FA++KL+   QLGE YNN EE+ WYTL
Sbjct: 178 AWYSKRLGISCAYVSSELFMAQDKSHNYEETFQFARDKLQRTMQLGEYYNNTEEWLWYTL 237

Query: 241 LSSISLAKSQMTR 253
           L+SI+LAKSQM R
Sbjct: 238 LNSINLAKSQMAR 250

>Kpol_530.30 s530 complement(75011..75793) [783 bp, 260 aa] {ON}
           complement(75011..75793) [783 nt, 261 aa]
          Length = 260

 Score =  282 bits (721), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 135/245 (55%), Positives = 183/245 (74%), Gaps = 2/245 (0%)

Query: 12  RGYHPNNLEHASSKVLPPLIYSKDSPQWKILANALDEQVPKYGFNERALTSSCSDLGYSS 71
           R YHPN  E+     LPPL+Y KDS Q+KIL+++LD  VP++GFNERA+ +S + LGY S
Sbjct: 16  RFYHPNPKEYVPQLTLPPLLYGKDSKQYKILSHSLDVSVPEFGFNERAIVNSINLLGYPS 75

Query: 72  SFLSVLGXXXXXXXXXXXXXVLELLKFHLVSKRYSLTDGVADGTL--ESPSLENLFLKRL 129
           S LSV+G             ++ELLKF+LV+KRY L++ +   T   E PSLE+L +KRL
Sbjct: 76  SILSVIGSSNTPSFLHSSTALMELLKFNLVAKRYQLSEDIPLDTPVEELPSLEDLLIKRL 135

Query: 130 EMNKPIAAHLSQLLSCLALPGAFLAEYAIPELHRLSDDMVYFSNEPDHNDFAWYSKRLAI 189
           +M+ PI  HLSQL++ L++PG FL + ++PELHRL+DDM+YFS+E DH DFAWY+KR+ +
Sbjct: 136 KMDVPIGPHLSQLIAQLSIPGPFLTDTSLPELHRLADDMIYFSSEKDHPDFAWYAKRMGV 195

Query: 190 STAYVSSELFMAQDKSIDYQDTVKFAKEKLKNIKQLGEAYNNVEEYAWYTLLSSISLAKS 249
           STAY+SS+LFMAQD+S  Y DT +FAK+KLK I +LG+ YNN EEYAWY L++SI++AKS
Sbjct: 196 STAYMSSKLFMAQDRSPGYVDTFEFAKDKLKRIMKLGDYYNNAEEYAWYVLMNSINMAKS 255

Query: 250 QMTRS 254
           +  R 
Sbjct: 256 KAARG 260

>YLR201C Chr12 complement(549511..550293) [783 bp, 260 aa] {ON}
           COQ9Protein required for ubiquinone (coenzyme Q)
           biosynthesis and respiratory growth; localizes to the
           matrix face of the mitochondrial inner membrane in a
           large complex with ubiquinone biosynthetic enzymes
          Length = 260

 Score =  278 bits (712), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 136/246 (55%), Positives = 181/246 (73%), Gaps = 3/246 (1%)

Query: 12  RGYHPNNLEHASSKVLPPLIYSKDSPQWKILANALDEQVPKYGFNERALTSSCSDLGYSS 71
           R YH N +EH     + PL Y K+SPQ+K+L+ AL + VP++GF+ER++  S ++LGY S
Sbjct: 15  RLYHSNPIEHVKPIHIKPLTYGKESPQYKVLSLALQKFVPEHGFSERSIVESLNELGYPS 74

Query: 72  SFLSVLGXXXXXXXXXXXXXVLELLKFHLVSKRYSLTDGV-ADGTLES--PSLENLFLKR 128
           S +S +G             V+EL+KF LV KRY LT+G+  D T +   PSLE+L LKR
Sbjct: 75  SMISSIGAPNSPSFFHSSTAVMELIKFQLVDKRYRLTEGINPDVTPQYKLPSLEHLLLKR 134

Query: 129 LEMNKPIAAHLSQLLSCLALPGAFLAEYAIPELHRLSDDMVYFSNEPDHNDFAWYSKRLA 188
           LEM+KPI  HLS+L+S LA+P AFL E AIPELHRLSDDM+YFSNE DH+D AWY+KRLA
Sbjct: 135 LEMDKPIGGHLSELMSQLAIPSAFLFETAIPELHRLSDDMIYFSNEKDHHDSAWYAKRLA 194

Query: 189 ISTAYVSSELFMAQDKSIDYQDTVKFAKEKLKNIKQLGEAYNNVEEYAWYTLLSSISLAK 248
           +S+ Y+ S+LFMAQDKS +Y++T  FAK+KL  + +LGE YNN EE+AWYTL+S+++L K
Sbjct: 195 VSSTYIGSKLFMAQDKSHNYKETFTFAKDKLHRVMRLGEYYNNTEEFAWYTLMSTVNLIK 254

Query: 249 SQMTRS 254
           SQ+ R 
Sbjct: 255 SQLVRG 260

>Suva_10.296 Chr10 complement(522345..523127) [783 bp, 260 aa] {ON}
           YLR201C (REAL)
          Length = 260

 Score =  276 bits (706), Expect = 4e-93,   Method: Compositional matrix adjust.
 Identities = 135/245 (55%), Positives = 175/245 (71%), Gaps = 3/245 (1%)

Query: 12  RGYHPNNLEHASSKVLPPLIYSKDSPQWKILANALDEQVPKYGFNERALTSSCSDLGYSS 71
           R YH N +EH +   + PL Y K SPQ+K+L+ AL E VPK+GF ER++  S + LGY S
Sbjct: 15  RLYHSNPIEHVNPLHIKPLAYGKQSPQYKVLSLALQEYVPKHGFTERSIVESLNKLGYPS 74

Query: 72  SFLSVLGXXXXXXXXXXXXXVLELLKFHLVSKRYSLTDGV-ADGT--LESPSLENLFLKR 128
           S +S +G             V+ELLKF LV KRY LT+G+  D T   + PSLE+L LKR
Sbjct: 75  SMISSIGASNSPSFVHSSTAVMELLKFQLVDKRYRLTEGINPDVTPHYKLPSLEHLLLKR 134

Query: 129 LEMNKPIAAHLSQLLSCLALPGAFLAEYAIPELHRLSDDMVYFSNEPDHNDFAWYSKRLA 188
           LEM+KP+   L+ L+S LA+P  FL E AIPELHRLSDDM+YFSNE DH+D AWY+KRLA
Sbjct: 135 LEMDKPVGEQLTDLMSQLAIPSGFLFETAIPELHRLSDDMIYFSNEKDHHDSAWYAKRLA 194

Query: 189 ISTAYVSSELFMAQDKSIDYQDTVKFAKEKLKNIKQLGEAYNNVEEYAWYTLLSSISLAK 248
           +S+ Y+ S+LFMAQDKS D+ +T  FAK+KL  + +LGE YNN EE+AWYTL+S+++L K
Sbjct: 195 VSSTYIGSQLFMAQDKSHDFHETFAFAKDKLHRVMRLGEYYNNTEEFAWYTLMSTVNLVK 254

Query: 249 SQMTR 253
           SQ+ R
Sbjct: 255 SQLAR 259

>ACL147W Chr3 (92477..93217) [741 bp, 246 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YLR201C
          Length = 246

 Score =  274 bits (700), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 129/247 (52%), Positives = 171/247 (69%), Gaps = 3/247 (1%)

Query: 8   KIARRGYHPNNLEHASSKVLPPLIYSKDSPQWKILANALDEQVPKYGFNERALTSSCSDL 67
           ++ RR YHPN LEHA    L PL Y +DSPQ+K+L  AL+  VP  GFNERA+  +  DL
Sbjct: 3   RVCRRLYHPNTLEHAVGNRLRPLAYEQDSPQYKVLQRALEAHVPVLGFNERAIVRAAGDL 62

Query: 68  GYSSSFLSVLGXXXXXXXXXXXXXVLELLKFHLVSKRYSLTDGVADGTLESPSLENLFLK 127
           GY S+ LS L              VLEL+KFHLV+KR +L D  A G +   S+E LFL+
Sbjct: 63  GYGSAVLSALAAPNSPALLNVPSAVLELVKFHLVTKRVALADAAAQGNV---SMEQLFLQ 119

Query: 128 RLEMNKPIAAHLSQLLSCLALPGAFLAEYAIPELHRLSDDMVYFSNEPDHNDFAWYSKRL 187
           R+E ++P+A  L+QLLS L+LPG FL   A+PEL RLSDD++Y+S E DH D AWYSKR 
Sbjct: 120 RVEADRPLAGQLTQLLSILSLPGEFLVNTAMPELFRLSDDLIYYSGEKDHPDLAWYSKRA 179

Query: 188 AISTAYVSSELFMAQDKSIDYQDTVKFAKEKLKNIKQLGEAYNNVEEYAWYTLLSSISLA 247
           A++ AYVS+ LFMA+D+S   ++T+ FA+ +L+ +  LG AYNNVEE+AWY LL +++L 
Sbjct: 180 AVAMAYVSTNLFMARDRSPALEETLHFARRRLQQVDSLGTAYNNVEEFAWYQLLMAMNLV 239

Query: 248 KSQMTRS 254
           KSQ+TR 
Sbjct: 240 KSQLTRG 246

>Skud_12.265 Chr12 complement(496162..496944) [783 bp, 260 aa] {ON}
           YLR201C (REAL)
          Length = 260

 Score =  267 bits (683), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 134/255 (52%), Positives = 175/255 (68%), Gaps = 9/255 (3%)

Query: 9   IARRG------YHPNNLEHASSKVLPPLIYSKDSPQWKILANALDEQVPKYGFNERALTS 62
           +AR G      YH N +EH     + PL Y K SPQ+K+L+ AL E VPK+GF+ER++  
Sbjct: 6   VARNGCKFHRLYHSNPIEHVKPLHIKPLTYGKQSPQYKVLSLALLEYVPKHGFSERSIVE 65

Query: 63  SCSDLGYSSSFLSVLGXXXXXXXXXXXXXVLELLKFHLVSKRYSLTDGV---ADGTLESP 119
           S + LGY SS +S +G             V+EL+KF LV KRY LT+G+        + P
Sbjct: 66  SLNKLGYPSSMVSSIGASNSPSFFHSSTAVMELVKFQLVDKRYRLTEGINPDVTSRYKLP 125

Query: 120 SLENLFLKRLEMNKPIAAHLSQLLSCLALPGAFLAEYAIPELHRLSDDMVYFSNEPDHND 179
           SLE+L LKRLEM+K I   L+ L+S LA+P   L E AIPELHRLSDDM+YFSNE DH+D
Sbjct: 126 SLEHLLLKRLEMDKLIGGQLADLMSQLAVPSRLLFETAIPELHRLSDDMIYFSNEEDHHD 185

Query: 180 FAWYSKRLAISTAYVSSELFMAQDKSIDYQDTVKFAKEKLKNIKQLGEAYNNVEEYAWYT 239
            AWY+KRLA+S+ Y+ S+LFMAQDKS D+++T  FAKEKL  + +LGE YNN EE+AWYT
Sbjct: 186 SAWYAKRLAVSSTYIGSKLFMAQDKSHDFKETFAFAKEKLHKVMRLGEYYNNTEEFAWYT 245

Query: 240 LLSSISLAKSQMTRS 254
           L+S+++L KSQ+ R 
Sbjct: 246 LMSTVNLVKSQLARG 260

>KNAG0B02620 Chr2 complement(507597..508394) [798 bp, 265 aa] {ON}
           Anc_7.351 YLR201C
          Length = 265

 Score =  263 bits (673), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 127/249 (51%), Positives = 175/249 (70%), Gaps = 4/249 (1%)

Query: 9   IARRGYHPNNLEHASSKVLPPLIYSKDSPQWKILANALDEQVPKYGFNERALTSSCSDLG 68
           ++ R YHPN +E+A+S V+ PL Y+ DSPQ +IL + L  +VP +GF ERAL  S   +G
Sbjct: 16  LSTRLYHPNPIEYANSTVVAPLTYTMDSPQSRILTHCLQNEVPHWGFTERALLKSIQAVG 75

Query: 69  YSSSFLSVLGXXXXXXXXXXXXXVLELLKFHLVSKRYSLTDGVADGTLESP----SLENL 124
           Y SS +SVLG             V+EL+KF+LV KR++LT+ +A   L SP    SLE+L
Sbjct: 76  YDSSMMSVLGASNSPSIFHSSPAVMELVKFNLVKKRHALTESLAAAGLGSPAALPSLEHL 135

Query: 125 FLKRLEMNKPIAAHLSQLLSCLALPGAFLAEYAIPELHRLSDDMVYFSNEPDHNDFAWYS 184
            +KRL+M+ P++  L  L + LALP  F+   A+PEL RLSDDM+YFSNE DH D AWYS
Sbjct: 136 LVKRLQMDVPLSKQLGDLFTQLALPSQFMVNVAVPELFRLSDDMIYFSNEKDHFDTAWYS 195

Query: 185 KRLAISTAYVSSELFMAQDKSIDYQDTVKFAKEKLKNIKQLGEAYNNVEEYAWYTLLSSI 244
           KRL +S AY +S+LFMAQD S++ QDT++FA++KL  I  LGE YNNVEEYAWY++++++
Sbjct: 196 KRLGVSLAYTTSKLFMAQDNSLNCQDTIEFARDKLHRIMTLGEYYNNVEEYAWYSIMTTV 255

Query: 245 SLAKSQMTR 253
           + AK+  +R
Sbjct: 256 NRAKAGFSR 264

>TBLA0E00450 Chr5 complement(83483..84322) [840 bp, 279 aa] {ON}
           Anc_7.351 YLR201C
          Length = 279

 Score =  263 bits (672), Expect = 7e-88,   Method: Compositional matrix adjust.
 Identities = 125/243 (51%), Positives = 176/243 (72%)

Query: 12  RGYHPNNLEHASSKVLPPLIYSKDSPQWKILANALDEQVPKYGFNERALTSSCSDLGYSS 71
           R Y+  + +   S  L PL+Y KDS Q++IL +A+   VP +GF ERA+ +S + LGY+S
Sbjct: 37  RTYYSVSNDVKKSDHLEPLLYGKDSAQYRILEDAVQNSVPTFGFTERAIINSINKLGYNS 96

Query: 72  SFLSVLGXXXXXXXXXXXXXVLELLKFHLVSKRYSLTDGVADGTLESPSLENLFLKRLEM 131
           S +SVLG             VLELLKF+LVSKR  L++G+   T + PSLE L LKRL+M
Sbjct: 97  SMISVLGSSNTHNILHSSPAVLELLKFNLVSKRLKLSEGIDPETKDLPSLEYLLLKRLQM 156

Query: 132 NKPIAAHLSQLLSCLALPGAFLAEYAIPELHRLSDDMVYFSNEPDHNDFAWYSKRLAIST 191
           +K I + L+++++ L++PG FLAE +IPEL RLSDDM+YFSNE DH+D AWYSKRLA+ST
Sbjct: 157 DKAIQSRLNEMITKLSIPGTFLAETSIPELFRLSDDMIYFSNEKDHHDMAWYSKRLAVST 216

Query: 192 AYVSSELFMAQDKSIDYQDTVKFAKEKLKNIKQLGEAYNNVEEYAWYTLLSSISLAKSQM 251
            Y++S++FMAQD S+D   T++FA++KL  +  LGE YNN EE+ W+TL++S+++ KSQ+
Sbjct: 217 TYIASQIFMAQDTSVDCYKTLEFAQDKLNKVMNLGEYYNNTEEFLWFTLMTSVNIVKSQL 276

Query: 252 TRS 254
            RS
Sbjct: 277 ARS 279

>Smik_12.260 Chr12 complement(496547..497329) [783 bp, 260 aa] {ON}
           YLR201C (REAL)
          Length = 260

 Score =  252 bits (643), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 135/246 (54%), Positives = 179/246 (72%), Gaps = 3/246 (1%)

Query: 12  RGYHPNNLEHASSKVLPPLIYSKDSPQWKILANALDEQVPKYGFNERALTSSCSDLGYSS 71
           R YHPN +EH  S  + PL Y K+SPQ+K+L+ AL++ VPK+GF+ER++  S ++LGY S
Sbjct: 15  RLYHPNPIEHVKSHHIKPLTYGKESPQYKVLSLALEQYVPKHGFSERSIVESLNELGYPS 74

Query: 72  SFLSVLGXXXXXXXXXXXXXVLELLKFHLVSKRYSLTDGV-ADGTLES--PSLENLFLKR 128
           S +S +              V+EL+KF LV KRY LT+ +  D T +   PSLE+L L+R
Sbjct: 75  SMISSISASNSPSFFHSSTAVMELIKFQLVDKRYRLTEAINPDVTPQYKLPSLEHLLLRR 134

Query: 129 LEMNKPIAAHLSQLLSCLALPGAFLAEYAIPELHRLSDDMVYFSNEPDHNDFAWYSKRLA 188
           LEM+KPI   LS+L+S LA+P  FL E AIPELHRLSDDM+YFSNE DH+D AWY+KRLA
Sbjct: 135 LEMDKPIGGCLSELMSQLAIPSGFLFETAIPELHRLSDDMIYFSNEKDHHDSAWYAKRLA 194

Query: 189 ISTAYVSSELFMAQDKSIDYQDTVKFAKEKLKNIKQLGEAYNNVEEYAWYTLLSSISLAK 248
           +S+ Y+ S+LFMAQDKS +Y+DT  FAK KL  + +LGE YNN EE+AWYTL+S+++L K
Sbjct: 195 VSSTYIGSKLFMAQDKSHNYKDTFDFAKHKLNRVMRLGEYYNNTEEFAWYTLMSTVNLVK 254

Query: 249 SQMTRS 254
           SQ+ R 
Sbjct: 255 SQLVRG 260

>Ecym_4722 Chr4 complement(1413860..1414621) [762 bp, 253 aa] {ON}
           similar to Ashbya gossypii ACL147W
          Length = 253

 Score =  249 bits (635), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 119/244 (48%), Positives = 170/244 (69%), Gaps = 4/244 (1%)

Query: 11  RRGYHPNNLEHASSKVLPPLIYSKDSPQWKILANALDEQVPKYGFNERALTSSCSDLGYS 70
           RR YH N+ E+A    L PLIY + SPQ+K+L  AL++ VP  GF + A+  + ++LGY+
Sbjct: 14  RRFYHVNSAEYAVGNTLRPLIYGRCSPQYKVLNCALEKYVPFKGFKDSAIVDAANELGYN 73

Query: 71  SSFLSVLGXXXXXXXXXXXXXVLELLKFHLVSKRYSLTDGVADGTLESPSLENLFLKRLE 130
           S+ L+ +G             V EL+KFHLV+KRY L +   +GT    +LE LFLKRLE
Sbjct: 74  SAVLAAIGANNSPAMFNVSTSVQELVKFHLVTKRYGLQED-QEGT---KTLEELFLKRLE 129

Query: 131 MNKPIAAHLSQLLSCLALPGAFLAEYAIPELHRLSDDMVYFSNEPDHNDFAWYSKRLAIS 190
            NK +  HL ++LS LA+PG FL    +PEL +L+DDM+Y+S E D ND AWYSKRLA+S
Sbjct: 130 ANKSLGPHLKEVLSILAIPGDFLVNTGLPELFQLADDMIYYSTEKDFNDLAWYSKRLAVS 189

Query: 191 TAYVSSELFMAQDKSIDYQDTVKFAKEKLKNIKQLGEAYNNVEEYAWYTLLSSISLAKSQ 250
            AY+S+ELFMA+D S ++Q T++FAK ++  I ++G AYNN+EE+AW+ LL++++LA+SQ
Sbjct: 190 MAYISTELFMAKDSSPNFQATMEFAKGRINQIDEMGTAYNNIEEFAWFQLLTTVNLARSQ 249

Query: 251 MTRS 254
           + R 
Sbjct: 250 LVRG 253

>TPHA0F02980 Chr6 (655375..656169) [795 bp, 264 aa] {ON} Anc_7.351
           YLR201C
          Length = 264

 Score =  248 bits (633), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 123/253 (48%), Positives = 176/253 (69%), Gaps = 5/253 (1%)

Query: 7   SKIARRGYHPNNLEHASSKVLPPLIYSKDSPQWKILANALDEQVPKYGFNERALTSSCSD 66
           S +  R +HP   E+     L P  Y+KDSPQ+KIL++A+D  V K+GF+ERA+  +  +
Sbjct: 12  SGVNARFFHPATDEYVLPNKLSPCTYTKDSPQFKILSHAIDNTVTKFGFSERAIIEAMKE 71

Query: 67  LGY--SSSFLSVLGXXXXXXXXXXXXXVLELLKFHLVSKRYSLTDGVADGTLESPSLENL 124
           L     S+ LS +G             V+ELLKF+LV KRY + +G+   T++   L +L
Sbjct: 72  LKIENQSTMLSAIGSSNSPSFLHSSPSVMELLKFNLVLKRYRMIEGLDPLTMQQEELPSL 131

Query: 125 FL---KRLEMNKPIAAHLSQLLSCLALPGAFLAEYAIPELHRLSDDMVYFSNEPDHNDFA 181
                KRLEM+ PI  H+S  +S L +PG FL + A+PELHRL+DDM+YFSNE DH+DFA
Sbjct: 132 ESLLLKRLEMDIPIGKHISAFMSQLVIPGPFLLDSALPELHRLADDMIYFSNEKDHHDFA 191

Query: 182 WYSKRLAISTAYVSSELFMAQDKSIDYQDTVKFAKEKLKNIKQLGEAYNNVEEYAWYTLL 241
           WYSKRL +S+AY+SS+LFMAQD S +Y++T++FAK+KL+ + +LG+ YNN EEYAWY LL
Sbjct: 192 WYSKRLGVSSAYISSKLFMAQDNSCNYKETLQFAKDKLEKVMRLGDYYNNTEEYAWYVLL 251

Query: 242 SSISLAKSQMTRS 254
           +S+++ KS+M+R+
Sbjct: 252 NSVNMVKSRMSRA 264

>NCAS0E02870 Chr5 complement(561968..562753) [786 bp, 261 aa] {ON}
           Anc_7.351 YLR201C
          Length = 261

 Score =  247 bits (631), Expect = 8e-82,   Method: Compositional matrix adjust.
 Identities = 132/247 (53%), Positives = 174/247 (70%), Gaps = 4/247 (1%)

Query: 12  RGYHPNNLEHASSKVLPPLIYSKDSPQWKILANALDEQVPKYGFNERALTSSCSDLGYSS 71
           R YHP+  E+     L PL Y+K+S Q+KIL+NAL + VPK+GF E+A+T S ++LG+SS
Sbjct: 15  RSYHPSLKEYVKPATLSPLTYNKESVQYKILSNALTKWVPKHGFKEKAITDSLNELGFSS 74

Query: 72  SFLSVLGXXXXXXXXXXXX-XVLELLKFHLVSKRYSLTDGVADGTL---ESPSLENLFLK 127
           S LSV+G              V+EL+KF LVSKRY LT+ +   T    E PSLE+L LK
Sbjct: 75  SLLSVIGASNSPAIFRSISPAVMELIKFQLVSKRYELTENLCPDTTPKNELPSLESLLLK 134

Query: 128 RLEMNKPIAAHLSQLLSCLALPGAFLAEYAIPELHRLSDDMVYFSNEPDHNDFAWYSKRL 187
           RLEM+K I   +  L + LA P +FL + A+PELHRLSDDM+YFSNE DH+D AWY+KRL
Sbjct: 135 RLEMDKAIGKQIPHLFAELATPSSFLFDVALPELHRLSDDMIYFSNEKDHHDMAWYTKRL 194

Query: 188 AISTAYVSSELFMAQDKSIDYQDTVKFAKEKLKNIKQLGEAYNNVEEYAWYTLLSSISLA 247
            +S AYVSS+L+MAQD S D++DT+ FAK+KL  I +LGE YNN EEYAWY  + S +L 
Sbjct: 195 GVSCAYVSSKLYMAQDNSRDFEDTLSFAKDKLHRIMKLGEYYNNTEEYAWYMFMVSTNLV 254

Query: 248 KSQMTRS 254
           ++++ RS
Sbjct: 255 RARLARS 261

>CAGL0A03949g Chr1 (399220..400026) [807 bp, 268 aa] {ON} similar to
           uniprot|Q05779 Saccharomyces cerevisiae YLR201c
          Length = 268

 Score =  246 bits (629), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 110/246 (44%), Positives = 175/246 (71%), Gaps = 2/246 (0%)

Query: 10  ARRGYHPNNLEHASSKVLPPLIYSKDSPQWKILANALDEQVPKYGFNERALTSSCSDLGY 69
           A R YHP + E+ + KV  PL Y+ +SP++K+L++ ++  VP++GF E+A+ +S + +  
Sbjct: 22  AVRRYHPTSNEYVNPKVWEPLTYTPESPEFKLLSHTMENSVPQHGFTEKAIVNSLNAMKM 81

Query: 70  SSSFLSVLGXXXXXXXXXXXXXVLELLKFHLVSKRYSLTDGVADGTLES--PSLENLFLK 127
            S  L+ +G             V+EL+KF LV KR+ + +G+ +    S  PSLE+L LK
Sbjct: 82  PSGMLTTIGASNSATFLHSSPAVMELIKFQLVEKRHRMVEGITEIAEASKLPSLESLLLK 141

Query: 128 RLEMNKPIAAHLSQLLSCLALPGAFLAEYAIPELHRLSDDMVYFSNEPDHNDFAWYSKRL 187
           RL+M+ PIA+HL+Q+ + L +P +F+   ++PEL RL+DDM+Y+SNE DH+DFAWY+KR 
Sbjct: 142 RLKMDVPIASHLTQMTAQLMVPSSFMTNVSLPELERLADDMIYYSNEKDHHDFAWYTKRA 201

Query: 188 AISTAYVSSELFMAQDKSIDYQDTVKFAKEKLKNIKQLGEAYNNVEEYAWYTLLSSISLA 247
           A++T Y++S+ FMAQDKS ++ +T++FA++KL  +  LG+ YNNVEE+ W+TL+S+++L 
Sbjct: 202 ALATTYLASKAFMAQDKSHNFMETMEFAQDKLHKVMTLGDYYNNVEEFGWFTLMSAVNLT 261

Query: 248 KSQMTR 253
           KSQM R
Sbjct: 262 KSQMAR 267

>NDAI0E04470 Chr5 complement(1006109..1006903) [795 bp, 264 aa] {ON}
           Anc_7.351 YLR201C
          Length = 264

 Score =  238 bits (607), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 121/247 (48%), Positives = 165/247 (66%), Gaps = 5/247 (2%)

Query: 12  RGYHPNNLEHASSKVLPPLIYSKDSPQWKILANALDEQVPKYGFNERALTSSCSDLGYSS 71
           R +H N LE+A +  L PL Y+KDS Q+KIL+NAL++ VPK GF + A+TSS ++L  SS
Sbjct: 17  RAFHSNTLEYAKAATLSPLTYNKDSVQYKILSNALNKWVPKKGFTDEAITSSLNELDLSS 76

Query: 72  SFLSVLGXXXXXXXXXXXX-XVLELLKFHLVSKRYSLTDGVA----DGTLESPSLENLFL 126
           S  SVLG              V+ELLKF LVSKRY LT+ +         + PSLE L +
Sbjct: 77  SLFSVLGSSNSPSIFRSISPAVMELLKFQLVSKRYQLTENITPYIETAKDKLPSLETLLI 136

Query: 127 KRLEMNKPIAAHLSQLLSCLALPGAFLAEYAIPELHRLSDDMVYFSNEPDHNDFAWYSKR 186
           +RL+M++P+   LS L + L +P   L   A+PEL  LSDD++YFSNE DH+D AWY+KR
Sbjct: 137 ERLKMDQPLNNQLSSLFNQLIIPSPLLFNVALPELFNLSDDLIYFSNEKDHHDMAWYAKR 196

Query: 187 LAISTAYVSSELFMAQDKSIDYQDTVKFAKEKLKNIKQLGEAYNNVEEYAWYTLLSSISL 246
           L +S AYVSS+L+M ++   ++  T+ FAK+KL  I  LGE YNN EEYAWYTL+ S++L
Sbjct: 197 LGVSCAYVSSKLYMVKNNGENFDKTIDFAKDKLHRIMNLGEYYNNTEEYAWYTLMVSMNL 256

Query: 247 AKSQMTR 253
            K+++ R
Sbjct: 257 VKARLAR 263

>KAFR0L01480 Chr12 (274514..275308) [795 bp, 264 aa] {ON} Anc_7.351
           YLR201C
          Length = 264

 Score =  226 bits (577), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 123/246 (50%), Positives = 168/246 (68%), Gaps = 2/246 (0%)

Query: 8   KIARRGYHPNNLEHASSKVLPPLIYSKDSPQWKILANALDEQVPKYGFNERALTSSCSDL 67
           K  RR YHP + E+ +   + PL YS DS Q KIL+++L E VP  GFNE+++  S +DL
Sbjct: 20  KCLRRLYHPASNEYVNPTTISPLTYSMDSIQSKILSHSLKEYVPTSGFNEKSILKSINDL 79

Query: 68  GYSSSFLSVLGXXXXXXXXXXXXXVLELLKFHLVSKRYSLTDGVADGTLESPSLENLFLK 127
           GYSSS +SV+G             VLEL+K++LVSKR  LT    D T  +     L  K
Sbjct: 80  GYSSSMMSVIGASNSPSFAHSSPAVLELIKYNLVSKRIELTKDTNDNTTTTLKELLL--K 137

Query: 128 RLEMNKPIAAHLSQLLSCLALPGAFLAEYAIPELHRLSDDMVYFSNEPDHNDFAWYSKRL 187
           RLEM+ PI++ L  L + LA PG F+ + ++PEL +L+DDM++FSNE DH+D AWYSKRL
Sbjct: 138 RLEMDIPISSQLRGLFAQLATPGKFMFDVSLPELFQLADDMIFFSNEKDHHDMAWYSKRL 197

Query: 188 AISTAYVSSELFMAQDKSIDYQDTVKFAKEKLKNIKQLGEAYNNVEEYAWYTLLSSISLA 247
           A+S AYV+S++FM QD S ++Q T+ FA +K+  +  LGE YNNVEEYAW+TL++SI+L 
Sbjct: 198 AVSMAYVTSKMFMIQDTSNNFQMTMDFASDKVDRVMNLGEYYNNVEEYAWFTLMNSINLV 257

Query: 248 KSQMTR 253
           KSQ +R
Sbjct: 258 KSQFSR 263

>YDR096W Chr4 (637139..639823) [2685 bp, 894 aa] {ON}  GIS1JmjC
           domain-containing histone demethylase and transcription
           factor; involved in expression of genes during nutrient
           limitation; negatively regulates DPP1 and PHR1; activity
           is modulated by limited proteasome-mediated proteolysis;
           has a JmjC and a JmjN domain in the N-terminal region
           that interact, promoting Gis1p stability and proper
           transcriptional activity; contains transactivating
           domains TAD1 and TAD2 downstream of the Jmj domains and
           a C-terminal DNA binding domain
          Length = 894

 Score = 30.4 bits (67), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 11/27 (40%), Positives = 18/27 (66%)

Query: 38  QWKILANALDEQVPKYGFNERALTSSC 64
           QWK LA +LD ++ +  FN++ L  +C
Sbjct: 102 QWKNLAESLDSRISQGDFNDKTLKENC 128

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.131    0.375 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 25,116,584
Number of extensions: 987415
Number of successful extensions: 2963
Number of sequences better than 10.0: 32
Number of HSP's gapped: 3006
Number of HSP's successfully gapped: 32
Length of query: 254
Length of database: 53,481,399
Length adjustment: 107
Effective length of query: 147
Effective length of database: 41,212,137
Effective search space: 6058184139
Effective search space used: 6058184139
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 64 (29.3 bits)