Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0F11374g7.350ON38338319520.0
Kwal_56.246427.350ON38138317660.0
KLTH0H01254g7.350ON38138317530.0
NCAS0A141607.350ON45138317340.0
KLLA0D12342g7.350ON38438216960.0
TDEL0C019807.350ON38538016870.0
ACL148C7.350ON38138116720.0
TBLA0E00390singletonON38338316660.0
Ecym_47237.350ON38138116510.0
Kpol_530.317.350ON38037816460.0
ZYRO0F11704g7.350ON38237916460.0
CAGL0L01111g7.350ON38138016350.0
YDL168W (SFA1)7.350ON38637816180.0
Suva_4.787.350ON38538216170.0
Skud_4.897.350ON38538316140.0
Smik_4.707.350ON38638216060.0
TPHA0F029707.350ON38137815960.0
KAFR0B008807.350ON38138115130.0
NDAI0A018907.350ON42238314720.0
KNAG0C037907.350ON38238713880.0
SAKL0A00880gsingletonON38837611321e-154
CAGL0J01441g2.480ON3723522813e-27
KLLA0D19929gsingletonON3863782762e-26
KNAG0K020003.118ON3503942627e-25
NCAS0I023503.118ON3513872611e-24
Ecym_53313.118ON3483482611e-24
KLLA0B00451gsingletonON3863802593e-24
TBLA0I011402.480ON3772642551e-23
Suva_4.3943.118ON3513872522e-23
KLTH0G15686g3.118ON3513902513e-23
AER032W3.118ON3512642513e-23
KLLA0F21010g3.118ON3502642494e-23
KAFR0G014203.118ON3513902495e-23
SAKL0B00814g8.16ON3543872487e-23
NCAS0I01720singletonON3513802478e-23
KLLA0B09064gna 1ON3743812462e-22
SAKL0C10164g3.118ON3513872452e-22
Ecym_73912.480ON3753872443e-22
KLTH0D05588g2.480ON3893732427e-22
KLTH0G18986g8.16ON3543682408e-22
NDAI0A069303.118ON3513872409e-22
TPHA0M007303.118ON3503902391e-21
SAKL0F06270gna 2ON3513872381e-21
ZYRO0G03388g2.480ON3703872391e-21
Suva_13.2612.480ON3753872392e-21
CAGL0I07843g3.118ON3522642372e-21
TPHA0G032102.480ON3773802372e-21
KAFR0A007902.480ON3772712373e-21
Smik_13.520na 3ON3483022354e-21
YOL086C (ADH1)3.118ON3483832354e-21
Skud_13.2402.480ON3753872354e-21
KAFR0L02010singletonON3513832345e-21
TDEL0A025602.480ON3733872355e-21
KLLA0F13530g2.480ON3752712355e-21
SAKL0B08184gna 1ON3733742346e-21
YMR083W (ADH3)2.480ON3753872347e-21
KLTH0E05588gna 2ON3482642338e-21
Skud_13.477na 3ON3483482329e-21
KLLA0F18260gsingletonON3482662311e-20
Smik_13.2662.480ON3753872321e-20
Smik_15.713.118ON3483022311e-20
YBR145W (ADH5)3.118ON3513752311e-20
ZYRO0B05940g3.118ON3793912321e-20
Suva_13.494na 3ON3483482302e-20
NDAI0H021602.480ON3813802302e-20
YMR303C (ADH2)na 3ON3483482293e-20
Skud_2.2723.118ON3513802283e-20
TBLA0E03430singletonON3513832284e-20
Kwal_26.77992.480ON3873802285e-20
TBLA0E034403.118ON3512642267e-20
Skud_15.683.118ON3483022257e-20
AAR084WsingletonON3852642268e-20
SAKL0E02838g2.480ON3772642269e-20
Suva_15.813.118ON3483802259e-20
Smik_2.2843.118ON3513802232e-19
Smik_48.1singletonON3573772232e-19
Kwal_55.19574singletonON3563602232e-19
ZYRO0G03410gsingletonON3733702232e-19
NCAS0A077802.480ON3732712205e-19
Kwal_26.6684singletonON3563692195e-19
Kwal_56.231983.118ON3512642187e-19
Kpol_1036.193.118ON3532842171e-18
KAFR0L02000singletonON3612642162e-18
ZYRO0C12562gna 2ON3483022152e-18
Skud_20.2singletonON3573692152e-18
Skud_4.2singletonON3573692152e-18
Kpol_431.82.480ON3802492152e-18
YJR159W (SOR1)na 4ON3573782143e-18
TDEL0D050503.118ON3512642133e-18
Suva_12.260singletonON3573782134e-18
TDEL0C003908.16ON3533832125e-18
ABL033C2.480ON3732992125e-18
YDL246C (SOR2)singletonON3573782116e-18
KLTH0D00616g7.3ON3823452117e-18
KNAG0E025902.480ON3742712118e-18
Kpol_1058.118.16ON3533492108e-18
CAGL0D00198g7.3ON3833182091e-17
YAL060W (BDH1)7.3ON3822782082e-17
TBLA0A042907.3ON3952792021e-16
TDEL0F03190na 2ON3512652002e-16
KNAG0K01040singletonON3913052012e-16
Smik_1.67.3ON3822782002e-16
ABR229C8.16ON3533621992e-16
Suva_10.1548.16ON3563891992e-16
KLLA0F00506g7.3ON3852792002e-16
Kwal_55.20564singletonON2162301914e-16
KLTH0A00418gsingletonON3562611975e-16
TDEL0H044607.3ON3822781976e-16
ZYRO0F02552g8.16ON3513541957e-16
YLR070C (XYL2)8.16ON3563531941e-15
Skud_1.37.3ON3822781951e-15
Kwal_26.67397.3ON3823151932e-15
NDAI0H020507.3ON3853101922e-15
NCAS0J003008.16ON3572791894e-15
SAKL0D14872g7.3ON3833011871e-14
KLLA0D05511g8.16ON3543881861e-14
Kpol_1049.187.2ON3862911861e-14
KAFR0I001607.2ON3853441861e-14
SAKL0D14894g7.2ON3853071852e-14
Suva_1.77.3ON3822801852e-14
NCAS0A076707.2ON4393051729e-13
YAL061W (BDH2)7.2ON4172791711e-12
YBR046C (ZTA1)3.253ON3342441692e-12
KNAG0I00120singletonON3812751657e-12
Skud_1.27.2ON4172771631e-11
KLLA0F00528g7.2ON3812941622e-11
Smik_1.57.2ON4172771603e-11
Suva_1.67.2ON4172781585e-11
Smik_2.1703.253ON3342471567e-11
TDEL0D037203.253ON3352491551e-10
KAFR0I001707.3ON3813191551e-10
NCAS0A076607.3ON3862841551e-10
Kwal_56.229853.253ON3463451541e-10
TPHA0H03100singletonON3922791523e-10
Skud_2.1623.253ON3342451495e-10
KAFR0C005803.253ON3342751471e-09
KNAG0D00110singletonON3623421471e-09
NDAI0A063203.253ON3492441433e-09
KLTH0C07854g3.253ON3583621416e-09
KNAG0E042007.2ON3853441363e-08
Kwal_47.17532na 5ON3733451354e-08
KLLA0A10549g3.253ON353891327e-08
SAKL0D03872g3.253ON3483601311e-07
NDAI0H02950singletonON3633071301e-07
Suva_4.2793.253ON3342481292e-07
SAKL0H22088gna 5ON3763081292e-07
SAKL0D14938gsingletonON3783221283e-07
NDAI0H020607.2ON3993041257e-07
TPHA0J00170singletonON3613431184e-06
ZYRO0A03366g3.253ON3493431184e-06
ABL090W3.253ON3342551184e-06
KLTH0E07964gna 5ON3742951141e-05
KLTH0B04972gna 6ON3603611142e-05
NCAS0C03020singletonON3623481132e-05
KAFR0A08730singletonON3603091104e-05
NDAI0G04880singletonON3613201105e-05
CAGL0H06853gsingletonON3603181061e-04
TPHA0M009303.253ON3432621052e-04
NDAI0A08470singletonON3633521042e-04
NCAS0D01220na 7ON362961025e-04
NCAS0I017303.253ON349911008e-04
CAGL0H09944g3.253ON333339990.001
CAGL0M14047gna 8ON359334980.001
NDAI0H02940na 7ON361105940.004
Suva_13.513na 8ON360316940.004
Skud_86.1singletonON8959860.004
KNAG0B06990singletonON358308930.005
KLTH0B00506gna 9ON398321920.007
Skud_13.494na 8ON360316900.011
KLLA0E19889gna 6ON366108900.011
KNAG0K02680singletonON359284860.036
Smik_13.535na 8ON360316850.044
SAKL0H00374gsingletonON428316850.047
SAKL0C00264gsingletonON359348850.048
Kpol_257.4singletonON360108840.073
KLLA0F00638gna 9ON382247830.084
YMR318C (ADH6)na 8ON360350830.090
Smik_26.3singletonON12593760.21
Kpol_529.30na 8ON360108790.25
Ecym_1093singletonON383295790.25
Suva_6.13singletonON6859720.27
TDEL0F02300na 5ON379300790.29
TPHA0A00140singletonON362366790.31
ZYRO0G10318gna 5ON37698780.37
TDEL0A00140singletonON405275770.50
Kpol_1057.24na 10ON36093741.1
Smik_14.1932.133ON376126741.1
Kpol_526.18singletonON36198721.8
KAFR0H03770singletonON36596712.8
Ecym_53113.191ON28790703.1
KAFR0C01550singletonON35995695.0
Kwal_26.9050singletonON364225695.1
Kwal_8.605singletonON379230678.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0F11374g
         (383 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0F11374g Chr6 complement(885478..886629) [1152 bp, 383 aa] {...   756   0.0  
Kwal_56.24642 s56 complement(1085556..1086701) [1146 bp, 381 aa]...   684   0.0  
KLTH0H01254g Chr8 (121076..122221) [1146 bp, 381 aa] {ON} highly...   679   0.0  
NCAS0A14160 Chr1 complement(2782022..2783377) [1356 bp, 451 aa] ...   672   0.0  
KLLA0D12342g Chr4 (1050181..1051335) [1155 bp, 384 aa] {ON} high...   657   0.0  
TDEL0C01980 Chr3 (344639..345796) [1158 bp, 385 aa] {ON} Anc_7.3...   654   0.0  
ACL148C Chr3 complement(90932..92077) [1146 bp, 381 aa] {ON} Syn...   648   0.0  
TBLA0E00390 Chr5 complement(71890..73041) [1152 bp, 383 aa] {ON}      646   0.0  
Ecym_4723 Chr4 (1415078..1416223) [1146 bp, 381 aa] {ON} similar...   640   0.0  
Kpol_530.31 s530 (77132..78274) [1143 bp, 380 aa] {ON} (77132..7...   638   0.0  
ZYRO0F11704g Chr6 complement(958546..959694) [1149 bp, 382 aa] {...   638   0.0  
CAGL0L01111g Chr12 (133129..134274) [1146 bp, 381 aa] {ON} highl...   634   0.0  
YDL168W Chr4 (159604..160764) [1161 bp, 386 aa] {ON}  SFA1Bifunc...   627   0.0  
Suva_4.78 Chr4 (147109..148266) [1158 bp, 385 aa] {ON} YDL168W (...   627   0.0  
Skud_4.89 Chr4 (155298..156455) [1158 bp, 385 aa] {ON} YDL168W (...   626   0.0  
Smik_4.70 Chr4 (136242..137402) [1161 bp, 386 aa] {ON} YDL168W (...   623   0.0  
TPHA0F02970 Chr6 complement(653405..654550) [1146 bp, 381 aa] {O...   619   0.0  
KAFR0B00880 Chr2 complement(164475..165620) [1146 bp, 381 aa] {O...   587   0.0  
NDAI0A01890 Chr1 (425090..426358) [1269 bp, 422 aa] {ON} Anc_7.350    571   0.0  
KNAG0C03790 Chr3 complement(745394..746542) [1149 bp, 382 aa] {O...   539   0.0  
SAKL0A00880g Chr1 complement(92246..93412) [1167 bp, 388 aa] {ON...   440   e-154
CAGL0J01441g Chr10 complement(134383..135501) [1119 bp, 372 aa] ...   112   3e-27
KLLA0D19929g Chr4 (1694826..1695986) [1161 bp, 386 aa] {ON} weak...   110   2e-26
KNAG0K02000 Chr11 (410263..411315) [1053 bp, 350 aa] {ON} Anc_3....   105   7e-25
NCAS0I02350 Chr9 (444097..445152) [1056 bp, 351 aa] {ON} Anc_3.118    105   1e-24
Ecym_5331 Chr5 (676233..677279) [1047 bp, 348 aa] {ON} similar t...   105   1e-24
KLLA0B00451g Chr2 complement(31822..32982) [1161 bp, 386 aa] {ON...   104   3e-24
TBLA0I01140 Chr9 (233777..234910) [1134 bp, 377 aa] {ON} Anc_2.4...   102   1e-23
Suva_4.394 Chr4 (702935..703990) [1056 bp, 351 aa] {ON} YBR145W ...   101   2e-23
KLTH0G15686g Chr7 complement(1367997..1369052) [1056 bp, 351 aa]...   101   3e-23
AER032W Chr5 (696807..697862) [1056 bp, 351 aa] {ON} Syntenic ho...   101   3e-23
KLLA0F21010g Chr6 (1962951..1964003) [1053 bp, 350 aa] {ON} unip...   100   4e-23
KAFR0G01420 Chr7 complement(314119..315174) [1056 bp, 351 aa] {O...   100   5e-23
SAKL0B00814g Chr2 (74565..75629) [1065 bp, 354 aa] {ON} similar ...   100   7e-23
NCAS0I01720 Chr9 (318144..319199) [1056 bp, 351 aa] {ON}              100   8e-23
KLLA0B09064g Chr2 complement(792849..793973) [1125 bp, 374 aa] {...    99   2e-22
SAKL0C10164g Chr3 complement(914732..915787) [1056 bp, 351 aa] {...    99   2e-22
Ecym_7391 Chr7 (801773..802900) [1128 bp, 375 aa] {ON} similar t...    99   3e-22
KLTH0D05588g Chr4 complement(502176..503345) [1170 bp, 389 aa] {...    98   7e-22
KLTH0G18986g Chr7 complement(1639254..1640318) [1065 bp, 354 aa]...    97   8e-22
NDAI0A06930 Chr1 (1585575..1586630) [1056 bp, 351 aa] {ON} Anc_3...    97   9e-22
TPHA0M00730 Chr13 complement(137798..138850) [1053 bp, 350 aa] {...    97   1e-21
SAKL0F06270g Chr6 (472877..473932) [1056 bp, 351 aa] {ON} simila...    96   1e-21
ZYRO0G03388g Chr7 complement(265952..267064) [1113 bp, 370 aa] {...    97   1e-21
Suva_13.261 Chr13 (416378..417505) [1128 bp, 375 aa] {ON} YMR083...    97   2e-21
CAGL0I07843g Chr9 complement(756345..757403) [1059 bp, 352 aa] {...    96   2e-21
TPHA0G03210 Chr7 complement(688137..689270) [1134 bp, 377 aa] {O...    96   2e-21
KAFR0A00790 Chr1 complement(140666..141799) [1134 bp, 377 aa] {O...    96   3e-21
Smik_13.520 Chr13 complement(856008..857054) [1047 bp, 348 aa] {...    95   4e-21
YOL086C Chr15 complement(159548..160594) [1047 bp, 348 aa] {ON} ...    95   4e-21
Skud_13.240 Chr13 (408909..410036) [1128 bp, 375 aa] {ON} YMR083...    95   4e-21
KAFR0L02010 Chr12 (379623..380678) [1056 bp, 351 aa] {ON}              95   5e-21
TDEL0A02560 Chr1 complement(462053..463174) [1122 bp, 373 aa] {O...    95   5e-21
KLLA0F13530g Chr6 (1251162..1252289) [1128 bp, 375 aa] {ON} unip...    95   5e-21
SAKL0B08184g Chr2 (698686..699807) [1122 bp, 373 aa] {ON} unipro...    95   6e-21
YMR083W Chr13 (434788..435915) [1128 bp, 375 aa] {ON}  ADH3Mitoc...    95   7e-21
KLTH0E05588g Chr5 complement(494815..495861) [1047 bp, 348 aa] {...    94   8e-21
Skud_13.477 Chr13 complement(846790..847836) [1047 bp, 348 aa] {...    94   9e-21
KLLA0F18260g Chr6 complement(1683417..1684463) [1047 bp, 348 aa]...    94   1e-20
Smik_13.266 Chr13 (418869..419996) [1128 bp, 375 aa] {ON} YMR083...    94   1e-20
Smik_15.71 Chr15 complement(122645..123691) [1047 bp, 348 aa] {O...    94   1e-20
YBR145W Chr2 (533762..534817) [1056 bp, 351 aa] {ON}  ADH5Alcoho...    94   1e-20
ZYRO0B05940g Chr2 (480279..481418) [1140 bp, 379 aa] {ON} highly...    94   1e-20
Suva_13.494 Chr13 complement(856051..857097) [1047 bp, 348 aa] {...    93   2e-20
NDAI0H02160 Chr8 (528551..529696) [1146 bp, 381 aa] {ON} Anc_2.480     93   2e-20
YMR303C Chr13 complement(873291..874337) [1047 bp, 348 aa] {ON} ...    93   3e-20
Skud_2.272 Chr2 (501260..502315) [1056 bp, 351 aa] {ON} YBR145W ...    92   3e-20
TBLA0E03430 Chr5 (850493..851548) [1056 bp, 351 aa] {ON}               92   4e-20
Kwal_26.7799 s26 complement(515580..516743) [1164 bp, 387 aa] {O...    92   5e-20
TBLA0E03440 Chr5 (852767..853822) [1056 bp, 351 aa] {ON} Anc_3.1...    92   7e-20
Skud_15.68 Chr15 complement(118795..119841) [1047 bp, 348 aa] {O...    91   7e-20
AAR084W Chr1 (494021..495178) [1158 bp, 385 aa] {ON} Non-synteni...    92   8e-20
SAKL0E02838g Chr5 (226264..227397) [1134 bp, 377 aa] {ON} unipro...    92   9e-20
Suva_15.81 Chr15 complement(132739..133785) [1047 bp, 348 aa] {O...    91   9e-20
Smik_2.284 Chr2 (518341..519396) [1056 bp, 351 aa] {ON} YBR145W ...    91   2e-19
Smik_48.1 Chr48 complement(1..1074) [1074 bp, 357 aa] {ON} YJR15...    91   2e-19
Kwal_55.19574 s55 complement(32260..33330) [1071 bp, 356 aa] {ON...    91   2e-19
ZYRO0G03410g Chr7 complement(269170..270291) [1122 bp, 373 aa] {...    91   2e-19
NCAS0A07780 Chr1 (1548197..1549318) [1122 bp, 373 aa] {ON} Anc_2...    89   5e-19
Kwal_26.6684 s26 (21910..22980) [1071 bp, 356 aa] {ON} YJR159W (...    89   5e-19
Kwal_56.23198 s56 (443881..444936) [1056 bp, 351 aa] {ON} YOL086...    89   7e-19
Kpol_1036.19 s1036 (51276..52337) [1062 bp, 353 aa] {ON} (51276....    88   1e-18
KAFR0L02000 Chr12 (378013..379098) [1086 bp, 361 aa] {ON}              88   2e-18
ZYRO0C12562g Chr3 (993434..994480) [1047 bp, 348 aa] {ON} highly...    87   2e-18
Skud_20.2 Chr20 (1588..2661) [1074 bp, 357 aa] {ON} YJR159W (REAL)     87   2e-18
Skud_4.2 Chr4 complement(6287..7360) [1074 bp, 357 aa] {ON} YJR1...    87   2e-18
Kpol_431.8 s431 (21043..22185) [1143 bp, 380 aa] {ON} (21043..22...    87   2e-18
YJR159W Chr10 (736044..737117) [1074 bp, 357 aa] {ON}  SOR1Sorbi...    87   3e-18
TDEL0D05050 Chr4 (921065..922120) [1056 bp, 351 aa] {ON} Anc_3.1...    87   3e-18
Suva_12.260 Chr12 (427406..428479) [1074 bp, 357 aa] {ON} YJR159...    87   4e-18
TDEL0C00390 Chr3 (53995..55056) [1062 bp, 353 aa] {ON} Anc_8.16 ...    86   5e-18
ABL033C Chr2 complement(337866..338987) [1122 bp, 373 aa] {ON} S...    86   5e-18
YDL246C Chr4 complement(8683..9756) [1074 bp, 357 aa] {ON}  SOR2...    86   6e-18
KLTH0D00616g Chr4 (59883..61031) [1149 bp, 382 aa] {ON} similar ...    86   7e-18
KNAG0E02590 Chr5 complement(513565..514689) [1125 bp, 374 aa] {O...    86   8e-18
Kpol_1058.11 s1058 (41165..42226) [1062 bp, 353 aa] {ON} (41165....    86   8e-18
CAGL0D00198g Chr4 (27559..28710) [1152 bp, 383 aa] {ON} similar ...    85   1e-17
YAL060W Chr1 (35155..36303) [1149 bp, 382 aa] {ON}  BDH1NAD-depe...    85   2e-17
TBLA0A04290 Chr1 (1063289..1064476) [1188 bp, 395 aa] {ON} Anc_7...    82   1e-16
TDEL0F03190 Chr6 (583849..584904) [1056 bp, 351 aa] {ON}  possib...    82   2e-16
KNAG0K01040 Chr11 complement(204636..205811) [1176 bp, 391 aa] {...    82   2e-16
Smik_1.6 Chr1 (18115..19263) [1149 bp, 382 aa] {ON} YAL060W (REAL)     82   2e-16
ABR229C Chr2 complement(831895..832956) [1062 bp, 353 aa] {ON} S...    81   2e-16
Suva_10.154 Chr10 complement(275737..276807) [1071 bp, 356 aa] {...    81   2e-16
KLLA0F00506g Chr6 complement(36518..37675) [1158 bp, 385 aa] {ON...    82   2e-16
Kwal_55.20564 s55 complement(459253..459903) [651 bp, 216 aa] {O...    78   4e-16
KLTH0A00418g Chr1 complement(34685..35755) [1071 bp, 356 aa] {ON...    80   5e-16
TDEL0H04460 Chr8 complement(769988..771136) [1149 bp, 382 aa] {O...    80   6e-16
ZYRO0F02552g Chr6 (203037..204092) [1056 bp, 351 aa] {ON} simila...    80   7e-16
YLR070C Chr12 complement(274141..275211) [1071 bp, 356 aa] {ON} ...    79   1e-15
Skud_1.3 Chr1 (11174..12322) [1149 bp, 382 aa] {ON} YAL060W (REAL)     80   1e-15
Kwal_26.6739 s26 (46044..47192) [1149 bp, 382 aa] {ON} YAL060W (...    79   2e-15
NDAI0H02050 Chr8 complement(500914..502071) [1158 bp, 385 aa] {O...    79   2e-15
NCAS0J00300 Chr10 (43719..44792) [1074 bp, 357 aa] {ON} Anc_8.16       77   4e-15
SAKL0D14872g Chr4 complement(1226093..1227244) [1152 bp, 383 aa]...    77   1e-14
KLLA0D05511g Chr4 complement(476363..477427) [1065 bp, 354 aa] {...    76   1e-14
Kpol_1049.18 s1049 complement(35191..36351) [1161 bp, 386 aa] {O...    76   1e-14
KAFR0I00160 Chr9 (33043..34200) [1158 bp, 385 aa] {ON} Anc_7.2 Y...    76   1e-14
SAKL0D14894g Chr4 complement(1230497..1231654) [1158 bp, 385 aa]...    76   2e-14
Suva_1.7 Chr1 (12310..13458) [1149 bp, 382 aa] {ON} YAL060W (REAL)     76   2e-14
NCAS0A07670 Chr1 complement(1527273..1528592) [1320 bp, 439 aa] ...    71   9e-13
YAL061W Chr1 (33448..34701) [1254 bp, 417 aa] {ON}  BDH2Putative...    70   1e-12
YBR046C Chr2 complement(330507..331511) [1005 bp, 334 aa] {ON}  ...    70   2e-12
KNAG0I00120 Chr9 (9352..10497) [1146 bp, 381 aa] {ON}                  68   7e-12
Skud_1.2 Chr1 (9513..10766) [1254 bp, 417 aa] {ON} YAL061W (REAL)      67   1e-11
KLLA0F00528g Chr6 complement(40081..41226) [1146 bp, 381 aa] {ON...    67   2e-11
Smik_1.5 Chr1 (16385..17638) [1254 bp, 417 aa] {ON} YAL061W (REAL)     66   3e-11
Suva_1.6 Chr1 (10591..11844) [1254 bp, 417 aa] {ON} YAL061W (REAL)     65   5e-11
Smik_2.170 Chr2 complement(312211..313215) [1005 bp, 334 aa] {ON...    65   7e-11
TDEL0D03720 Chr4 (683833..684840) [1008 bp, 335 aa] {ON} Anc_3.2...    64   1e-10
KAFR0I00170 Chr9 (34519..35664) [1146 bp, 381 aa] {ON} Anc_7.3 Y...    64   1e-10
NCAS0A07660 Chr1 complement(1525755..1526915) [1161 bp, 386 aa] ...    64   1e-10
Kwal_56.22985 s56 complement(357501..358541) [1041 bp, 346 aa] {...    64   1e-10
TPHA0H03100 Chr8 complement(736924..738102) [1179 bp, 392 aa] {O...    63   3e-10
Skud_2.162 Chr2 complement(299642..300646) [1005 bp, 334 aa] {ON...    62   5e-10
KAFR0C00580 Chr3 (113544..114548) [1005 bp, 334 aa] {ON} Anc_3.2...    61   1e-09
KNAG0D00110 Chr4 (3538..4626) [1089 bp, 362 aa] {ON}                   61   1e-09
NDAI0A06320 Chr1 (1438393..1439442) [1050 bp, 349 aa] {ON} Anc_3...    60   3e-09
KLTH0C07854g Chr3 (673945..675021) [1077 bp, 358 aa] {ON} simila...    59   6e-09
KNAG0E04200 Chr5 complement(837232..838389) [1158 bp, 385 aa] {O...    57   3e-08
Kwal_47.17532 s47 (444594..445715) [1122 bp, 373 aa] {ON} YMR318...    57   4e-08
KLLA0A10549g Chr1 (921022..922083) [1062 bp, 353 aa] {ON} highly...    55   7e-08
SAKL0D03872g Chr4 (316127..317173) [1047 bp, 348 aa] {ON} highly...    55   1e-07
NDAI0H02950 Chr8 complement(718762..719853) [1092 bp, 363 aa] {O...    55   1e-07
Suva_4.279 Chr4 complement(495380..496384) [1005 bp, 334 aa] {ON...    54   2e-07
SAKL0H22088g Chr8 (1934171..1935301) [1131 bp, 376 aa] {ON} simi...    54   2e-07
SAKL0D14938g Chr4 complement(1235542..1236678) [1137 bp, 378 aa]...    54   3e-07
NDAI0H02060 Chr8 complement(502872..504071) [1200 bp, 399 aa] {O...    53   7e-07
TPHA0J00170 Chr10 (40911..41996) [1086 bp, 361 aa] {ON}                50   4e-06
ZYRO0A03366g Chr1 (271779..272828) [1050 bp, 349 aa] {ON} highly...    50   4e-06
ABL090W Chr2 (230699..231703) [1005 bp, 334 aa] {ON} Syntenic ho...    50   4e-06
KLTH0E07964g Chr5 (735214..736338) [1125 bp, 374 aa] {ON} simila...    49   1e-05
KLTH0B04972g Chr2 (408153..409235) [1083 bp, 360 aa] {ON} highly...    49   2e-05
NCAS0C03020 Chr3 complement(593785..594873) [1089 bp, 362 aa] {O...    48   2e-05
KAFR0A08730 Chr1 complement(1747657..1748739) [1083 bp, 360 aa] ...    47   4e-05
NDAI0G04880 Chr7 complement(1175518..1176603) [1086 bp, 361 aa] ...    47   5e-05
CAGL0H06853g Chr8 complement(680184..681266) [1083 bp, 360 aa] {...    45   1e-04
TPHA0M00930 Chr13 complement(180084..181115) [1032 bp, 343 aa] {...    45   2e-04
NDAI0A08470 Chr1 (1954035..1955126) [1092 bp, 363 aa] {ON}             45   2e-04
NCAS0D01220 Chr4 (223821..224909) [1089 bp, 362 aa] {ON}               44   5e-04
NCAS0I01730 Chr9 (319449..320498) [1050 bp, 349 aa] {ON} Anc_3.253     43   8e-04
CAGL0H09944g Chr8 complement(971519..972520) [1002 bp, 333 aa] {...    43   0.001
CAGL0M14047g Chr13 complement(1386775..1387854) [1080 bp, 359 aa...    42   0.001
NDAI0H02940 Chr8 complement(717073..718158) [1086 bp, 361 aa] {O...    41   0.004
Suva_13.513 Chr13 complement(894394..895476) [1083 bp, 360 aa] {...    41   0.004
Skud_86.1 Chr86 complement(469..738) [270 bp, 89 aa] {ON} YJR159...    38   0.004
KNAG0B06990 Chr2 (1393058..1394134) [1077 bp, 358 aa] {ON}             40   0.005
KLTH0B00506g Chr2 complement(53662..54858) [1197 bp, 398 aa] {ON...    40   0.007
Skud_13.494 Chr13 complement(884038..885120) [1083 bp, 360 aa] {...    39   0.011
KLLA0E19889g Chr5 (1770061..1771161) [1101 bp, 366 aa] {ON} simi...    39   0.011
KNAG0K02680 Chr11 complement(531173..532252) [1080 bp, 359 aa] {...    38   0.036
Smik_13.535 Chr13 complement(893727..894809) [1083 bp, 360 aa] {...    37   0.044
SAKL0H00374g Chr8 (45725..47011) [1287 bp, 428 aa] {ON} weakly s...    37   0.047
SAKL0C00264g Chr3 complement(17429..18508) [1080 bp, 359 aa] {ON...    37   0.048
Kpol_257.4 s257 complement(12348..13430) [1083 bp, 360 aa] {ON} ...    37   0.073
KLLA0F00638g Chr6 (51849..52997) [1149 bp, 382 aa] {ON} weakly s...    37   0.084
YMR318C Chr13 complement(911061..912143) [1083 bp, 360 aa] {ON} ...    37   0.090
Smik_26.3 Chr26 (2136..2513) [378 bp, 125 aa] {ON} YMR318C (REAL)      34   0.21 
Kpol_529.30 s529 (89344..90426) [1083 bp, 360 aa] {ON} (89344..9...    35   0.25 
Ecym_1093 Chr1 complement(195854..197005) [1152 bp, 383 aa] {ON}...    35   0.25 
Suva_6.13 Chr6 (21861..22031,22035..22067) [204 bp, 68 aa] {ON} ...    32   0.27 
TDEL0F02300 Chr6 complement(421372..422511) [1140 bp, 379 aa] {O...    35   0.29 
TPHA0A00140 Chr1 (14857..15945) [1089 bp, 362 aa] {ON}                 35   0.31 
ZYRO0G10318g Chr7 (831554..832684) [1131 bp, 376 aa] {ON} simila...    35   0.37 
TDEL0A00140 Chr1 (23016..24233) [1218 bp, 405 aa] {ON}                 34   0.50 
Kpol_1057.24 s1057 (53467..54549) [1083 bp, 360 aa] {ON} (53467....    33   1.1  
Smik_14.193 Chr14 complement(352041..353171) [1131 bp, 376 aa] {...    33   1.1  
Kpol_526.18 s526 (51360..52445) [1086 bp, 361 aa] {ON} (51360..5...    32   1.8  
KAFR0H03770 Chr8 complement(715399..716496) [1098 bp, 365 aa] {O...    32   2.8  
Ecym_5311 Chr5 complement(631236..632099) [864 bp, 287 aa] {ON} ...    32   3.1  
KAFR0C01550 Chr3 complement(318350..319429) [1080 bp, 359 aa] {O...    31   5.0  
Kwal_26.9050 s26 (1055019..1056113) [1095 bp, 364 aa] {ON} YCR10...    31   5.1  
Kwal_8.605 s8 (25017..26156) [1140 bp, 379 aa] {ON} YCR105W - Hy...    30   8.1  

>SAKL0F11374g Chr6 complement(885478..886629) [1152 bp, 383 aa] {ON}
           highly similar to uniprot|P32771 Saccharomyces
           cerevisiae YDL168W SFA1 Long-chain alcohol dehydrogenase
           (glutathione-dependent formaldehyde dehydrogenase)
          Length = 383

 Score =  756 bits (1952), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/383 (96%), Positives = 371/383 (96%)

Query: 1   MSETVGKPITCLAAVAYEAGKPLTVEEIIVEPPKAHEVRIRITYTAVCHTDAYTLSGVDP 60
           MSETVGKPITCLAAVAYEAGKPLTVEEIIVEPPKAHEVRIRITYTAVCHTDAYTLSGVDP
Sbjct: 1   MSETVGKPITCLAAVAYEAGKPLTVEEIIVEPPKAHEVRIRITYTAVCHTDAYTLSGVDP 60

Query: 61  EGAFPSILGHEGAGVVESVGKGVTNVKPGDHVVALYTAECQKCKFCTSGKTNLCGSVRAT 120
           EGAFPSILGHEGAGVVESVGKGVTNVKPGDHVVALYTAECQKCKFCTSGKTNLCGSVRAT
Sbjct: 61  EGAFPSILGHEGAGVVESVGKGVTNVKPGDHVVALYTAECQKCKFCTSGKTNLCGSVRAT 120

Query: 121 QGKGVMPDGTSRFRTKNGESILHFMGCSTFSQYTXXXXXXXXXXXXQAPLDRICLLGCGV 180
           QGKGVMPDGTSRFRTKNGESILHFMGCSTFSQYT            QAPLDRICLLGCGV
Sbjct: 121 QGKGVMPDGTSRFRTKNGESILHFMGCSTFSQYTVVADVSVVAVDSQAPLDRICLLGCGV 180

Query: 181 TTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFG 240
           TTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFG
Sbjct: 181 TTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFG 240

Query: 241 ATDFVNPSKDLKEGETIVSKLIELTDGGLDFTFDCTGNTKVMRDALEACHKGWGQSIIIG 300
           ATDFVNPSKDLKEGETIVSKLIELTDGGLDFTFDCTGNTKVMRDALEACHKGWGQSIIIG
Sbjct: 241 ATDFVNPSKDLKEGETIVSKLIELTDGGLDFTFDCTGNTKVMRDALEACHKGWGQSIIIG 300

Query: 301 VAAAGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGQLKVDEFITHRRPFT 360
           VAAAGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGQLKVDEFITHRRPFT
Sbjct: 301 VAAAGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGQLKVDEFITHRRPFT 360

Query: 361 EINAAFDDLHHGDCLRTVLDLSK 383
           EINAAFDDLHHGDCLRTVLDLSK
Sbjct: 361 EINAAFDDLHHGDCLRTVLDLSK 383

>Kwal_56.24642 s56 complement(1085556..1086701) [1146 bp, 381 aa]
           {ON} YDL168W (SFA1) - Long-chain alcohol dehydrogenase
           (glutathione-dependent formaldehyde dehydrogenase)
           [contig 161] FULL
          Length = 381

 Score =  684 bits (1766), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/383 (85%), Positives = 355/383 (92%), Gaps = 2/383 (0%)

Query: 1   MSETVGKPITCLAAVAYEAGKPLTVEEIIVEPPKAHEVRIRITYTAVCHTDAYTLSGVDP 60
           MSE  GKPITCLAAVAYEAGKPLT+EEI+V+PPKAHEVR++I YTAVCHTDAYTLSGVDP
Sbjct: 1   MSE--GKPITCLAAVAYEAGKPLTIEEIVVDPPKAHEVRVKIAYTAVCHTDAYTLSGVDP 58

Query: 61  EGAFPSILGHEGAGVVESVGKGVTNVKPGDHVVALYTAECQKCKFCTSGKTNLCGSVRAT 120
           EGAFPSILGHEGAG+VES+G+GVTNVKPGDHV+ALYTAEC++CKFC SGKTNLCGSVRAT
Sbjct: 59  EGAFPSILGHEGAGIVESIGEGVTNVKPGDHVIALYTAECKECKFCKSGKTNLCGSVRAT 118

Query: 121 QGKGVMPDGTSRFRTKNGESILHFMGCSTFSQYTXXXXXXXXXXXXQAPLDRICLLGCGV 180
           QGKGVMPDGT+RF  K GE ILHFMGCSTFSQYT            +APLD+ CLLGCGV
Sbjct: 119 QGKGVMPDGTTRFHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGV 178

Query: 181 TTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFG 240
           TTGYGAA+KTANVQKGDTVAVFGAGTVGLSVVQGAK RGASRIIVVDINDQKKQWA++FG
Sbjct: 179 TTGYGAAVKTANVQKGDTVAVFGAGTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFG 238

Query: 241 ATDFVNPSKDLKEGETIVSKLIELTDGGLDFTFDCTGNTKVMRDALEACHKGWGQSIIIG 300
           ATDFVNPSKDLK+G+TIV  L+E+TDGGLD+TFDCTGNT VMR ALEACHKGWG+SIIIG
Sbjct: 239 ATDFVNPSKDLKDGKTIVDMLVEMTDGGLDYTFDCTGNTDVMRSALEACHKGWGESIIIG 298

Query: 301 VAAAGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGQLKVDEFITHRRPFT 360
           VAAAG+EISTRPFQLVTGRVWKGSAFGGIKGRSEMGGL+SDYMDG+LKVDEFITHRR FT
Sbjct: 299 VAAAGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLISDYMDGKLKVDEFITHRRGFT 358

Query: 361 EINAAFDDLHHGDCLRTVLDLSK 383
           +IN+AF+DLHHGDCLRTVLDL K
Sbjct: 359 DINSAFEDLHHGDCLRTVLDLLK 381

>KLTH0H01254g Chr8 (121076..122221) [1146 bp, 381 aa] {ON} highly
           similar to uniprot|P32771 Saccharomyces cerevisiae
           YDL168W SFA1 Long-chain alcohol dehydrogenase
           (glutathione-dependent formaldehyde dehydrogenase)
          Length = 381

 Score =  679 bits (1753), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/383 (85%), Positives = 352/383 (91%), Gaps = 2/383 (0%)

Query: 1   MSETVGKPITCLAAVAYEAGKPLTVEEIIVEPPKAHEVRIRITYTAVCHTDAYTLSGVDP 60
           MSE  GKPITC AAVAYEAGKPLTVEEI+V+PPKAHEVRI++ YTAVCHTDAYTLSGVDP
Sbjct: 1   MSE--GKPITCTAAVAYEAGKPLTVEEIVVDPPKAHEVRIKVEYTAVCHTDAYTLSGVDP 58

Query: 61  EGAFPSILGHEGAGVVESVGKGVTNVKPGDHVVALYTAECQKCKFCTSGKTNLCGSVRAT 120
           EGAFPSILGHEGAGVVESVG+GVTNVK GDHV+ALYTAEC++CKFC SGKTNLCGSVRAT
Sbjct: 59  EGAFPSILGHEGAGVVESVGEGVTNVKAGDHVIALYTAECKECKFCKSGKTNLCGSVRAT 118

Query: 121 QGKGVMPDGTSRFRTKNGESILHFMGCSTFSQYTXXXXXXXXXXXXQAPLDRICLLGCGV 180
           QGKGVMPDGTSRF  K GE +LHFMGCSTFSQYT            +APLD+ CLLGCGV
Sbjct: 119 QGKGVMPDGTSRFHNKKGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGV 178

Query: 181 TTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFG 240
           TTGYGAA+KTA+VQKGDTVA+FGAGTVGLSVVQGA  RGAS+IIVVDINDQKKQW+ DFG
Sbjct: 179 TTGYGAAVKTADVQKGDTVAIFGAGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFG 238

Query: 241 ATDFVNPSKDLKEGETIVSKLIELTDGGLDFTFDCTGNTKVMRDALEACHKGWGQSIIIG 300
           ATDFVNPSK LK+G+TIV KL+E+TDGGLDFTFDCTGNT VMR ALEACHKGWGQSIIIG
Sbjct: 239 ATDFVNPSKGLKDGQTIVDKLVEMTDGGLDFTFDCTGNTDVMRSALEACHKGWGQSIIIG 298

Query: 301 VAAAGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGQLKVDEFITHRRPFT 360
           VAAAG+EISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDG+LKVDEFITHRR FT
Sbjct: 299 VAAAGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGKLKVDEFITHRRGFT 358

Query: 361 EINAAFDDLHHGDCLRTVLDLSK 383
           +IN+AF+DLHHGDCLRTVLDLSK
Sbjct: 359 DINSAFEDLHHGDCLRTVLDLSK 381

>NCAS0A14160 Chr1 complement(2782022..2783377) [1356 bp, 451 aa]
           {ON} Anc_7.350
          Length = 451

 Score =  672 bits (1734), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/383 (83%), Positives = 348/383 (90%)

Query: 1   MSETVGKPITCLAAVAYEAGKPLTVEEIIVEPPKAHEVRIRITYTAVCHTDAYTLSGVDP 60
           MS T GKPITC AAVAY AGKPLTVE+I+V+PPKAHEVRI+I YTAVCHTDAYTLSG+DP
Sbjct: 69  MSSTQGKPITCTAAVAYAAGKPLTVEQIVVDPPKAHEVRIKIEYTAVCHTDAYTLSGIDP 128

Query: 61  EGAFPSILGHEGAGVVESVGKGVTNVKPGDHVVALYTAECQKCKFCTSGKTNLCGSVRAT 120
           EGAFPSILGHEG+G+VESVG+GVTNVK GDHV+ALYTAEC KCKFC SGKTNLCGSVRAT
Sbjct: 129 EGAFPSILGHEGSGIVESVGEGVTNVKVGDHVIALYTAECGKCKFCKSGKTNLCGSVRAT 188

Query: 121 QGKGVMPDGTSRFRTKNGESILHFMGCSTFSQYTXXXXXXXXXXXXQAPLDRICLLGCGV 180
           QGKGVMPDGTSRF  + GE +LHFMGCSTFSQYT            +APLD I LLGCGV
Sbjct: 189 QGKGVMPDGTSRFHNQKGEPLLHFMGCSTFSQYTVVADVSVVAVDPKAPLDSISLLGCGV 248

Query: 181 TTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFG 240
           TTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAK+RGAS+IIVVDIN+ KKQW+ DFG
Sbjct: 249 TTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKQWSFDFG 308

Query: 241 ATDFVNPSKDLKEGETIVSKLIELTDGGLDFTFDCTGNTKVMRDALEACHKGWGQSIIIG 300
           ATDFVNP +DLKEGETIV KLIE+TDGGL++TFDCTGN KVMRDALEACHKGWG+SIIIG
Sbjct: 309 ATDFVNPKEDLKEGETIVQKLIEMTDGGLEYTFDCTGNVKVMRDALEACHKGWGESIIIG 368

Query: 301 VAAAGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGQLKVDEFITHRRPFT 360
           VA AG+EISTRPFQLVTGRVWKGSAFGGIKGRSEMGGL+ DY +G+LKVDEFITHRRPFT
Sbjct: 369 VAGAGEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIEDYQNGKLKVDEFITHRRPFT 428

Query: 361 EINAAFDDLHHGDCLRTVLDLSK 383
           EIN AF+DLHHGDCLRTVLDL+K
Sbjct: 429 EINDAFEDLHHGDCLRTVLDLAK 451

>KLLA0D12342g Chr4 (1050181..1051335) [1155 bp, 384 aa] {ON} highly
           similar to uniprot|P32771 Saccharomyces cerevisiae
           YDL168W SFA1 Long-chain alcohol dehydrogenase
           (glutathione-dependent formaldehyde dehydrogenase)
          Length = 384

 Score =  657 bits (1696), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/382 (82%), Positives = 341/382 (89%)

Query: 2   SETVGKPITCLAAVAYEAGKPLTVEEIIVEPPKAHEVRIRITYTAVCHTDAYTLSGVDPE 61
           S T GKPI C+AAVAYEAGKPLTVE+IIV+ PKAHEVR+++T+TAVCHTDAYTLSGVDPE
Sbjct: 3   SATAGKPIECVAAVAYEAGKPLTVEKIIVDAPKAHEVRVQVTHTAVCHTDAYTLSGVDPE 62

Query: 62  GAFPSILGHEGAGVVESVGKGVTNVKPGDHVVALYTAECQKCKFCTSGKTNLCGSVRATQ 121
           GAFPSILGHEGAG+VESVG GVTNVK GDHVV LYTAEC KCKFC S KTNLCGSVRATQ
Sbjct: 63  GAFPSILGHEGAGIVESVGDGVTNVKVGDHVVLLYTAECGKCKFCKSNKTNLCGSVRATQ 122

Query: 122 GKGVMPDGTSRFRTKNGESILHFMGCSTFSQYTXXXXXXXXXXXXQAPLDRICLLGCGVT 181
           GKGVMPDGT+RF    GE +LHFMGCSTFSQYT             APL  +CLLGCGVT
Sbjct: 123 GKGVMPDGTTRFHNLKGEPLLHFMGCSTFSQYTVVADVSLVTIDPSAPLSSVCLLGCGVT 182

Query: 182 TGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFGA 241
           TGYGAA+KTANVQ+GDTVAVFGAGTVGLSVVQGAK+RGAS+IIVVD+NDQKKQW+ DFGA
Sbjct: 183 TGYGAAVKTANVQEGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDVNDQKKQWSMDFGA 242

Query: 242 TDFVNPSKDLKEGETIVSKLIELTDGGLDFTFDCTGNTKVMRDALEACHKGWGQSIIIGV 301
           T FVNP KDLKEGETIVSKLI++TDGGLDFTFDCTGN KVMRDALEACHKGWGQSIIIGV
Sbjct: 243 TGFVNPLKDLKEGETIVSKLIDMTDGGLDFTFDCTGNVKVMRDALEACHKGWGQSIIIGV 302

Query: 302 AAAGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGQLKVDEFITHRRPFTE 361
           AAAG+EISTRPFQL+TGRVWKGSAFGGIKGRSEMG LV+ Y  G LKVD+FITH+RPFTE
Sbjct: 303 AAAGEEISTRPFQLITGRVWKGSAFGGIKGRSEMGQLVTSYQKGDLKVDDFITHKRPFTE 362

Query: 362 INAAFDDLHHGDCLRTVLDLSK 383
           IN AF+DLHHGDCLRTVLDL+ 
Sbjct: 363 INNAFEDLHHGDCLRTVLDLAN 384

>TDEL0C01980 Chr3 (344639..345796) [1158 bp, 385 aa] {ON} Anc_7.350
           YDL168W
          Length = 385

 Score =  654 bits (1687), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/380 (82%), Positives = 339/380 (89%)

Query: 4   TVGKPITCLAAVAYEAGKPLTVEEIIVEPPKAHEVRIRITYTAVCHTDAYTLSGVDPEGA 63
           T GK ITC+AAVAYEAGKPLTVEEI VE P+AHEVRI+I YTAVCHTDAYTLSGVDPEGA
Sbjct: 6   TEGKSITCVAAVAYEAGKPLTVEEITVEAPRAHEVRIKIEYTAVCHTDAYTLSGVDPEGA 65

Query: 64  FPSILGHEGAGVVESVGKGVTNVKPGDHVVALYTAECQKCKFCTSGKTNLCGSVRATQGK 123
           FPSILGHEGAG+VESVG+GVTNVKPGDHV+ALYTAECQKCKFC SGKTNLC SVRATQGK
Sbjct: 66  FPSILGHEGAGIVESVGEGVTNVKPGDHVIALYTAECQKCKFCKSGKTNLCSSVRATQGK 125

Query: 124 GVMPDGTSRFRTKNGESILHFMGCSTFSQYTXXXXXXXXXXXXQAPLDRICLLGCGVTTG 183
           GVMPDGTSRF+ + GE + HFMGCSTFSQYT             APL+ ICLLGCGVTTG
Sbjct: 126 GVMPDGTSRFKNQKGEELKHFMGCSTFSQYTVVADVSVVAVDPSAPLESICLLGCGVTTG 185

Query: 184 YGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFGATD 243
           YGAA KTANVQKGDTVAVFGAGTVGLSV+QGAK RGASRII+VDINDQK+++ ++FGATD
Sbjct: 186 YGAATKTANVQKGDTVAVFGAGTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGATD 245

Query: 244 FVNPSKDLKEGETIVSKLIELTDGGLDFTFDCTGNTKVMRDALEACHKGWGQSIIIGVAA 303
           F+NP  DLK+G+TIV KLIE+TDGGLD+TFDCTGNTKVMRDALEACHKGWG S+IIGVAA
Sbjct: 246 FINPKSDLKDGQTIVEKLIEMTDGGLDYTFDCTGNTKVMRDALEACHKGWGTSVIIGVAA 305

Query: 304 AGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGQLKVDEFITHRRPFTEIN 363
           A +EISTRPFQLVTGRVWKGSAFGGIKGRSEMGGL+ DY  G LKVDEFIT+ RPFTEIN
Sbjct: 306 AEEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIEDYKKGTLKVDEFITNERPFTEIN 365

Query: 364 AAFDDLHHGDCLRTVLDLSK 383
            AF+DLH GDCLRTVLDL K
Sbjct: 366 KAFEDLHAGDCLRTVLDLKK 385

>ACL148C Chr3 complement(90932..92077) [1146 bp, 381 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL168W
           (SFA1)
          Length = 381

 Score =  648 bits (1672), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/381 (80%), Positives = 339/381 (88%)

Query: 1   MSETVGKPITCLAAVAYEAGKPLTVEEIIVEPPKAHEVRIRITYTAVCHTDAYTLSGVDP 60
           MSET GKPI C AAVAY AG+PL +E++ V+PPKAHEVRI+I  +A+CHTDAYTLSG DP
Sbjct: 1   MSETQGKPIQCTAAVAYAAGEPLRIEKVTVDPPKAHEVRIKIVNSAICHTDAYTLSGSDP 60

Query: 61  EGAFPSILGHEGAGVVESVGKGVTNVKPGDHVVALYTAECQKCKFCTSGKTNLCGSVRAT 120
           EG FP ILGHEG+G+VESVG+GVTNVKPGDHVV LYTAECQ+CKFC SGKTNLCG+VRAT
Sbjct: 61  EGLFPCILGHEGSGIVESVGEGVTNVKPGDHVVPLYTAECQQCKFCVSGKTNLCGAVRAT 120

Query: 121 QGKGVMPDGTSRFRTKNGESILHFMGCSTFSQYTXXXXXXXXXXXXQAPLDRICLLGCGV 180
           QGKGVMPDGTSRFR   GE++ HFMGCSTFS+YT            QAPL+ +CLLGCGV
Sbjct: 121 QGKGVMPDGTSRFRNGKGETLYHFMGCSTFSEYTVVADVSVVAVDQQAPLETVCLLGCGV 180

Query: 181 TTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFG 240
           TTGYGAA+KTA+VQ+GDTVAVFGAGTVGLSVVQGAKAR ASRIIVVDIND K++WAS FG
Sbjct: 181 TTGYGAAVKTADVQEGDTVAVFGAGTVGLSVVQGAKARNASRIIVVDINDAKREWASKFG 240

Query: 241 ATDFVNPSKDLKEGETIVSKLIELTDGGLDFTFDCTGNTKVMRDALEACHKGWGQSIIIG 300
           ATDF+NP  DLKEGETIV++LIE+TDGGLD TFDCTGNTKVMRDALEACHKGWGQSIIIG
Sbjct: 241 ATDFINPKTDLKEGETIVARLIEMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIG 300

Query: 301 VAAAGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGQLKVDEFITHRRPFT 360
           VAAAGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLV DY++G LKV EF+TH+RPF 
Sbjct: 301 VAAAGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVRDYLNGTLKVQEFVTHKRPFE 360

Query: 361 EINAAFDDLHHGDCLRTVLDL 381
           EIN+ F+DLHHGDCLRTVL L
Sbjct: 361 EINSGFEDLHHGDCLRTVLSL 381

>TBLA0E00390 Chr5 complement(71890..73041) [1152 bp, 383 aa] {ON} 
          Length = 383

 Score =  646 bits (1666), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/383 (80%), Positives = 339/383 (88%)

Query: 1   MSETVGKPITCLAAVAYEAGKPLTVEEIIVEPPKAHEVRIRITYTAVCHTDAYTLSGVDP 60
           MSET GKPI CLAAVAY+A +PLTVEEIIVEPP+AHEVRI+IT+TAVCHTDAYTLSGVDP
Sbjct: 1   MSETQGKPIKCLAAVAYKAAEPLTVEEIIVEPPEAHEVRIKITHTAVCHTDAYTLSGVDP 60

Query: 61  EGAFPSILGHEGAGVVESVGKGVTNVKPGDHVVALYTAECQKCKFCTSGKTNLCGSVRAT 120
           EGAFP +LGHEG+G+VESVG+GV++VK GDHV+ALYTAEC  CKFC SGKTNLCGSVR T
Sbjct: 61  EGAFPCVLGHEGSGIVESVGEGVSSVKVGDHVIALYTAECGVCKFCKSGKTNLCGSVRET 120

Query: 121 QGKGVMPDGTSRFRTKNGESILHFMGCSTFSQYTXXXXXXXXXXXXQAPLDRICLLGCGV 180
           QGKGVMPDGTSRF+   GES+LHFMGCSTFSQYT             APL  +CLLGCGV
Sbjct: 121 QGKGVMPDGTSRFKNLKGESLLHFMGCSTFSQYTVVADVSVVAINKTAPLQSVCLLGCGV 180

Query: 181 TTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFG 240
           TTGYGAAIKTANVQK DTVAVFGAGTVGLSVVQGA+ARGAS+II+VD+N +K+ ++  FG
Sbjct: 181 TTGYGAAIKTANVQKNDTVAVFGAGTVGLSVVQGAQARGASKIIMVDVNSKKETYSRQFG 240

Query: 241 ATDFVNPSKDLKEGETIVSKLIELTDGGLDFTFDCTGNTKVMRDALEACHKGWGQSIIIG 300
           ATDF+NP  DLK GETIVSKL+E+TDGGLD TFDCTGN KVMRDALE CHKGWGQSIIIG
Sbjct: 241 ATDFINPMTDLKPGETIVSKLVEMTDGGLDHTFDCTGNVKVMRDALECCHKGWGQSIIIG 300

Query: 301 VAAAGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGQLKVDEFITHRRPFT 360
           VAAAGQEISTRPFQLVTGRVWKGSAFGG+KGRSEMGGL+  Y  G LKVD+FIT++RPFT
Sbjct: 301 VAAAGQEISTRPFQLVTGRVWKGSAFGGVKGRSEMGGLIESYQKGDLKVDQFITNKRPFT 360

Query: 361 EINAAFDDLHHGDCLRTVLDLSK 383
           EINAAF+DLHHGDCLRTVLDL K
Sbjct: 361 EINAAFEDLHHGDCLRTVLDLEK 383

>Ecym_4723 Chr4 (1415078..1416223) [1146 bp, 381 aa] {ON} similar to
           Ashbya gossypii ACL148C
          Length = 381

 Score =  640 bits (1651), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/381 (79%), Positives = 336/381 (88%)

Query: 1   MSETVGKPITCLAAVAYEAGKPLTVEEIIVEPPKAHEVRIRITYTAVCHTDAYTLSGVDP 60
           MS T GK I C AA+AY AG PL +E I V+PPKAHEVRI+IT+TA+CHTDAYTLSGVDP
Sbjct: 1   MSITAGKTIQCKAAIAYTAGNPLKIETITVDPPKAHEVRIKITHTALCHTDAYTLSGVDP 60

Query: 61  EGAFPSILGHEGAGVVESVGKGVTNVKPGDHVVALYTAECQKCKFCTSGKTNLCGSVRAT 120
           EG FPSILGHEG+G+VESVG GVTNVK GDHV+ LYTAECQ+CKFC SGKTNLCGSVRAT
Sbjct: 61  EGIFPSILGHEGSGIVESVGTGVTNVKVGDHVIPLYTAECQECKFCISGKTNLCGSVRAT 120

Query: 121 QGKGVMPDGTSRFRTKNGESILHFMGCSTFSQYTXXXXXXXXXXXXQAPLDRICLLGCGV 180
           QGKG+MPDGTSRF+   GE I HFMGCSTFS+YT            +APLD++CLLGCGV
Sbjct: 121 QGKGLMPDGTSRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGV 180

Query: 181 TTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFG 240
           TTGYGAA+KTA+VQKGDTVAVFGAGTVGLSVVQGA++RGAS+IIVVDIND KK+W+ DFG
Sbjct: 181 TTGYGAAVKTADVQKGDTVAVFGAGTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFG 240

Query: 241 ATDFVNPSKDLKEGETIVSKLIELTDGGLDFTFDCTGNTKVMRDALEACHKGWGQSIIIG 300
           ATDF+NP+KDL +GETIVSKLI++TDGGLD TFDCTGNTKVMRDALEACHKGWGQSIIIG
Sbjct: 241 ATDFINPTKDLNDGETIVSKLIDMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIG 300

Query: 301 VAAAGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGQLKVDEFITHRRPFT 360
           VAAAGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMG L+SDY  G+LKVDEF+TH RPF+
Sbjct: 301 VAAAGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGNLISDYFAGKLKVDEFVTHTRPFS 360

Query: 361 EINAAFDDLHHGDCLRTVLDL 381
           EIN    DLHHGDCLRTVL+ 
Sbjct: 361 EINDGLTDLHHGDCLRTVLNF 381

>Kpol_530.31 s530 (77132..78274) [1143 bp, 380 aa] {ON}
           (77132..78274) [1143 nt, 381 aa]
          Length = 380

 Score =  638 bits (1646), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/378 (80%), Positives = 333/378 (88%), Gaps = 1/378 (0%)

Query: 4   TVGKPITCLAAVAYEAGKPLTVEEIIVEPPKAHEVRIRITYTAVCHTDAYTLSGVDPEGA 63
           TVGKPITC AAVAYEA KPL VEEI+V+PPKAHEVRI+I  TAVCHTDAYTLSGVDPEG 
Sbjct: 3   TVGKPITCQAAVAYEAAKPLVVEEIVVDPPKAHEVRIKIINTAVCHTDAYTLSGVDPEGL 62

Query: 64  FPSILGHEGAGVVESVGKGVTNVKPGDHVVALYTAECQKCKFCTSGKTNLCGSVRATQGK 123
           FP +LGHEG+G+VESVG  VT VKPGDHVVALYTAEC KCKFC SGKTNLCGSVRATQGK
Sbjct: 63  FPCVLGHEGSGIVESVGDNVTTVKPGDHVVALYTAECGKCKFCLSGKTNLCGSVRATQGK 122

Query: 124 GVMPDGTSRFRTKNGESILHFMGCSTFSQYTXXXXXXXXXXXXQAPLDRICLLGCGVTTG 183
           GVMPDGT RF  K GE + HFMGCSTFS+YT             APLD +CLLGCGVTTG
Sbjct: 123 GVMPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAPLDSVCLLGCGVTTG 182

Query: 184 YGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFGATD 243
           YGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAK+RGAS+IIVVDIN+ KK+W+++FGATD
Sbjct: 183 YGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKEWSAEFGATD 242

Query: 244 FVNPSKDLKEGETIVSKLIELTDGGLDFTFDCTGNTKVMRDALEACHKGWGQSIIIGVAA 303
           FVNPS +L EG+ IVSKL+E+TDGGLDFTFDCTGN  VMRDALEACHKGWGQSIIIGVAA
Sbjct: 243 FVNPS-ELPEGQDIVSKLVEMTDGGLDFTFDCTGNVNVMRDALEACHKGWGQSIIIGVAA 301

Query: 304 AGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGQLKVDEFITHRRPFTEIN 363
           AG+EISTRPFQLVTGRVWKGSAFGGIKGRSEMGGL+ DY +G LKVDEFIT+RRPF EIN
Sbjct: 302 AGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQNGSLKVDEFITNRRPFVEIN 361

Query: 364 AAFDDLHHGDCLRTVLDL 381
            AF++LHHG+CLRTVL  
Sbjct: 362 DAFEELHHGNCLRTVLSF 379

>ZYRO0F11704g Chr6 complement(958546..959694) [1149 bp, 382 aa] {ON}
           highly similar to uniprot|P32771 Saccharomyces
           cerevisiae YDL168W SFA1 Long-chain alcohol dehydrogenase
           (glutathione-dependent formaldehyde dehydrogenase)
          Length = 382

 Score =  638 bits (1646), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/379 (79%), Positives = 337/379 (88%)

Query: 4   TVGKPITCLAAVAYEAGKPLTVEEIIVEPPKAHEVRIRITYTAVCHTDAYTLSGVDPEGA 63
           T GKP+T LAAVAYEAGKPL+VEEI V+PPKAHEVRIR+  TAVCHTDAYTLSG DPEGA
Sbjct: 3   TEGKPVTSLAAVAYEAGKPLSVEEITVDPPKAHEVRIRVKKTAVCHTDAYTLSGADPEGA 62

Query: 64  FPSILGHEGAGVVESVGKGVTNVKPGDHVVALYTAECQKCKFCTSGKTNLCGSVRATQGK 123
           FPSILGHEGAG+VESVG+GVT+VKPGDHVVALYTAEC KCKFC SGKTNLCGSVRATQGK
Sbjct: 63  FPSILGHEGAGIVESVGEGVTSVKPGDHVVALYTAECGKCKFCKSGKTNLCGSVRATQGK 122

Query: 124 GVMPDGTSRFRTKNGESILHFMGCSTFSQYTXXXXXXXXXXXXQAPLDRICLLGCGVTTG 183
           GVMPDGTSRF+ K GE++LHFMGCSTFS+YT            +APL+  CLLGCGVTTG
Sbjct: 123 GVMPDGTSRFKNKKGETLLHFMGCSTFSEYTVVADVSVVAVDPKAPLESACLLGCGVTTG 182

Query: 184 YGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFGATD 243
           YGAA+KTANVQKGDTVA+FGAGTVGLSV QGAKARGAS+II+VDIND KK++  +FGATD
Sbjct: 183 YGAAVKTANVQKGDTVAIFGAGTVGLSVAQGAKARGASQIILVDINDAKKKYMHEFGATD 242

Query: 244 FVNPSKDLKEGETIVSKLIELTDGGLDFTFDCTGNTKVMRDALEACHKGWGQSIIIGVAA 303
           F+NP+ DL+ G+TIV KLIE+TDGGLDFTFDCTGN KVMRDALEACHKGWG S++IGVAA
Sbjct: 243 FINPATDLQNGQTIVEKLIEMTDGGLDFTFDCTGNVKVMRDALEACHKGWGVSVVIGVAA 302

Query: 304 AGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGQLKVDEFITHRRPFTEIN 363
           +GQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGL+ DY  G LKVDEFIT+RRPF +IN
Sbjct: 303 SGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQGGALKVDEFITNRRPFKQIN 362

Query: 364 AAFDDLHHGDCLRTVLDLS 382
            AF+DLH GD LRTVL+ +
Sbjct: 363 EAFEDLHAGDSLRTVLNYT 381

>CAGL0L01111g Chr12 (133129..134274) [1146 bp, 381 aa] {ON} highly
           similar to uniprot|P32771 Saccharomyces cerevisiae
           YDL168w SFA1 long-chain alcohol dehydrogenase
          Length = 381

 Score =  634 bits (1635), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/380 (79%), Positives = 327/380 (86%)

Query: 4   TVGKPITCLAAVAYEAGKPLTVEEIIVEPPKAHEVRIRITYTAVCHTDAYTLSGVDPEGA 63
           T GKPI CLAAVAYEAGKP  VE+I+V+PPKAHEVRI+I  TAVCHTDAYTLSG DPEG 
Sbjct: 2   TEGKPIECLAAVAYEAGKPQVVEQIVVDPPKAHEVRIKIVNTAVCHTDAYTLSGADPEGL 61

Query: 64  FPSILGHEGAGVVESVGKGVTNVKPGDHVVALYTAECQKCKFCTSGKTNLCGSVRATQGK 123
           FP +LGHEGAG+VESVG GVTNVKPGDHV+ALYTAECQKCKFC SGKTNLCG+VRATQGK
Sbjct: 62  FPCVLGHEGAGIVESVGDGVTNVKPGDHVIALYTAECQKCKFCLSGKTNLCGAVRATQGK 121

Query: 124 GVMPDGTSRFRTKNGESILHFMGCSTFSQYTXXXXXXXXXXXXQAPLDRICLLGCGVTTG 183
           GVMPDGTSRF  K GES+ HFMGCSTFS+YT             APL+ +CLLGCGVTTG
Sbjct: 122 GVMPDGTSRFHNKKGESLYHFMGCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGVTTG 181

Query: 184 YGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFGATD 243
           YGAA+KTANVQKGDTVAVFG GTVGLSV+QGA  RGASRII +D NDQKK + + FGATD
Sbjct: 182 YGAAVKTANVQKGDTVAVFGCGTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGATD 241

Query: 244 FVNPSKDLKEGETIVSKLIELTDGGLDFTFDCTGNTKVMRDALEACHKGWGQSIIIGVAA 303
           F+NP+KDLKE ETIV+KLIE+TDGGLD TFDCTGN  VMR ALEACHKGWGQS+IIGVAA
Sbjct: 242 FINPTKDLKENETIVAKLIEMTDGGLDHTFDCTGNVNVMRSALEACHKGWGQSVIIGVAA 301

Query: 304 AGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGQLKVDEFITHRRPFTEIN 363
           AGQEISTRPFQLVTGRVWKGSAFGG+KGRSEM GL+  Y  G+LKVDEFITHRR F EIN
Sbjct: 302 AGQEISTRPFQLVTGRVWKGSAFGGVKGRSEMAGLIEQYKKGELKVDEFITHRRSFNEIN 361

Query: 364 AAFDDLHHGDCLRTVLDLSK 383
            AFDDLH+G CLRTVL  SK
Sbjct: 362 EAFDDLHNGLCLRTVLSFSK 381

>YDL168W Chr4 (159604..160764) [1161 bp, 386 aa] {ON}
           SFA1Bifunctional enzyme containing both alcohol
           dehydrogenase and glutathione-dependent formaldehyde
           dehydrogenase activities, functions in formaldehyde
           detoxification and formation of long chain and complex
           alcohols, regulated by Hog1p-Sko1p
          Length = 386

 Score =  627 bits (1618), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/378 (78%), Positives = 329/378 (87%)

Query: 2   SETVGKPITCLAAVAYEAGKPLTVEEIIVEPPKAHEVRIRITYTAVCHTDAYTLSGVDPE 61
           + TVGKPI C+AAVAY+A KPL+VEEI V+ PKAHEVRI+I YTAVCHTDAYTLSG DPE
Sbjct: 3   AATVGKPIKCIAAVAYDAKKPLSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDPE 62

Query: 62  GAFPSILGHEGAGVVESVGKGVTNVKPGDHVVALYTAECQKCKFCTSGKTNLCGSVRATQ 121
           G FP +LGHEGAG+VESVG  V  VKPGDHV+ALYTAEC KCKFCTSGKTNLCG+VRATQ
Sbjct: 63  GLFPCVLGHEGAGIVESVGDDVITVKPGDHVIALYTAECGKCKFCTSGKTNLCGAVRATQ 122

Query: 122 GKGVMPDGTSRFRTKNGESILHFMGCSTFSQYTXXXXXXXXXXXXQAPLDRICLLGCGVT 181
           GKGVMPDGT+RF    GE I HFMGCSTFS+YT            +APLD  CLLGCGVT
Sbjct: 123 GKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVT 182

Query: 182 TGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFGA 241
           TG+GAA+KTANVQKGDTVAVFG GTVGLSV+QGAK RGAS+II +DIN++KKQ+ S FGA
Sbjct: 183 TGFGAALKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGASKIIAIDINNKKKQYCSQFGA 242

Query: 242 TDFVNPSKDLKEGETIVSKLIELTDGGLDFTFDCTGNTKVMRDALEACHKGWGQSIIIGV 301
           TDFVNP +DL + +TIV KLIE+TDGGLDFTFDCTGNTK+MRDALEACHKGWGQSIIIGV
Sbjct: 243 TDFVNPKEDLAKDQTIVEKLIEMTDGGLDFTFDCTGNTKIMRDALEACHKGWGQSIIIGV 302

Query: 302 AAAGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGQLKVDEFITHRRPFTE 361
           AAAG+EISTRPFQLVTGRVWKGSAFGGIKGRSEMGGL+ DY  G LKV+EFITHRRPF E
Sbjct: 303 AAAGEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQKGALKVEEFITHRRPFKE 362

Query: 362 INAAFDDLHHGDCLRTVL 379
           IN AF+DLH+GDCLRTVL
Sbjct: 363 INQAFEDLHNGDCLRTVL 380

>Suva_4.78 Chr4 (147109..148266) [1158 bp, 385 aa] {ON} YDL168W
           (REAL)
          Length = 385

 Score =  627 bits (1617), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/382 (78%), Positives = 330/382 (86%)

Query: 2   SETVGKPITCLAAVAYEAGKPLTVEEIIVEPPKAHEVRIRITYTAVCHTDAYTLSGVDPE 61
           + TVGKPI C+AA+AY+A KPL+VEEI V+PPKAHEVRI+I YTAVCHTDAYTLSG DPE
Sbjct: 3   ASTVGKPIQCIAAIAYDAKKPLSVEEITVDPPKAHEVRIKIEYTAVCHTDAYTLSGSDPE 62

Query: 62  GAFPSILGHEGAGVVESVGKGVTNVKPGDHVVALYTAECQKCKFCTSGKTNLCGSVRATQ 121
           G FP ILGHEGAG+VESVG  VT VKPGDHV+ALYTAEC KCKFCTSGKTNLC +VRATQ
Sbjct: 63  GLFPCILGHEGAGIVESVGDDVTTVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRATQ 122

Query: 122 GKGVMPDGTSRFRTKNGESILHFMGCSTFSQYTXXXXXXXXXXXXQAPLDRICLLGCGVT 181
           G+G+MPD T+RF    GE I HFMGCSTFS+YT            +APLD   LLGCGVT
Sbjct: 123 GRGIMPDETTRFHNGKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAASLLGCGVT 182

Query: 182 TGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFGA 241
           TGYGAA+KTANVQKGDTVAVFG GTVGLSV+QGAKARGAS+II +DIN++KKQ+  DFGA
Sbjct: 183 TGYGAAVKTANVQKGDTVAVFGCGTVGLSVIQGAKARGASKIIGIDINNKKKQYCFDFGA 242

Query: 242 TDFVNPSKDLKEGETIVSKLIELTDGGLDFTFDCTGNTKVMRDALEACHKGWGQSIIIGV 301
           TDF+NP +DL +G+TIV KLIE TDGGLDFTFDCTGNTK+MRDALEACHKGWGQSIIIGV
Sbjct: 243 TDFINPKEDLAKGQTIVEKLIETTDGGLDFTFDCTGNTKIMRDALEACHKGWGQSIIIGV 302

Query: 302 AAAGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGQLKVDEFITHRRPFTE 361
           AAAG+EISTRPFQLVTGRVWKGSAFGGIKGRSEMGGL+ DY +G LKV+EFITHRRPF E
Sbjct: 303 AAAGEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQNGALKVEEFITHRRPFKE 362

Query: 362 INAAFDDLHHGDCLRTVLDLSK 383
           IN AF+DLH GDCLRTVL   K
Sbjct: 363 INQAFEDLHQGDCLRTVLKFDK 384

>Skud_4.89 Chr4 (155298..156455) [1158 bp, 385 aa] {ON} YDL168W
           (REAL)
          Length = 385

 Score =  626 bits (1614), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/383 (77%), Positives = 331/383 (86%)

Query: 1   MSETVGKPITCLAAVAYEAGKPLTVEEIIVEPPKAHEVRIRITYTAVCHTDAYTLSGVDP 60
           ++ TVGKPI C+AAVAY A K L+VEEI V+PPKAHEVRI+I +TAVCHTDAYTLSG DP
Sbjct: 2   LAATVGKPIQCVAAVAYNAKKSLSVEEITVDPPKAHEVRIKIEFTAVCHTDAYTLSGSDP 61

Query: 61  EGAFPSILGHEGAGVVESVGKGVTNVKPGDHVVALYTAECQKCKFCTSGKTNLCGSVRAT 120
           EG FP ILGHEGAG+VESVG  V  VKPGDHV+ALYTAEC KCKFCTSGKTNLC +VRAT
Sbjct: 62  EGLFPCILGHEGAGIVESVGDDVMTVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRAT 121

Query: 121 QGKGVMPDGTSRFRTKNGESILHFMGCSTFSQYTXXXXXXXXXXXXQAPLDRICLLGCGV 180
           QGKGVMPDGT+RF    GE I HFMGCSTFS+YT            +APLD  CLLGCGV
Sbjct: 122 QGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGV 181

Query: 181 TTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFG 240
           TTGYGAAIKTANVQ+GDTVAVFG GTVGLSV+QGAK+RGAS+II VDIN++K+Q++S+FG
Sbjct: 182 TTGYGAAIKTANVQEGDTVAVFGCGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNFG 241

Query: 241 ATDFVNPSKDLKEGETIVSKLIELTDGGLDFTFDCTGNTKVMRDALEACHKGWGQSIIIG 300
           ATDF+NP +DL E +TIV KLI++TDGGLDFTFDCTGNT +MRDALEACHKGWGQSIIIG
Sbjct: 242 ATDFINPKEDLAEDQTIVEKLIDMTDGGLDFTFDCTGNTNIMRDALEACHKGWGQSIIIG 301

Query: 301 VAAAGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGQLKVDEFITHRRPFT 360
           VAAAG+EISTRPFQLVTGRVWKGSAFGGIKGRSEMGGL+ DY  G LKV+EFITHRRPF 
Sbjct: 302 VAAAGEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQSGALKVEEFITHRRPFK 361

Query: 361 EINAAFDDLHHGDCLRTVLDLSK 383
           EIN AF+DLH+GDCLRTVL   +
Sbjct: 362 EINQAFEDLHNGDCLRTVLRFQE 384

>Smik_4.70 Chr4 (136242..137402) [1161 bp, 386 aa] {ON} YDL168W
           (REAL)
          Length = 386

 Score =  623 bits (1606), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/382 (77%), Positives = 328/382 (85%)

Query: 2   SETVGKPITCLAAVAYEAGKPLTVEEIIVEPPKAHEVRIRITYTAVCHTDAYTLSGVDPE 61
           + TVGKPI C+AAVAY+A KP +VEEI V+ PKAHEVRI+I YTAVCHTDAYTLSG DPE
Sbjct: 3   AATVGKPIKCIAAVAYDAKKPSSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDPE 62

Query: 62  GAFPSILGHEGAGVVESVGKGVTNVKPGDHVVALYTAECQKCKFCTSGKTNLCGSVRATQ 121
           G FP ILGHEGAG+VESVG GV  VKPGDHV+ALYTAEC KCKFCTSGKTNLC +VRATQ
Sbjct: 63  GLFPCILGHEGAGIVESVGDGVVTVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRATQ 122

Query: 122 GKGVMPDGTSRFRTKNGESILHFMGCSTFSQYTXXXXXXXXXXXXQAPLDRICLLGCGVT 181
           GKGVMPDGT+RF    G+ I HFMGCSTFS+YT            +APLD  CLLGCGVT
Sbjct: 123 GKGVMPDGTTRFHNAKGKDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLGCGVT 182

Query: 182 TGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFGA 241
           TGYGAA+KTANVQKGDTVAVFG GTVGLSV+QGAK RGAS+II VDIN+ KK++ S FGA
Sbjct: 183 TGYGAAVKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGASKIIAVDINNNKKKYCSQFGA 242

Query: 242 TDFVNPSKDLKEGETIVSKLIELTDGGLDFTFDCTGNTKVMRDALEACHKGWGQSIIIGV 301
           TDF+NP +DL + +TIV KL+E+TDGGLDFTFDCTGNTK+MRDALEACHKGWGQSIIIGV
Sbjct: 243 TDFINPKEDLAKDQTIVEKLVEMTDGGLDFTFDCTGNTKIMRDALEACHKGWGQSIIIGV 302

Query: 302 AAAGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGQLKVDEFITHRRPFTE 361
           AAAG+EISTRPFQLVTGRVWKGSAFGGIKGRSEMGGL+ DY  G LKV+EFITHRRPF E
Sbjct: 303 AAAGEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQSGVLKVEEFITHRRPFKE 362

Query: 362 INAAFDDLHHGDCLRTVLDLSK 383
           IN AF+DLH+GDCLRTVL   +
Sbjct: 363 INHAFEDLHNGDCLRTVLKFDE 384

>TPHA0F02970 Chr6 complement(653405..654550) [1146 bp, 381 aa] {ON}
           Anc_7.350 YDL168W
          Length = 381

 Score =  619 bits (1596), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/378 (78%), Positives = 328/378 (86%), Gaps = 1/378 (0%)

Query: 5   VGKPITCLAAVAYEAGKPLTVEEIIVEPPKAHEVRIRITYTAVCHTDAYTLSGVDPEGAF 64
           VGKPITC AA+AYEA KPLTV EI+V+PPKAHEVRI+I  TAVCHTDAY+LSGVDPEG F
Sbjct: 4   VGKPITCTAAIAYEANKPLTVTEIVVDPPKAHEVRIKIVKTAVCHTDAYSLSGVDPEGLF 63

Query: 65  PSILGHEGAGVVESVGKGVTNVKPGDHVVALYTAECQKCKFCTSGKTNLCGSVRATQGKG 124
           P +LGHEG+G+VES+G  VTNVK GDHV+ALYTAEC KCKFC SGKTNLCGSVRATQGKG
Sbjct: 64  PCVLGHEGSGIVESIGADVTNVKVGDHVIALYTAECGKCKFCLSGKTNLCGSVRATQGKG 123

Query: 125 VMPDGTSRFRTKNGESILHFMGCSTFSQYTXXXXXXXXXXXXQAPLDRICLLGCGVTTGY 184
           VMPDGT+RF  K+G+ I HFMGCSTFSQYT                +   LLGCGVTTGY
Sbjct: 124 VMPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVSFEPTALLGCGVTTGY 183

Query: 185 GAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFGATDF 244
           GAAIKTAN+QKGDTVAVFGAGTVGLSVVQGAK+RGAS+IIVVD+N+ KK W+ +FGATDF
Sbjct: 184 GAAIKTANIQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDLNNDKKDWSFEFGATDF 243

Query: 245 VNPSKDLKEGETIVSKLIELTDGGLDFTFDCTGNTKVMRDALEACHKGWGQSIIIGVAAA 304
           VNP K+LK+ E IVSKLIE+TDGGLDFTFDCTGN  VMR+ALEACHKGWGQSIIIGVAAA
Sbjct: 244 VNP-KELKDSEDIVSKLIEMTDGGLDFTFDCTGNVNVMRNALEACHKGWGQSIIIGVAAA 302

Query: 305 GQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGQLKVDEFITHRRPFTEINA 364
           GQEI+TRPFQLVTGRVW+GSAFGGIKGRSEMGGL+ DY  G LKVDEFIT RRPFTEINA
Sbjct: 303 GQEIATRPFQLVTGRVWRGSAFGGIKGRSEMGGLIKDYQSGTLKVDEFITGRRPFTEINA 362

Query: 365 AFDDLHHGDCLRTVLDLS 382
           AF+DLH+G CLRTVLD S
Sbjct: 363 AFEDLHNGSCLRTVLDTS 380

>KAFR0B00880 Chr2 complement(164475..165620) [1146 bp, 381 aa] {ON}
           Anc_7.350 YDL168W
          Length = 381

 Score =  587 bits (1513), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/381 (73%), Positives = 318/381 (83%)

Query: 1   MSETVGKPITCLAAVAYEAGKPLTVEEIIVEPPKAHEVRIRITYTAVCHTDAYTLSGVDP 60
           MS T GK I C AAVAYEA KPL V+++IV+ PKAHEVRI+I  TA+CHTDAYTLSGVDP
Sbjct: 1   MSSTQGKAIQCKAAVAYEAKKPLVVQDVIVDAPKAHEVRIKIMNTAICHTDAYTLSGVDP 60

Query: 61  EGAFPSILGHEGAGVVESVGKGVTNVKPGDHVVALYTAECQKCKFCTSGKTNLCGSVRAT 120
           EG FP ILGHEG+G+VES+G+GVT+VK GDHV+ LYTAECQKCKFC SGKTNLCG+VR T
Sbjct: 61  EGLFPCILGHEGSGIVESIGEGVTSVKVGDHVIPLYTAECQKCKFCKSGKTNLCGAVRET 120

Query: 121 QGKGVMPDGTSRFRTKNGESILHFMGCSTFSQYTXXXXXXXXXXXXQAPLDRICLLGCGV 180
           QGKGVMPDGTSRF T  G+ I HFMGCSTFS+YT            +  L+   LLGCGV
Sbjct: 121 QGKGVMPDGTSRFHTLEGKDIFHFMGCSTFSEYTVVADVSVVAIDKKVSLEPASLLGCGV 180

Query: 181 TTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFG 240
           TTG+GAA+K ANVQKGDTVAVFGAGTVGLSVVQGA+ RG S++IVVDIND+KKQ++ DFG
Sbjct: 181 TTGFGAAVKAANVQKGDTVAVFGAGTVGLSVVQGARMRGCSKVIVVDINDEKKQFSYDFG 240

Query: 241 ATDFVNPSKDLKEGETIVSKLIELTDGGLDFTFDCTGNTKVMRDALEACHKGWGQSIIIG 300
           ATDFVNP  DLK+GETIV+KLI +TDGGLD+TFDCTGN  VMR+ALEACHKGWGQS IIG
Sbjct: 241 ATDFVNPMTDLKDGETIVNKLISMTDGGLDYTFDCTGNVHVMRNALEACHKGWGQSFIIG 300

Query: 301 VAAAGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGQLKVDEFITHRRPFT 360
           VAAAGQEISTRPFQLVTGRVW+G+AFG IKGR++M  L+ DY  G LK+DEFITHRR F 
Sbjct: 301 VAAAGQEISTRPFQLVTGRVWRGTAFGDIKGRTDMPQLLDDYEKGLLKIDEFITHRRQFD 360

Query: 361 EINAAFDDLHHGDCLRTVLDL 381
           EIN  F+DLH G CLRTVL  
Sbjct: 361 EINDGFEDLHMGTCLRTVLKF 381

>NDAI0A01890 Chr1 (425090..426358) [1269 bp, 422 aa] {ON} Anc_7.350
          Length = 422

 Score =  571 bits (1472), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/383 (74%), Positives = 310/383 (80%), Gaps = 46/383 (12%)

Query: 1   MSETVGKPITCLAAVAYEAGKPLTVEEIIVEPPKAHEVRIRITYTAVCHTDAYTLSGVDP 60
           MS T GKPITC AAVAYEAGKPLTVE+I+V+PPKAHEVRI+I YTAVCHTDAYTLSGVDP
Sbjct: 86  MSTTQGKPITCTAAVAYEAGKPLTVEDIVVDPPKAHEVRIKIDYTAVCHTDAYTLSGVDP 145

Query: 61  EGAFPSILGHEGAGVVESVGKGVTNVKPGDHVVALYTAECQKCKFCTSGKTNLCGSVRAT 120
           EGAFPSILGHEG+G+VESVG+GVTNVK GDHV+ALYTAEC        G+   C S    
Sbjct: 146 EGAFPSILGHEGSGIVESVGEGVTNVKVGDHVIALYTAEC--------GECKFCKSGXXX 197

Query: 121 QGKGVMPDGTSRFRTKNGESILHFMGCSTFSQYTXXXXXXXXXXXXQAPLDRICLLGCGV 180
                +         KN                              AP+D ICLLGCGV
Sbjct: 198 XXXXAV--------DKN------------------------------APMDSICLLGCGV 219

Query: 181 TTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFG 240
           TTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKARGAS+IIVVD+NDQKKQW+ DFG
Sbjct: 220 TTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKARGASKIIVVDVNDQKKQWSMDFG 279

Query: 241 ATDFVNPSKDLKEGETIVSKLIELTDGGLDFTFDCTGNTKVMRDALEACHKGWGQSIIIG 300
           ATDF+NP  DLKEGETIVSKLIE+TDGGL++TFDCTGNTKVMRDALEACHKGWG+SIIIG
Sbjct: 280 ATDFINPKTDLKEGETIVSKLIEMTDGGLEYTFDCTGNTKVMRDALEACHKGWGESIIIG 339

Query: 301 VAAAGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGQLKVDEFITHRRPFT 360
           VAAAG+EISTRPFQLVTGRVWKGSAFGGIKGRSEMGGL+ DY +G LKVDEFITHRRPFT
Sbjct: 340 VAAAGEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQNGNLKVDEFITHRRPFT 399

Query: 361 EINAAFDDLHHGDCLRTVLDLSK 383
           EIN AF+DLHHGDCLRTVLDLSK
Sbjct: 400 EINNAFEDLHHGDCLRTVLDLSK 422

>KNAG0C03790 Chr3 complement(745394..746542) [1149 bp, 382 aa] {ON}
           Anc_7.350 YDL168W
          Length = 382

 Score =  539 bits (1388), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 272/387 (70%), Positives = 304/387 (78%), Gaps = 13/387 (3%)

Query: 1   MSETVGKPITCLAAVAYEAGKPLTVEEIIVEPPKAHEVRIRITYTAVCHTDAYTLSGVDP 60
           M+ T G+ ITC AAVAY AGKPLTVE+I VE P       R  Y    H   Y   G   
Sbjct: 1   MANTEGQTITCTAAVAYAAGKPLTVEQITVEAPTG----ARGAYQD--HQHCYLPHGCVH 54

Query: 61  EGAFPS-------ILGHEGAGVVESVGKGVTNVKPGDHVVALYTAECQKCKFCTSGKTNL 113
              F S         G  GAGVVESVG  VT+VK GDHV+ALYTAEC++CK C SGKTNL
Sbjct: 55  SVWFGSEVRCVSLCFGARGAGVVESVGPDVTSVKVGDHVIALYTAECKECKMCKSGKTNL 114

Query: 114 CGSVRATQGKGVMPDGTSRFRTKNGESILHFMGCSTFSQYTXXXXXXXXXXXXQAPLDRI 173
           C +VRATQGKGVMPDGTSRFR   GE +LHFMGCSTF++YT             APL+++
Sbjct: 115 CSAVRATQGKGVMPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEKV 174

Query: 174 CLLGCGVTTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKARGASRIIVVDINDQKK 233
           CLLGCGVTTGYGAA+KTANVQKGDTVAVFGAGT+GLSVVQGAKAR AS+IIVVDIND KK
Sbjct: 175 CLLGCGVTTGYGAALKTANVQKGDTVAVFGAGTIGLSVVQGAKAREASKIIVVDINDTKK 234

Query: 234 QWASDFGATDFVNPSKDLKEGETIVSKLIELTDGGLDFTFDCTGNTKVMRDALEACHKGW 293
           ++A DFGATDFVNP  DLK+G+TIV KL+E+TDGGLDFTFD TGN +VMRDALEACHKGW
Sbjct: 235 KFAFDFGATDFVNPKTDLKDGQTIVEKLVEMTDGGLDFTFDGTGNVQVMRDALEACHKGW 294

Query: 294 GQSIIIGVAAAGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGQLKVDEFI 353
           GQSIIIGVAAAG+EISTRPFQLVTGRVWKGSAFGG+KGRSEMG L+ DY  G LK+DEFI
Sbjct: 295 GQSIIIGVAAAGKEISTRPFQLVTGRVWKGSAFGGVKGRSEMGSLIEDYNKGNLKIDEFI 354

Query: 354 THRRPFTEINAAFDDLHHGDCLRTVLD 380
           T++RPF EIN  F+DLHHGDCLRTVL+
Sbjct: 355 TNKRPFKEINEGFEDLHHGDCLRTVLN 381

>SAKL0A00880g Chr1 complement(92246..93412) [1167 bp, 388 aa] {ON}
           similar to uniprot|P32771 Saccharomyces cerevisiae
           YDL168W SFA1 Long-chain alcohol dehydrogenase
           (glutathione- dependent formaldehyde dehydrogenase)
          Length = 388

 Score =  440 bits (1132), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 208/376 (55%), Positives = 270/376 (71%), Gaps = 3/376 (0%)

Query: 6   GKPITCLAAVAYEAGKPLTVEEIIVEPPKAHEVRIRITYTAVCHTDAYTLSGVDPEGAFP 65
           G+PI C AAVAY   KPL +E+IIV+PP+ HEVR+++T TA+C TD +TL G++PEG FP
Sbjct: 6   GEPIRCTAAVAYSINKPLVLEQIIVDPPQEHEVRVKVTNTALCRTDLFTLKGLNPEGKFP 65

Query: 66  SILGHEGAGVVESVGKGVTNVKPGDHVVALYTAECQKCKFCTSGKTNLCGSVRATQGKGV 125
            +LGHEG+G+VES G  V  VK GDHV+ LY  EC  C  C S K+NLC  ++ATQ +GV
Sbjct: 66  CVLGHEGSGIVESCGSKVETVKKGDHVLLLYIPECGHCADCKSEKSNLCSVIKATQAQGV 125

Query: 126 MPDGTSRFRTKNGESILHFMGCSTFSQYTXXXXXXXXXXXXQAPLDRICLLGCGVTTGYG 185
           MP G+SR      +++ HFMGCS+FSQY              APLD+ICLLGCGVTTG+G
Sbjct: 126 MPQGSSRLHNLENKTLWHFMGCSSFSQYAVVSDISCVKIRDDAPLDKICLLGCGVTTGFG 185

Query: 186 AAIKTANVQKGDTVAVFGAGTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFGATDFV 245
           A I    V+ GD VAVFG+GTVGLSVVQ        ++IVVD+ D K++WA  FGATDF+
Sbjct: 186 API-AKGVKAGDRVAVFGSGTVGLSVVQSCSQLKCFQVIVVDVQDNKREWALGFGATDFI 244

Query: 246 NPSKDLKEGETIVSKLIELTDG-GLDFTFDCTGNTKVMRDALEACHKGWGQSIIIGVAAA 304
           NP K + + ++++  LI+ + G G DFTFDCTG+T VMR ALE+C KGWG S+IIG+A A
Sbjct: 245 NPQK-IPKNKSLLQTLIDKSGGDGFDFTFDCTGSTSVMRTALESCRKGWGTSVIIGLAGA 303

Query: 305 GQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGQLKVDEFITHRRPFTEINA 364
           G+EIST P+ L+ GR W+G AFGG+KGRSE+  LV  YM+ ++K+DE+IT++RP  EIN 
Sbjct: 304 GEEISTLPYNLIVGRSWEGCAFGGVKGRSELPTLVERYMNNEIKLDEYITNKRPLKEINE 363

Query: 365 AFDDLHHGDCLRTVLD 380
           A  +L  G  L+TVLD
Sbjct: 364 ALKELEDGLVLKTVLD 379

>CAGL0J01441g Chr10 complement(134383..135501) [1119 bp, 372 aa]
           {ON} highly similar to uniprot|P07246 Saccharomyces
           cerevisiae YMR083w ADH3 or uniprot|P00330 Saccharomyces
           cerevisiae YOL086c ADH1 or uniprot|P00331 Saccharomyces
           cerevisiae YMR303c ADH2
          Length = 372

 Score =  112 bits (281), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 98/352 (27%), Positives = 160/352 (45%), Gaps = 37/352 (10%)

Query: 1   MSETVGKPITCLAAVAYEAGKPLTVEEIIVEPPKAHEVRIRITYTAVCHTDAYTLSGVDP 60
           +  T+  P +    + YE G  L  +++ V  PK +E+ I + Y+ VCHTD +   G  P
Sbjct: 21  LQSTLSIPQSQKGVIFYEHGGKLEYKDLPVPKPKPNEILINVRYSGVCHTDLHAWHGDWP 80

Query: 61  EGA-FPSILGHEGAGVVESVGKGVTNVKPGDHV-VALYTAECQKCKFCTSGKTNLCGSVR 118
            GA  P + GHEGAGVV + G  VTN + GD+  +      C  C+FC  G  + C    
Sbjct: 81  LGAKLPLVGGHEGAGVVVAKGSSVTNFEIGDYAGIKWLNGSCMSCEFCEQGNESNCAKAD 140

Query: 119 ATQGKGVMPDGTSRFRTKNGESILHFMGCSTFSQYTXXXXXXXXXXXXQAPLDRICLLGC 178
            +   G   DG                   +F QY                L ++  + C
Sbjct: 141 LS---GYTHDG-------------------SFQQYATADAIQAAQIPKGTDLAQVAPILC 178

Query: 179 GVTTGYGAAIKTANVQKGDTVAVFG-AGTVGLSVVQGAKARGASRIIVVDINDQKKQWAS 237
              T Y  A+K ++V+ G  VA+ G AG +G   VQ AKA G  R++ +D  D+K++   
Sbjct: 179 AGVTVY-KALKDSDVKPGQWVAISGAAGGLGSLAVQYAKAMGM-RVLGIDAGDEKRKLFE 236

Query: 238 DFGATDFVNPSKDLKEGETIVSKLIELTDGGLDFTFDCTGNTKVMRDALEACHKGWGQSI 297
             G   FV    D  + + +VS++ E+T+GG     + + + K +  ++E   +  G  +
Sbjct: 237 SLGGNHFV----DFTKTKDLVSEIQEITEGGPHGVINVSVSEKAIGQSVEYV-RPCGTVV 291

Query: 298 IIGVAAAGQEISTRPFQLVTGRV-WKGSAFGGIKGRSEMGGLVSDYMDGQLK 348
           ++G+  AG  + +  F  V   +  KGS  G    R++    +  +  GQ+K
Sbjct: 292 LVGL-PAGATVKSDVFNHVIKSINIKGSYVG---NRADTREAIDFFAKGQVK 339

>KLLA0D19929g Chr4 (1694826..1695986) [1161 bp, 386 aa] {ON} weakly
           similar to uniprot|P35497 Saccharomyces cerevisiae
           YJR159W SOR1 Sorbitol dehydrogenase
          Length = 386

 Score =  110 bits (276), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 98/378 (25%), Positives = 162/378 (42%), Gaps = 53/378 (14%)

Query: 12  LAAVAYEAGKPLTVEEIIVEPPK---AHEVRIRITYTAVCHTDAYTLSGVDPE------- 61
           + A+ Y     +  E+   E P+   + +  I++T+T++C TD     G +PE       
Sbjct: 31  MKAMVYYGANDIKFED--REQPQILSSTDAIIKMTHTSICGTDLGIWKGKNPEIEQTAQT 88

Query: 62  --GAFP-SILGHEGAGVVESVGKGVTNVKPGDHVVALYTAECQKCKFCTSGKTNLCGSVR 118
             G+F   ILGHEG G+++ VG  V N K GD V+    + C  C+ C     + C    
Sbjct: 89  KEGSFNGRILGHEGIGIIDEVGDAVHNFKKGDRVIVSCISRCGTCENCAKSLYSHC---- 144

Query: 119 ATQGKGVMPDGTSRFRTKNGESILHFMGCSTFSQYTXXXXXXXXXXXXQAPL--DRICLL 176
                           T  G  IL +M   T ++Y                L  +   +L
Sbjct: 145 ----------------TNGGGWILGYMIDGTQAEYVRTPFADTSLYSVPENLSDEAAVML 188

Query: 177 GCGVTTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKARGASRIIVVDINDQKKQWA 236
              + T +   ++  NV+ GDTVA+ GAG VG+  V  ++    S +IVVDI+D +   A
Sbjct: 189 SDALPTAHEIGVQMGNVKPGDTVAIVGAGPVGMGCVLTSQLYSPSLLIVVDIDDNRLAMA 248

Query: 237 SDFGATDFVNPSKDLKEGETIVSKLIELTDG-GLDFTFDCTGNTKVMRDALEACHKGWGQ 295
            + G+T  +N +K     E  VSK++E T+G G+D   +  G  +   D  +   K  G 
Sbjct: 249 KEMGSTHTINSAK-----EDAVSKILEYTNGRGVDCVMEAVG-AQATWDICQRVIKEGGH 302

Query: 296 SIIIGVAAAGQEISTRPFQLVTGRVW--KGSAFGGIKGRSEMGGLVSDYMDGQLKVDEFI 353
              +GV         +P      ++W    +   G+   +  G L+     G+LK +  +
Sbjct: 303 LANVGVHG-------KPVNFEIDKLWIKNLTITSGLVNTNTTGMLMKSCCSGKLKSERLV 355

Query: 354 THRRPFTEINAAFDDLHH 371
           TH   F E++  ++   H
Sbjct: 356 THHCNFGEMSGNYNIFKH 373

>KNAG0K02000 Chr11 (410263..411315) [1053 bp, 350 aa] {ON} Anc_3.118
           YBR145W
          Length = 350

 Score =  105 bits (262), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 101/394 (25%), Positives = 166/394 (42%), Gaps = 55/394 (13%)

Query: 1   MSETVGKPITCLAAVAYEAGKPLTVEEIIVEPPKAHEVRIRITYTAVCHTDAYTLSGVDP 60
           MS ++  P T +  +    G PL  +EI V  PKA+E+ I + Y+ VCHTD +   G  P
Sbjct: 1   MSSSI--PETQMGVIFESNGGPLEYKEIPVPKPKANELLINVKYSGVCHTDLHAWHGDWP 58

Query: 61  EGA-FPSILGHEGAGVVESVGKGVTNVKPGDHV-VALYTAECQKCKFCTSGKTNLCGSVR 118
                P + GHEGAG+V ++G  V N   GD+  +      C  C+ C     + C    
Sbjct: 59  LPVKLPLVGGHEGAGIVVAMGDSVKNWNIGDYAGIKWLNGSCMNCESCELANESNC---- 114

Query: 119 ATQGKGVMPDGTSRFRTKNGESILHFMGCSTFSQYTXXXXXXXXXXXXQAPLDRICLLGC 178
                   P       T +G          +F QY                L  +  + C
Sbjct: 115 --------PQADLSGYTHDG----------SFQQYATADAVQAAKIPHGTDLAEVAPILC 156

Query: 179 GVTTGYGAAIKTANVQKGDTVAVFGA-GTVGLSVVQGAKARGASRIIVVDINDQKKQWAS 237
              T Y  A+K+AN++ GD VA+ GA G +G   +Q A A G  R++ +D  ++K +   
Sbjct: 157 AGVTVY-KALKSANLKAGDWVAISGACGGLGSLAIQYATAMG-YRVLGIDGGEEKAELFK 214

Query: 238 DFGATDFVNPSKDLKEGETIVSKLIELTDGGLDFTFDCTGNTKVMRDALEACHKGWGQSI 297
             G   F+    D  + + ++++++E+TDGG     + + +   +  +   C    G  +
Sbjct: 215 KLGGEYFI----DFTKCKDVIAEILEVTDGGAHGVINVSVSEAAIEASTRYCRAN-GTVV 269

Query: 298 IIGVAAAGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGQLKVDEFI---- 353
           ++G+ A     S    Q+V             K  S +G  V +  D +  +D F     
Sbjct: 270 LVGLPANAYCKSEVFSQVV-------------KSISIVGSYVGNRADTRQALDFFARGLV 316

Query: 354 ---THRRPFTEINAAFDDLHHGDCL-RTVLDLSK 383
               H  P +++   FD +  G  + R V+D SK
Sbjct: 317 KSPIHIAPLSDLPEIFDKMAKGQIVGRYVVDTSK 350

>NCAS0I02350 Chr9 (444097..445152) [1056 bp, 351 aa] {ON} Anc_3.118
          Length = 351

 Score =  105 bits (261), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 99/387 (25%), Positives = 168/387 (43%), Gaps = 53/387 (13%)

Query: 8   PITCLAAVAYEAGKPLTVEEIIVEPPKAHEVRIRITYTAVCHTDAYTLSGVDP-EGAFPS 66
           P T  A +    G  L  ++I V  PK++E+ I + Y+ VCHTD +   G  P     P 
Sbjct: 7   PKTQKAVIFETNGGKLEYKDIPVPTPKSNEILINVKYSGVCHTDLHAWKGDWPLPTKLPL 66

Query: 67  ILGHEGAGVVESVGKGVTNVKPGDHV-VALYTAECQKCKFCTSGKTNLCGSVRATQGKGV 125
           + GHEGAGVV ++G  V   K GD+  +      C  C++C  G  + C           
Sbjct: 67  VGGHEGAGVVVAMGDAVKGWKIGDYAGIKWLNGSCMSCEYCELGNESNC----------- 115

Query: 126 MPDGTSRFRTKNGESILHFMGCSTFSQYTXXXXXXXXXXXXQAPLDRICLLGCGVTTGYG 185
            P       T +G          +F QY              + L  +  + C   T Y 
Sbjct: 116 -PHADLSGYTHDG----------SFQQYATADAVQAARIAPGSDLAEVAPVLCAGITVY- 163

Query: 186 AAIKTANVQKGDTVAVFGA-GTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFGATDF 244
            A+K+AN++ G+ VA+ GA G +G   +Q AKA G  R++ +D  D+K +   D G   F
Sbjct: 164 KALKSANLRAGEWVAISGACGGLGSLAIQFAKAMG-YRVVGIDGGDEKAKMFKDLGGEVF 222

Query: 245 VNPSKDLKEGETIVSKLIELTDGGLDFTFDCTGNTKVMRDALEACHKGWGQSIIIGVAAA 304
           +    D  + + IV  +I+ T+GG     + + + + +  +++ C    G ++++G+   
Sbjct: 223 I----DFTKTKDIVGDIIKATNGGAHGVINVSVSEQAIDASVKYCRAN-GTAVLVGM-PG 276

Query: 305 GQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGQLKVDEF-------ITHRR 357
           G ++ +  F  V            +K  S +G  V +  D +  +D F         H  
Sbjct: 277 GAQVKSDVFNQV------------VKSISIVGSYVGNRADTREALDFFSRGLVKSPIHIA 324

Query: 358 PFTEINAAFDDLHHGDCL-RTVLDLSK 383
             +++   F+ +  G  + R V+D SK
Sbjct: 325 KLSDVPEIFEKMEKGQIVGRYVVDCSK 351

>Ecym_5331 Chr5 (676233..677279) [1047 bp, 348 aa] {ON} similar to
           Ashbya gossypii AER032W
          Length = 348

 Score =  105 bits (261), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 96/348 (27%), Positives = 153/348 (43%), Gaps = 45/348 (12%)

Query: 8   PITCLAAVAYEAGKPLTVEEIIVEPPKAHEVRIRITYTAVCHTDAYTLSGVDP-EGAFPS 66
           P T  A + YE G  L   +I V  PK  E+ I + Y+ VCHTD +   G  P     P 
Sbjct: 4   PETQKAVIFYENGGELKYTDIPVPKPKPSELLINVKYSGVCHTDLHAWKGDWPLPTKLPL 63

Query: 67  ILGHEGAGVVESVGKGVTNVKPGDHV-VALYTAECQKCKFCTSGKTNLCGSVRATQGKGV 125
           + GHEGAGVV ++G+ V   K GD   +      C  C++C     + C           
Sbjct: 64  VGGHEGAGVVVAMGENVRGWKIGDFAGIKWLNGSCMTCEYCEKSNESNC----------- 112

Query: 126 MPDGTSRFRTKNGESILHFMGCSTFSQYTXXXXXXXXXXXXQAPLDRICLLGCGVTTGYG 185
            PD      T +G          +F QY                L ++  + C   T Y 
Sbjct: 113 -PDADLSGYTHDG----------SFQQYATADAVHAAKIPQGTDLAQVAPVLCAGITVY- 160

Query: 186 AAIKTANVQKGDTVAVFGA-GTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFGATDF 244
            A+K+A +Q G+ VA+ GA G +G   VQ AKA G  RI+ +D  ++KK+   + G   F
Sbjct: 161 KALKSARLQAGEWVAISGASGGLGSLAVQYAKAMG-YRILGIDSGEEKKKLFKELGGEYF 219

Query: 245 VNPSKDLKEGETIVSKLIELTDGGLDFTFDCTGNTKVMRDALEACHKGWGQSIIIGVAAA 304
           +    D  E + +V+++I++T+GG     + + +   +  + E C    G  +++G+  A
Sbjct: 220 I----DFAESKDVVAEVIKVTNGGAHGVINVSVSEAAIAASAEYCRSN-GTVVLVGL-PA 273

Query: 305 GQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGQLKVDEF 352
           G ++ +  F  V            +K  S +G  V +  D +  +D F
Sbjct: 274 GAQMRSEVFSHV------------VKSISVVGSYVGNRADSREAIDFF 309

>KLLA0B00451g Chr2 complement(31822..32982) [1161 bp, 386 aa] {ON}
           weakly similar to uniprot|P35497 Saccharomyces
           cerevisiae YJR159W SOR1 Sorbitol dehydrogenase
          Length = 386

 Score =  104 bits (259), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 98/380 (25%), Positives = 163/380 (42%), Gaps = 57/380 (15%)

Query: 12  LAAVAYEAGKPLTVEEIIVEPPKAHEVR---IRITYTAVCHTDAYTLSGVDPE------- 61
           + A+ Y     L  E+  +  PK  + R   I++T T++C TD     G  PE       
Sbjct: 31  MKAMVYYGANDLRFEDRAI--PKIIDQRDAIIKMTNTSICGTDVGIWKGKSPEIEEIAVK 88

Query: 62  --GAFP-SILGHEGAGVVESVGKGVTNVKPGDHVVALYTAECQKCKFCTSGKTNLCGSVR 118
             G+F   +LGHEG G+V  VG  V N+K GD V+      C  C+ C  G    C +  
Sbjct: 89  NEGSFNGRVLGHEGTGIVTEVGDAVRNIKKGDKVIISCITRCGTCENCARGMYAHCMN-D 147

Query: 119 ATQGKGVMPDGTS--RFRTKNGESILHFM--GCSTFSQYTXXXXXXXXXXXXQAPLDRIC 174
                G   DGT     RT   ++ L+ +  G S                      +   
Sbjct: 148 GGWALGYSIDGTQAEYVRTPFADTSLYALPEGLSD---------------------ENAV 186

Query: 175 LLGCGVTTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKARGASRIIVVDINDQKKQ 234
           LL   + T +   ++  NV+ GD+VA+ GAG VG+  V  ++    S +IVVD++D + +
Sbjct: 187 LLSDALPTAHEIGVQMGNVKPGDSVAILGAGPVGMGCVLTSQLYSPSLLIVVDMDDNRLE 246

Query: 235 WASDFGATDFVNPSKDLKEGETIVSKLIELTDG-GLDFTFDCTGNTKVMRDALEACHKGW 293
            A + GAT  +N  K     E  V+K++E+T+G G+D   +  G     +   + C    
Sbjct: 247 MAKEMGATHTINSGK-----EDAVAKILEITNGRGVDCAMEAVG----AQPTWDICQ--- 294

Query: 294 GQSIIIGVAAAGQEISTRPFQLVTGRVW--KGSAFGGIKGRSEMGGLVSDYMDGQLKVDE 351
            Q I  G   A   +  +P      ++W    +   G+   +    L+ +   G+L+ D+
Sbjct: 295 -QIIKEGGHLANVGVHGKPVDFAIDKLWIKNLTITSGLVNTNTTSMLMKNCCSGKLQSDK 353

Query: 352 FITHRRPFTEINAAFDDLHH 371
            ++H   F ++   ++   H
Sbjct: 354 LVSHHCNFKDMANNYNIFKH 373

>TBLA0I01140 Chr9 (233777..234910) [1134 bp, 377 aa] {ON} Anc_2.480
           YMR083W
          Length = 377

 Score =  102 bits (255), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 84/264 (31%), Positives = 116/264 (43%), Gaps = 31/264 (11%)

Query: 8   PITCLAAVAYEAGKPLTVEEIIVEPPKAHEVRIRITYTAVCHTDAYTLSGVDPEGA-FPS 66
           P T  A V YE G PL    I V  PK +E+ I + Y+ VCHTD +   G  P     P 
Sbjct: 33  PTTQKAVVFYENGGPLKYTTIPVPKPKPNEILINVKYSGVCHTDLHAWKGDWPLAVKLPL 92

Query: 67  ILGHEGAGVVESVGKGVTNVKPGDHV-VALYTAECQKCKFCTSGKTNLCGSVRATQGKGV 125
           + GHEGAGVV + G  V N + GD+  +      C  C+ C  G  + C     +   G 
Sbjct: 93  VGGHEGAGVVVAKGSEVKNFEIGDYAGIKWLNGSCMSCELCEKGFESNCEQADLS---GY 149

Query: 126 MPDGTSRFRTKNGESILHFMGCSTFSQYTXXXXXXXXXXXXQAPLDRICLLGCGVTTGYG 185
             DG                   +F QY                L  +  + C   T Y 
Sbjct: 150 THDG-------------------SFQQYATADAVQAAHIPKNVDLAEVAPILCAGVTVY- 189

Query: 186 AAIKTANVQKGDTVAVFGA-GTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFGATDF 244
            A+KTA+V+ G  VA+ GA G +G   VQ AKA G  R++ +D  D+KK+     G   F
Sbjct: 190 KALKTADVKPGQWVAISGACGGLGSLAVQYAKAMGL-RVVGIDGGDEKKKLFHSLGGDIF 248

Query: 245 VNPSKDLKEGETIVSKLIELTDGG 268
           V    D  +  +IV  + ++T+GG
Sbjct: 249 V----DFTKTHSIVKDIQDVTNGG 268

>Suva_4.394 Chr4 (702935..703990) [1056 bp, 351 aa] {ON} YBR145W
           (REAL)
          Length = 351

 Score =  101 bits (252), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 104/387 (26%), Positives = 162/387 (41%), Gaps = 53/387 (13%)

Query: 8   PITCLAAVAYEAGKPLTVEEIIVEPPKAHEVRIRITYTAVCHTDAYTLSGVDP-EGAFPS 66
           P +  A V YE    L  ++I V  PKA+E+ + + Y+ VCH+D +   G  P +  FP 
Sbjct: 7   PESQKAIVFYETNGKLEYKDIAVPEPKANEILVHVKYSGVCHSDLHAWRGDWPFQLKFPL 66

Query: 67  ILGHEGAGVVESVGKGVTNVKPGDHV-VALYTAECQKCKFCTSGKTNLCGSVRATQGKGV 125
           I GHEGAGVV  +G  V   K GD   +      C  C++C  G  + C  +    G G 
Sbjct: 67  IGGHEGAGVVVKLGSNVKGWKVGDLAGIKWLNGTCMSCEYCEVGNESQCPHL---DGTGF 123

Query: 126 MPDGTSRFRTKNGESILHFMGCSTFSQYTXXXXXXXXXXXXQAPLDRICLLGCGVTTGYG 185
             DG                   TF +Y                L  +  + C   T Y 
Sbjct: 124 THDG-------------------TFQEYATADAVQAAHLPENVDLAEVAPILCAGVTVY- 163

Query: 186 AAIKTANVQKGDTVAVFGA-GTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFGATDF 244
            A+K AN+  G  V + GA G +G   +Q A A G  R+I +D  + KKQ     G   F
Sbjct: 164 KALKRANLIPGQWVTISGACGGLGSLAIQYATAMG-YRVIGIDEGETKKQLFEGLGGEVF 222

Query: 245 VNPSKDLKEGETIVSKLIELTDGGLDFTFDCTGNTKVMRDALEACHKGWGQSIIIGVAAA 304
           ++ +K+    + IV  +I+ TDGG     + + +   +  +   C    G  +++G+ A 
Sbjct: 223 IDFTKE----KDIVGAVIKATDGGSHGVINVSVSEAAIEASTRYCRPN-GTVVLVGMPAH 277

Query: 305 GQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGQLKVDEFITH--RRP---- 358
               S    Q+V             K  S +G  V +  D +  +D F  H  + P    
Sbjct: 278 AYCKSDVFNQVV-------------KSISIVGSCVGNRADTREALDFFARHLVKSPIRLA 324

Query: 359 -FTEINAAFDDLHHGDCL-RTVLDLSK 383
             +++   F+ + +G  + R V+D SK
Sbjct: 325 GLSDVPEIFEKMENGSIVGRYVVDTSK 351

>KLTH0G15686g Chr7 complement(1367997..1369052) [1056 bp, 351 aa]
           {ON} highly similar to uniprot|P00330 Saccharomyces
           cerevisiae YOL086C ADH1 Alcohol dehydrogenase involved
           in the production of certain carboxylate esters
          Length = 351

 Score =  101 bits (251), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 107/390 (27%), Positives = 166/390 (42%), Gaps = 59/390 (15%)

Query: 8   PITCLAAVAYEAGKPLTVEEIIVEPPKAHEVRIRITYTAVCHTDAYTLSGVDPEGA-FPS 66
           P T    + YE G  L  ++I V  PKA+E+ + + Y+ VCHTD +   G  P     P 
Sbjct: 7   PKTQKGVIFYETGGKLEYKDIDVPTPKANELLVNVKYSGVCHTDLHAYHGDWPLPVKLPL 66

Query: 67  ILGHEGAGVVESVGKGVTNVKPGDHV-VALYTAECQKCKFCTSGKTNLCGSVRATQGKGV 125
           + GHEGAGVV ++G+ V   K GD   +      C  C+ C  G  + C           
Sbjct: 67  VGGHEGAGVVVAMGENVKGWKVGDLAGIKWLNGSCMSCESCELGNESNC----------- 115

Query: 126 MPDGTSRFRTKNGESILHFMGCSTFSQYTXXXXXXXXXXXXQAPLDRICLLGCGVTTGYG 185
            P+      T +G          +F QY              A L  I  + C   T Y 
Sbjct: 116 -PEADLSGYTHDG----------SFQQYATADAVQAAKIPAGADLAEIAPILCAGITVY- 163

Query: 186 AAIKTANVQKGDTVAVFG-AGTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFGATDF 244
            A+K+AN+Q GD VA+ G AG +G   VQ AKA G  R++ +D  ++K+Q     G   F
Sbjct: 164 KALKSANLQAGDWVAISGAAGGLGSLAVQYAKAMG-YRVLGIDGGEEKEQLFRQLGGEVF 222

Query: 245 VNPSKDLKEGETIVSKLIELTDGGLDFTFDCTGNTKVMRDALEACH---KGWGQSIIIGV 301
           +    D +  + I  ++I+ T+GG         N  V   A+E+     +  G  +++G+
Sbjct: 223 I----DFRTCKDIEGEIIKATNGGAHGVI----NVSVSEAAIESSTNYVRANGTVVLVGL 274

Query: 302 AAAGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGQLKVDEFITH--RRP- 358
             AG +  +  F  V            +K  S +G  V +  D +  +D F+    R P 
Sbjct: 275 -PAGAKCKSDVFNQV------------VKSISIVGSYVGNRADTREALDFFVRGLVRSPI 321

Query: 359 ----FTEINAAFDDLHHGDCL-RTVLDLSK 383
                + +   F+ +  G  + R V+D S 
Sbjct: 322 KVVGLSTLPEIFEKMEKGQIVGRYVVDTSN 351

>AER032W Chr5 (696807..697862) [1056 bp, 351 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL086C (ADH1) and
           YBR145W (ADH5)
          Length = 351

 Score =  101 bits (251), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 79/264 (29%), Positives = 121/264 (45%), Gaps = 31/264 (11%)

Query: 8   PITCLAAVAYEAGKPLTVEEIIVEPPKAHEVRIRITYTAVCHTDAYTLSGVDP-EGAFPS 66
           P T  A + YE G PL   +I V  PKA E+ I + Y+ VCHTD +   G  P     P 
Sbjct: 7   PRTQKAVIFYENGGPLQYTDIEVPKPKATELLINVKYSGVCHTDLHAWKGDWPLPTKLPL 66

Query: 67  ILGHEGAGVVESVGKGVTNVKPGDHV-VALYTAECQKCKFCTSGKTNLCGSVRATQGKGV 125
           + GHEGAGVV ++G+ V   K GD   +      C  C++C     + C           
Sbjct: 67  VGGHEGAGVVVAMGENVRGWKIGDLAGIKWLNGSCMACEYCEKSNESNC----------- 115

Query: 126 MPDGTSRFRTKNGESILHFMGCSTFSQYTXXXXXXXXXXXXQAPLDRICLLGCGVTTGYG 185
            P+      T +G          +F QY                L ++  + C   T Y 
Sbjct: 116 -PEADLSGYTHDG----------SFQQYATADAVQAAHIPAGTDLAQVAPILCAGITVY- 163

Query: 186 AAIKTANVQKGDTVAVFGA-GTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFGATDF 244
            A+K+AN++ GD VA+ GA G +G   +Q A A G  R++ +D  ++K+Q     G   F
Sbjct: 164 KALKSANLRAGDWVAISGACGGLGSLAIQYATAMG-YRVLGIDGGEEKEQLFRQLGGEVF 222

Query: 245 VNPSKDLKEGETIVSKLIELTDGG 268
           +    D ++ + IV+ +++ T+GG
Sbjct: 223 I----DFRKSKDIVADVVKATNGG 242

>KLLA0F21010g Chr6 (1962951..1964003) [1053 bp, 350 aa] {ON}
           uniprot|P20369 Kluyveromyces lactis KLLA0F21010g ADH1
           Alcohol dehydrogenase 1
          Length = 350

 Score =  100 bits (249), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 80/264 (30%), Positives = 118/264 (44%), Gaps = 31/264 (11%)

Query: 8   PITCLAAVAYEAGKPLTVEEIIVEPPKAHEVRIRITYTAVCHTDAYTLSGVDP-EGAFPS 66
           P T    + YE G  L  ++I V  PKA+E+ I + Y+ VCHTD +   G  P     P 
Sbjct: 6   PETQKGVIFYENGGELQYKDIPVPKPKANELLINVKYSGVCHTDLHAWKGDWPLPTKLPL 65

Query: 67  ILGHEGAGVVESVGKGVTNVKPGDHV-VALYTAECQKCKFCTSGKTNLCGSVRATQGKGV 125
           + GHEGAGVV ++G+ V   K GD   +      C  C++C     + C           
Sbjct: 66  VGGHEGAGVVVAMGENVKGWKIGDFAGIKWLNGSCMSCEYCELSNESNC----------- 114

Query: 126 MPDGTSRFRTKNGESILHFMGCSTFSQYTXXXXXXXXXXXXQAPLDRICLLGCGVTTGYG 185
            P+      T +G          +F QY                L  +  + C   T Y 
Sbjct: 115 -PEADLSGYTHDG----------SFQQYATADAVQAAKIPVGTDLAEVAPVLCAGVTVY- 162

Query: 186 AAIKTANVQKGDTVAVFG-AGTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFGATDF 244
            A+K+AN++ GD VA+ G AG +G   VQ AKA G  R++ +D  ++K +   D G   F
Sbjct: 163 KALKSANLKAGDWVAISGAAGGLGSLAVQYAKAMG-YRVLGIDAGEEKAKLFKDLGGEYF 221

Query: 245 VNPSKDLKEGETIVSKLIELTDGG 268
           +    D  + + I  ++IE T GG
Sbjct: 222 I----DFTKSKNIPEEVIEATKGG 241

>KAFR0G01420 Chr7 complement(314119..315174) [1056 bp, 351 aa] {ON}
           Anc_3.118 YBR145W
          Length = 351

 Score =  100 bits (249), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 102/390 (26%), Positives = 164/390 (42%), Gaps = 59/390 (15%)

Query: 8   PITCLAAVAYEAGKPLTVEEIIVEPPKAHEVRIRITYTAVCHTDAYTLSGVDP-EGAFPS 66
           P T    + YE G  L  ++I V  PKA+E+ I + Y+ VCHTD +   G  P +   P 
Sbjct: 7   PKTQKGVIFYENGGKLEYKDIPVPTPKANELLINVKYSGVCHTDLHAWKGDWPLDVKLPL 66

Query: 67  ILGHEGAGVVESVGKGVTNVKPGDHV-VALYTAECQKCKFCTSGKTNLCGSVRATQGKGV 125
           + GHEGAGVV ++G+ V   K GD+  +      C  C++C     + C           
Sbjct: 67  VGGHEGAGVVVAMGENVRGWKIGDYAGIKWLNGSCMSCEYCELSNESNC----------- 115

Query: 126 MPDGTSRFRTKNGESILHFMGCSTFSQYTXXXXXXXXXXXXQAPLDRICLLGCGVTTGYG 185
            P+      T +G          +F QY                L ++  + C   T Y 
Sbjct: 116 -PEADLSGYTHDG----------SFQQYATADAVQAAKIPQGTDLAQVAPILCAGITVY- 163

Query: 186 AAIKTANVQKGDTVAVFGA-GTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFGATDF 244
            A+K+AN+  G+ VA+ GA G +G   +Q AKA G  RI+ +D  D+K     + G   F
Sbjct: 164 KALKSANLSAGEWVAISGACGGLGSLAIQYAKAMG-YRILGIDGGDEKAALFKELGGEVF 222

Query: 245 VNPSKDLKEGETIVSKLIELTDGGLDFTFDCTGNTKVMRDALEACH---KGWGQSIIIGV 301
           +    D  + + I + +IE T+GG         N  V   A+E+     +  G  +++G+
Sbjct: 223 I----DFTKTKDIEAAVIEATNGGAHGVI----NVSVSEAAIESSTRYVRSNGTCVLVGL 274

Query: 302 AAAGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGQLKVDEFI-------T 354
              G    +  F  V            +K  S +G  V +  D +  +D F         
Sbjct: 275 -PGGAYCKSEVFSHV------------VKSISIVGSYVGNRADTREAIDFFTRGLVKAPI 321

Query: 355 HRRPFTEINAAFDDLHHGDCL-RTVLDLSK 383
           H  P + +   F+ +  G  + R V+D ++
Sbjct: 322 HIAPLSAVPEIFEKMEKGQIVGRYVVDCNQ 351

>SAKL0B00814g Chr2 (74565..75629) [1065 bp, 354 aa] {ON} similar to
           uniprot|P35497 Saccharomyces cerevisiae YJR159W SOR1
           Sorbitol dehydrogenase expression is induced in the
           presence of sorbitol
          Length = 354

 Score =  100 bits (248), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 112/387 (28%), Positives = 177/387 (45%), Gaps = 62/387 (16%)

Query: 14  AVAYEAGKPLTVEEIIV---EPPKAHEVRIRITYTAVCHTDA-YTLSGVDPEGAF----P 65
           AV  +    +T E+I V   E P  H V++ I  T +C +D  Y  +G    G F    P
Sbjct: 7   AVVLQKQGLITFEDIPVPQIEDP--HYVKLAIKKTGICGSDVHYYKTGAI--GNFVVKDP 62

Query: 66  SILGHEGAGVVESVGKGVTNVKPGDHVVALYTAECQKCKFCTSGKTNLCGSVRATQGKGV 125
            +LGHE +GVV  VG  VT+VK GD V        +  K   SG  NLC S+       +
Sbjct: 63  MVLGHESSGVVVEVGSKVTSVKVGDRVAIEPGVPSRYSKATKSGHYNLCPSMAFAATPPI 122

Query: 126 MPDGTS-RFRTKNGESILHFMGCSTFSQYTXXXXXXXXXXXXQAPLDRICL--LGCGVTT 182
             DGT  ++     + ++      +F +                     C+  L  GV  
Sbjct: 123 --DGTLLKYYLSPEDFLVKLPDSVSFEEGA-------------------CVEPLSVGV-- 159

Query: 183 GYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFGAT 242
               A K A+V+ G  V VFGAG VGL     ++A GA+ ++ VD+ D K +  ++FGAT
Sbjct: 160 ---HANKLADVRFGSKVVVFGAGPVGLLAGAVSRAFGATDVVFVDVFDHKLERTNEFGAT 216

Query: 243 DFVNPSKDLKEGETIVSKLIELTDGGL-DFTFDCTGNTKVMRDALEACHKGWGQSIIIGV 301
             VN SK  K  + +V ++  +  G   +  F+C+G    +R  ++AC  G G+ + +G+
Sbjct: 217 QTVNSSK-FKSEDDLVKEIQRVLSGEQPEVVFECSGAEVCIRAGIKACKAG-GRYVQVGM 274

Query: 302 AAAG-----QEISTRPFQLV-TGRVWKGSAFGGIKGRSEMGGLVSDYMDGQLKVDEFITH 355
                     E+ ++  Q++ T R   G     +K  SE          G++ V   ITH
Sbjct: 275 GKDNVNFPISEVVSKELQVLGTFRYCFGDYNDSVKLISE----------GKVNVKPLITH 324

Query: 356 RRPFTEINAAFD-DLHHG-DCLRTVLD 380
           R  F +   A++ ++ HG D ++T++D
Sbjct: 325 RFKFQDAIKAYEFNIEHGEDVVKTIID 351

>NCAS0I01720 Chr9 (318144..319199) [1056 bp, 351 aa] {ON} 
          Length = 351

 Score = 99.8 bits (247), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 94/380 (24%), Positives = 163/380 (42%), Gaps = 39/380 (10%)

Query: 8   PITCLAAVAYEAGKPLTVEEIIVEPPKAHEVRIRITYTAVCHTDAYTLSGVDP-EGAFPS 66
           P T  A +    G PL  ++I V  PK++E+ + I Y+ VCHTD +   G  P +   P 
Sbjct: 7   PKTQKAIIFESNGGPLEYKDIPVPTPKSNEILVNIKYSGVCHTDLHAWKGDWPLDTKLPL 66

Query: 67  ILGHEGAGVVESVGKGVTNVKPGDHV-VALYTAECQKCKFCTSGKTNLCGSVRATQGKGV 125
           + GHEGAG+V ++G  V   K GD+  V      C  C++C  G  + C           
Sbjct: 67  VGGHEGAGIVVAIGDNVKGWKIGDYAGVKWLNGSCMACEYCELGNESNC----------- 115

Query: 126 MPDGTSRFRTKNGESILHFMGCSTFSQYTXXXXXXXXXXXXQAPLDRICLLGCGVTTGYG 185
            P+      T +G          +F QY                L  +  + C   T Y 
Sbjct: 116 -PNADLSGYTHDG----------SFQQYATADAVQAARIPAGTNLSEVAPILCAGMTVY- 163

Query: 186 AAIKTANVQKGDTVAVFGA-GTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFGATDF 244
            A+K+AN++ G+ VA+ GA G +G   +Q A A G  R++ +D  D K +         F
Sbjct: 164 KALKSANLRAGEWVAISGACGGLGSLCIQYANAMG-YRVLGIDGGDDKAKLFKQLHGEVF 222

Query: 245 VNPSKDLKEGETIVSKLIELTDGGLDFTFDCTGNTKVMRDALEACHKGWGQSIIIGVAAA 304
           +    D  + + ++S++ ++T+GG     + + +   +  + + C    G  +++G+   
Sbjct: 223 I----DFTKTKDVISEVNKVTNGGAHGVINVSVSEAAIEASTKYCRAN-GTVVLVGLPGG 277

Query: 305 GQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGQLKVDEFITHRRPFTEINA 364
            +  S    Q+V      GS  G    R++    +  +  G +K      H  P + +  
Sbjct: 278 AKCKSDVFNQVVKSMTIVGSYVG---NRADTREALDFFTRGLVKAP---IHVAPLSTLPT 331

Query: 365 AFDDLHHGDCL-RTVLDLSK 383
            F+ +  G  + R V+D S+
Sbjct: 332 IFEKMEKGQIVGRYVVDTSR 351

>KLLA0B09064g Chr2 complement(792849..793973) [1125 bp, 374 aa] {ON}
           uniprot|P49384 Kluyveromyces lactis KLLA0B09064g ADH3
           Alcohol dehydrogenase III mitochondrial precursor
          Length = 374

 Score = 99.4 bits (246), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 99/381 (25%), Positives = 164/381 (43%), Gaps = 41/381 (10%)

Query: 8   PITCLAAVAYEAGKPLTVEEIIVEPPKAHEVRIRITYTAVCHTDAYTLSGVDP-EGAFPS 66
           P T    + YE G  L  ++I V  PK +E+ I + Y+ VCHTD +   G  P     P 
Sbjct: 30  PETQKGVIFYENGGKLEYKDIPVPKPKPNEILINVKYSGVCHTDLHAWKGDWPLPTKLPL 89

Query: 67  ILGHEGAGVVESVGKGVTNVKPGDHV-VALYTAECQKCKFCTSGKTNLCGSVRATQGKGV 125
           + GHEGAGVV ++G+ V     GD   +      C  C++C     + C           
Sbjct: 90  VGGHEGAGVVVAMGENVKGWNIGDFAGIKWLNGSCMSCEYCELSNESNC----------- 138

Query: 126 MPDGTSRFRTKNGESILHFMGCSTFSQYTXXXXXXXXXXXXQAPLDRICLLGCGVTTGYG 185
            PD      T +G          +F QY                L  +  + C   T Y 
Sbjct: 139 -PDADLSGYTHDG----------SFQQYATADAVQAARIPKGTDLAEVAPILCAGVTVY- 186

Query: 186 AAIKTANVQKGDTVAVFG-AGTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFGATDF 244
            A+K+AN++ GD VA+ G AG +G   VQ AKA G  R++ +D  ++K +     G   F
Sbjct: 187 KALKSANLKAGDWVAISGAAGGLGSLAVQYAKAMG-YRVVGIDGGEEKGKLVKQLGGEAF 245

Query: 245 VNPSKDLKEGETIVSKLIELTDGGLDFTFDCTGNTKVMRDALEACHKGWGQSIIIGVAAA 304
           V    D  + + +V+++ E+T+GG     + + +   M  + +      G  +++G+  A
Sbjct: 246 V----DFTKTKDMVAEIQEITNGGPHGVINVSVSEAAMNASTQFVRPT-GTVVLVGL-PA 299

Query: 305 GQEISTRPFQLVTGRV-WKGSAFGGIKGRSEMGGLVSDYMDGQLKVDEFITHRRPFTEIN 363
           G  I +  F  V   +  KGS  G    R++    ++ + +G +     +      +E+ 
Sbjct: 300 GAVIKSEVFSHVVKSINIKGSYVG---NRADTREAINFFANGHVHSPIKVVG---LSELP 353

Query: 364 AAFDDLHHGDCL-RTVLDLSK 383
             ++ +  G  L R V+D S 
Sbjct: 354 KVYELMEQGKILGRYVVDTSN 374

>SAKL0C10164g Chr3 complement(914732..915787) [1056 bp, 351 aa] {ON}
           uniprot|Q6XQ74 Saccharomyces kluyveri ADH1 Alcohol
           dehydrogenase 1
          Length = 351

 Score = 99.0 bits (245), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 98/387 (25%), Positives = 165/387 (42%), Gaps = 53/387 (13%)

Query: 8   PITCLAAVAYEAGKPLTVEEIIVEPPKAHEVRIRITYTAVCHTDAYTLSGVDP-EGAFPS 66
           P T  A + YE G  L  ++I V  PK++E+ I I Y+ VCHTD +   G  P     P 
Sbjct: 7   PETQKAVIFYENGGELQYKDIPVPKPKSNEILINIKYSGVCHTDLHAWKGDWPLPTKLPL 66

Query: 67  ILGHEGAGVVESVGKGVTNVKPGDHV-VALYTAECQKCKFCTSGKTNLCGSVRATQGKGV 125
           + GHEGAG+V  +G+ V   K GD+  +      C  C++C     + C           
Sbjct: 67  VGGHEGAGIVVGMGENVKGWKIGDYAGIKWLNGSCMSCEYCELSNESNC----------- 115

Query: 126 MPDGTSRFRTKNGESILHFMGCSTFSQYTXXXXXXXXXXXXQAPLDRICLLGCGVTTGYG 185
            PD      T +G          +F QY                L  +  + C   T Y 
Sbjct: 116 -PDADLSGYTHDG----------SFQQYATADAVQAARIAPGTDLAEVAPVLCAGITVY- 163

Query: 186 AAIKTANVQKGDTVAVFGA-GTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFGATDF 244
            A+K+AN++ G+ VA+ GA G +G   +Q AKA G  R++ +D  D+K     + G   F
Sbjct: 164 KALKSANLRAGEWVAISGACGGLGSLAIQYAKAMG-YRVLGIDGGDEKAALFKELGGEVF 222

Query: 245 VNPSKDLKEGETIVSKLIELTDGGLDFTFDCTGNTKVMRDALEACHKGWGQSIIIGVAAA 304
           +    D  + + +V  +++ T+GG     + + +   +  +   C    G  +++G+   
Sbjct: 223 I----DFTKTKDVVKAVVDATNGGAHGVINVSVSEAAIEASTVYCRAN-GTVVLVGL-PG 276

Query: 305 GQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGQLKVDEFITH--RRP---- 358
           G +  +  F  V            +K  S +G  V +  D +  +D F     + P    
Sbjct: 277 GAKCKSDVFNQV------------VKSISIVGSYVGNRADTREALDFFSRGLVKSPIMVV 324

Query: 359 -FTEINAAFDDLHHGDCL-RTVLDLSK 383
             +E+ + ++ +  G  + R V+D SK
Sbjct: 325 GLSELPSIYEKMEKGAIVGRYVVDTSK 351

>Ecym_7391 Chr7 (801773..802900) [1128 bp, 375 aa] {ON} similar to
           Ashbya gossypii ABL033C
          Length = 375

 Score = 98.6 bits (244), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 103/387 (26%), Positives = 169/387 (43%), Gaps = 41/387 (10%)

Query: 2   SETVGKPITCLAAVAYEAGKPLTVEEIIVEPPKAHEVRIRITYTAVCHTDAYTLSGVDPE 61
           S + G P+T  A + YE G  L  ++I V  PK +E+ + + Y+ VCHTD +   G  P 
Sbjct: 25  STSSGIPLTQKAVIFYEHGDKLHYKDIPVPKPKPNEILVNVKYSGVCHTDIHAWKGDWPL 84

Query: 62  GA-FPSILGHEGAGVVESVGKGVTNVKPGDHV-VALYTAECQKCKFCTSGKTNLCGSVRA 119
               P + GHEGAG+V + G  VTN + GD+  V      C  C++C +G  + C     
Sbjct: 85  ATKLPLVGGHEGAGIVVAKGSNVTNFEIGDYAGVKWLNKSCMSCEYCETGHESNCAEADL 144

Query: 120 TQGKGVMPDGTSRFRTKNGESILHFMGCSTFSQYTXXXXXXXXXXXXQAPLDRICLLGCG 179
           +   G   DG                   +F QY                L ++  + C 
Sbjct: 145 S---GYTRDG-------------------SFQQYATADAVQAAKIPQGTDLAQVAPILCA 182

Query: 180 VTTGYGAAIKTANVQKGDTVAV-FGAGTVGLSVVQGAKARGASRIIVVDINDQKKQWASD 238
             T Y  A+KTAN+  G  VA+    G +G   VQ AKA G  R++ +D    K      
Sbjct: 183 GVTVY-KALKTANLDPGQWVAISGAGGGLGSLAVQYAKAMGL-RVVGIDGGAAKDALFKK 240

Query: 239 FGATDFVNPSKDLKEGETIVSKLIELTDGGLDFTFDCTGNTKVMRDALEACHKGWGQSII 298
            G   F+    D  + + IV+ + E T+GG     + + +   +  +++   +  G  ++
Sbjct: 241 LGGEVFI----DFTKSKDIVADIQEATNGGPHGAVNVSVSEAAIVQSVKYI-RPTGTVVL 295

Query: 299 IGVAAAGQEISTRPFQLVTGRV-WKGSAFGGIKGRSEMGGLVSDYMDGQLKVDEFITHRR 357
           +G+  A   +++  F  V   +  KGS  G    R++M   +  +  G +K    I    
Sbjct: 296 VGL-PANSYVNSEIFSHVIKSISIKGSYVG---NRADMREAIDFFTRGLVKAPIKIIG-- 349

Query: 358 PFTEINAAFDDLHHGDCL-RTVLDLSK 383
             +E+  A+ +L  G+ + R V+D SK
Sbjct: 350 -LSELPTAYHELEAGNMVGRFVVDTSK 375

>KLTH0D05588g Chr4 complement(502176..503345) [1170 bp, 389 aa] {ON}
           similar to uniprot|P07246 Saccharomyces cerevisiae
           YMR083W ADH3 Alcohol dehydrogenase isoenzyme III
          Length = 389

 Score = 97.8 bits (242), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 101/373 (27%), Positives = 157/373 (42%), Gaps = 39/373 (10%)

Query: 15  VAYEAGKPLTVEEIIVEPPKAHEVRIRITYTAVCHTDAYTLSGVDPEGA-FPSILGHEGA 73
           + YE G  L  +++ V  PK +E+ I + Y+ VCHTD +   G  P     P + GHEGA
Sbjct: 52  IFYEHGGELHYKDLPVPKPKPNEILINVKYSGVCHTDLHAWKGDWPLAVKLPLVGGHEGA 111

Query: 74  GVVESVGKGVTNVKPGDHV-VALYTAECQKCKFCTSGKTNLCGSVRATQGKGVMPDGTSR 132
           GVV + G+ VTN + GD+  +      C  C+ C  G    C     +   G   DG   
Sbjct: 112 GVVVAKGENVTNFEIGDYAGIKWLNGSCMSCELCEQGNEPNCEHADLS---GYTHDG--- 165

Query: 133 FRTKNGESILHFMGCSTFSQYTXXXXXXXXXXXXQAPLDRICLLGCGVTTGYGAAIKTAN 192
                           +F QY                L +I  + C   T Y  A+KTA+
Sbjct: 166 ----------------SFQQYATADAVQAAQIPKGTDLAQIAPILCAGVTVY-KALKTAD 208

Query: 193 VQKGDTVAVFG-AGTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFGATDFVNPSKDL 251
           V+ G  VA+ G AG +G   VQ AKA G  R++ +D  + KK+   D G   F+    D 
Sbjct: 209 VRPGQWVAISGAAGGLGSLAVQYAKAMGL-RVLGIDGGEDKKKLFHDLGGETFI----DF 263

Query: 252 KEGETIVSKLIELTDGGLDFTFDCTGNTKVMRDALEACHKGWGQSIIIGVAAAGQEISTR 311
           +  + +V  + E T GG     + + +   +  + E   +  G  +++G+ A     S  
Sbjct: 264 RTTKDMVGAIQEATQGGPHAVINVSVSEAAISMSTEYV-RPTGSVVLVGLPANAYVKSEV 322

Query: 312 PFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGQLKVDEFITHRRPFTEINAAFDDLHH 371
              +V     KGS  G    R++    +  +  G +K    I      +E+  A+  +  
Sbjct: 323 FSHVVKSISIKGSYVG---NRADTREAIDFFARGLVKAPIKIIG---LSELPEAYKLMEA 376

Query: 372 GDCL-RTVLDLSK 383
           G  L R V+D  K
Sbjct: 377 GKILGRYVVDTEK 389

>KLTH0G18986g Chr7 complement(1639254..1640318) [1065 bp, 354 aa]
           {ON} similar to uniprot|P35497 Saccharomyces cerevisiae
           YJR159W SOR1 Sorbitol dehydrogenase expression is
           induced in the presence of sorbitol
          Length = 354

 Score = 97.1 bits (240), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 100/368 (27%), Positives = 163/368 (44%), Gaps = 71/368 (19%)

Query: 36  HEVRIRITYTAVCHTDA-YTLSGVDPEGAF----PSILGHEGAGVVESVGKGVTNVKPGD 90
           H V+++I  T +C +D  Y ++G    G F    P ILGHE +G+V  VG  V+ V+ GD
Sbjct: 30  HYVKLQIKKTGICGSDVHYYVAGAI--GDFVVKKPMILGHESSGLVVEVGSEVSRVRVGD 87

Query: 91  HVVALYTAECQKCKFCTSGKTNLCGSVRATQGKGVMPDGTSRFRTKNGESILHFMGCSTF 150
            V        +      +G+ NLC  ++      +           +G  + +++     
Sbjct: 88  RVAIEPGVPSRYSDETKAGRYNLCPHMQFAATPPI-----------DGTLVKYYL----- 131

Query: 151 SQYTXXXXXXXXXXXXQAPLDRICLLGCGVTTGYGAAI----------KTANVQKGDTVA 200
                            AP D +  L   V+   GA +          K A V     VA
Sbjct: 132 -----------------APEDFLVKLPDHVSYEEGALVEPLSVGVHANKLAGVAFNQRVA 174

Query: 201 VFGAGTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFGATDFVNPSKDLKEGETIVSK 260
           VFGAG VGL     A+A GAS ++ +D+ + K   +S+FG T FVN S ++K+ + +V K
Sbjct: 175 VFGAGPVGLLTGAVARAFGASEVVYIDVFEHKLSLSSNFGGTQFVN-SANIKDEDDLV-K 232

Query: 261 LIELTDGGL--DFTFDCTGNTKVMRDALEACHKGWGQSIIIGVAAAGQEISTRPFQLVTG 318
            IE   GG   D  FDCTG    +R  ++ C+ G G  + +G+   G +    P   +  
Sbjct: 233 EIERVLGGARPDVVFDCTGAEICIRTGIKVCNSG-GTYVQVGM---GHDDVNFPIGAIGA 288

Query: 319 RVWK-----GSAFGGIKGRSEMGGLVSDYMDGQLKVDEFITHRRPFTEINAAFD-DLHHG 372
           +  K       AFG  +   ++         G + V   +THR  F +  AA++ ++ HG
Sbjct: 289 KELKVLGCFRYAFGDYRDAVQL------IASGDVNVKPLVTHRFKFEDAEAAYEFNIKHG 342

Query: 373 -DCLRTVL 379
            + ++T++
Sbjct: 343 SEVIKTII 350

>NDAI0A06930 Chr1 (1585575..1586630) [1056 bp, 351 aa] {ON}
           Anc_3.118
          Length = 351

 Score = 97.1 bits (240), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 101/387 (26%), Positives = 162/387 (41%), Gaps = 53/387 (13%)

Query: 8   PITCLAAVAYEAGKPLTVEEIIVEPPKAHEVRIRITYTAVCHTDAYTLSGVDPEGA-FPS 66
           P T  A +    G  L  ++I V  PK+ E+ I + Y+ VCHTD +   G  P     P 
Sbjct: 7   PKTQKAVIFETNGGKLEYKDIPVPVPKSTEILINVKYSGVCHTDLHAWKGDWPLATKLPL 66

Query: 67  ILGHEGAGVVESVGKGVTNVKPGDHV-VALYTAECQKCKFCTSGKTNLCGSVRATQGKGV 125
           + GHEGAG+V  VG+ V   K GD   +      C  C++C  G  + C           
Sbjct: 67  VGGHEGAGIVVQVGENVQGWKVGDLAGIKWLNGSCMACEYCELGNESNC----------- 115

Query: 126 MPDGTSRFRTKNGESILHFMGCSTFSQYTXXXXXXXXXXXXQAPLDRICLLGCGVTTGYG 185
            P+      T +G          +F QY                L  +  + C   T Y 
Sbjct: 116 -PNADLSGYTHDG----------SFQQYATADAVQAARIPQGTDLAEVAPVLCAGITVY- 163

Query: 186 AAIKTANVQKGDTVAVFG-AGTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFGATDF 244
            A+K+AN++ G+ VA+ G AG +G   VQ AKA G  RI+ +D  ++K++   + G   F
Sbjct: 164 KALKSANLRAGEWVAISGAAGGLGSLAVQYAKAMG-YRILGIDGGEEKEKLFRELGGEIF 222

Query: 245 VNPSKDLKEGETIVSKLIELTDGGLDFTFDCTGNTKVMRDALEACHKGWGQSIIIGVAAA 304
           +    D  + + IV  +I+ T+GG     + + +   +  + E C    G  +++G+   
Sbjct: 223 I----DFTKTKDIVGDIIKATNGGAHGVINVSVSEAAIGASTEYCRAN-GTVVLVGLPRD 277

Query: 305 GQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGQLKVDEF-------ITHRR 357
            +  S    Q+V             K  S +G  V +  D +  +D F         H  
Sbjct: 278 AKCKSDVFNQVV-------------KSISIVGSYVGNRADTREALDFFSRGLVKSPIHIA 324

Query: 358 PFTEINAAFDDLHHGDCL-RTVLDLSK 383
           P +++   F  +  G  + R V+D SK
Sbjct: 325 PLSDLPEIFGKMEKGQIVGRYVVDTSK 351

>TPHA0M00730 Chr13 complement(137798..138850) [1053 bp, 350 aa] {ON}
           Anc_3.118 YBR145W
          Length = 350

 Score = 96.7 bits (239), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 103/390 (26%), Positives = 163/390 (41%), Gaps = 61/390 (15%)

Query: 8   PITCLAAVAYEAGKPLTVEEIIVEPPKAHEVRIRITYTAVCHTDAYTLSGVDPEGA-FPS 66
           P T    + YE   PL  ++I V  P  +E+ I + Y+ VCHTD +   G  P     P 
Sbjct: 6   PKTQKGVIFYENNGPLEYKDIPVPTPLPNELLIHVLYSGVCHTDLHAWHGDWPLPVKLPL 65

Query: 67  ILGHEGAGVVESVGKGVTNVKPGDHV-VALYTAECQKCKFCTSGKTNLCGSVRATQGKGV 125
           + GHEGAGVV  +G  V   K GD+  +      C  C+ C     + C           
Sbjct: 66  VGGHEGAGVVVGMGSSVKGWKVGDYAGIKWLNGSCMSCEECELSNESNC----------- 114

Query: 126 MPDGTSRFRTKNGESILHFMGCSTFSQYTXXXXXXXXXXXXQAPLDRICLLGCGVTTGYG 185
            P+      T +G          +F QY              A L  I  + C   T Y 
Sbjct: 115 -PEADLSGYTHDG----------SFQQYATADAVQAAKIPAGADLKNIAPILCAGVTVY- 162

Query: 186 AAIKTANVQKGDTVAVFGA-GTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFGATDF 244
            AIK+AN++ GD +A+ GA G +G   +Q  KA G  RI+ +D   +K++     G   F
Sbjct: 163 KAIKSANLKAGDWLAISGACGGLGSLAIQYGKAMGF-RILGIDGGAEKEELFKKLGGEYF 221

Query: 245 VNPSKDLKEGETIVSKLIELTDGGLDFTFDCTGNTKVMRDALEACH---KGWGQSIIIGV 301
           +    D  + + I++++ + T+GG         N  V   A+EA     +  G  +++G+
Sbjct: 222 I----DFTQCKDIIAEVKKATNGGAHGVI----NVSVSEAAIEASTNYVRSNGTVVLVGL 273

Query: 302 AAAGQEISTRPFQLVTGRVWKGSAFGG-IKGRSEMGGLVSDYMDGQLKVDEFITH--RRP 358
            A              G V K + F   +K    +G  V +  D +  +D F+    + P
Sbjct: 274 PA--------------GAVCKSNVFNQVVKSTKIVGSYVGNRADTREAIDFFVRGLVKSP 319

Query: 359 -----FTEINAAFDDLHHGDCL-RTVLDLS 382
                 +++ + FDD+  G  + R V+D S
Sbjct: 320 IKVVGLSQLASVFDDMQAGKIVGRVVVDTS 349

>SAKL0F06270g Chr6 (472877..473932) [1056 bp, 351 aa] {ON} similar
           to uniprot|P00331 Saccharomyces cerevisiae YMR303C ADH2
           Glucose-repressible alcohol dehydrogenase II
          Length = 351

 Score = 96.3 bits (238), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 95/387 (24%), Positives = 166/387 (42%), Gaps = 53/387 (13%)

Query: 8   PITCLAAVAYEAGKPLTVEEIIVEPPKAHEVRIRITYTAVCHTDAYTLSGVDP-EGAFPS 66
           P T  A + YE G  L  ++I V  PK++E+ I + Y+ VCHTD +   G  P     P 
Sbjct: 7   PKTQKAVIFYENGGELQYKDIPVPKPKSNEILINVKYSGVCHTDLHAWKGDWPLPTKLPL 66

Query: 67  ILGHEGAGVVESVGKGVTNVKPGDHV-VALYTAECQKCKFCTSGKTNLCGSVRATQGKGV 125
           + GHEGAGVV ++G+ V   K GD+  +      C  C++C     + C           
Sbjct: 67  VGGHEGAGVVVAIGENVKGWKIGDYAGIKWLNGSCMACEYCELSNESNC----------- 115

Query: 126 MPDGTSRFRTKNGESILHFMGCSTFSQYTXXXXXXXXXXXXQAPLDRICLLGCGVTTGYG 185
            P+      T +G          +F QY                L  +  + C   T Y 
Sbjct: 116 -PEADLSGYTHDG----------SFQQYATADAVQAARIPAGTDLAEVAPVLCAGITVY- 163

Query: 186 AAIKTANVQKGDTVAVFGA-GTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFGATDF 244
            A+K+AN++ G+ VA+ GA G +G   +Q AKA G  R++ +D  ++K     + G   F
Sbjct: 164 KALKSANLRAGEWVAISGACGGLGSLAIQYAKAMG-YRVLGIDGGEEKAALFKELGGEVF 222

Query: 245 VNPSKDLKEGETIVSKLIELTDGGLDFTFDCTGNTKVMRDALEACHKGWGQSIIIGVAAA 304
           +    D  + + +V  +++ T+GG     + + +   +  +   C    G  +++G+   
Sbjct: 223 I----DFTKTKDVVKAVVDATNGGAHGVINVSVSEAAIEASTVYCRAN-GTVVLVGL-PG 276

Query: 305 GQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGQLKVDEFITH--RRP---- 358
           G +  +  F  V            +K  + +G  V +  D +  +D F     + P    
Sbjct: 277 GAKCKSDVFNQV------------VKSTTIVGSYVGNRADTREALDFFARGLVKSPIKVV 324

Query: 359 -FTEINAAFDDLHHGDCL-RTVLDLSK 383
             +E+ + ++ +  G  + R V+D SK
Sbjct: 325 GLSELPSIYEKMEKGAIVGRYVVDTSK 351

>ZYRO0G03388g Chr7 complement(265952..267064) [1113 bp, 370 aa] {ON}
           similar to uniprot|P07246 Saccharomyces cerevisiae
           YMR083W
          Length = 370

 Score = 96.7 bits (239), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 98/387 (25%), Positives = 166/387 (42%), Gaps = 39/387 (10%)

Query: 1   MSETVGKPITCLAAVAYEAGKPLTVEEIIVEPPKAHEVRIRITYTAVCHTDAYTLSGVDP 60
           +S T+  P T    + YE+G  L  +++ V  P+ +E+ + + Y+ VCHTD +   G  P
Sbjct: 19  LSSTISIPSTQKGVIFYESGGKLHYKDLAVPKPRNNEILVNVKYSGVCHTDLHAWKGDWP 78

Query: 61  -EGAFPSILGHEGAGVVESVGKGVTNVKPGDHV-VALYTAECQKCKFCTSGKTNLCGSVR 118
            +   P + GHEGAGVV + G+ V N + GD   +      CQ C+ C  G  + C    
Sbjct: 79  LDTKLPLVGGHEGAGVVVAKGENVKNFEIGDLAGIKWLNGSCQSCEMCEMGHESNCAHAD 138

Query: 119 ATQGKGVMPDGTSRFRTKNGESILHFMGCSTFSQYTXXXXXXXXXXXXQAPLDRICLLGC 178
            +   G   DG                   TF QY                L  +  + C
Sbjct: 139 LS---GYTHDG-------------------TFQQYATADAIQAAHIPKGTDLAGVAPILC 176

Query: 179 GVTTGYGAAIKTANVQKGDTVAVFG-AGTVGLSVVQGAKARGASRIIVVDINDQKKQWAS 237
              T Y  A++++  + G+ VA+ G AG +G    Q A+A G  R++ +D  + K +   
Sbjct: 177 AGVTVY-KALRSSGARPGEWVAISGAAGGLGSLATQYARAMGL-RVVGIDGGEDKAKLFK 234

Query: 238 DFGATDFVNPSKDLKEGETIVSKLIELTDGGLDFTFDCTGNTKVMRDALEACHKGWGQSI 297
             G   F++ +K+    + I + ++E T GG     + + + K M  ++E   +  G  +
Sbjct: 235 SLGGEIFIDFTKE----KDIPAAILEATQGGAHGVINVSVSEKAMSQSVEYV-RPQGTVV 289

Query: 298 IIGVAAAGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGQLKVDEFITHRR 357
           ++G+ A     S     +V     KGS  G    R++    V  +  G +K    I    
Sbjct: 290 LVGLPANAVIKSNVFNHVVKSFSIKGSYVG---NRADSREAVEFFSRGLVKSPIKIVG-- 344

Query: 358 PFTEINAAFDDLHHGDCL-RTVLDLSK 383
             +E+   ++ +  G  L R V+D SK
Sbjct: 345 -LSELPKIYELMEAGKILGRYVVDTSK 370

>Suva_13.261 Chr13 (416378..417505) [1128 bp, 375 aa] {ON} YMR083W
           (REAL)
          Length = 375

 Score = 96.7 bits (239), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 102/387 (26%), Positives = 159/387 (41%), Gaps = 39/387 (10%)

Query: 1   MSETVGKPITCLAAVAYEAGKPLTVEEIIVEPPKAHEVRIRITYTAVCHTDAYTLSGVDP 60
           +  T+  P T    + YE    L  ++I V  PK +E+ I + Y+ VCHTD +   G  P
Sbjct: 24  LQSTIAIPQTQKGVIFYENNGKLHYKDIPVPEPKPNEILINVKYSGVCHTDLHAWHGDWP 83

Query: 61  EGA-FPSILGHEGAGVVESVGKGVTNVKPGDHV-VALYTAECQKCKFCTSGKTNLCGSVR 118
                P + GHEGAGVV  +G  V   K GD   +      C  C+FC SG  + C    
Sbjct: 84  LPVKLPLVGGHEGAGVVVKLGSNVKGWKVGDLAGIKWLNGSCMTCEFCESGHESNC---- 139

Query: 119 ATQGKGVMPDGTSRFRTKNGESILHFMGCSTFSQYTXXXXXXXXXXXXQAPLDRICLLGC 178
                   PD      T +G          +F Q+                L  +  + C
Sbjct: 140 --------PDADLSGYTHDG----------SFQQFATADAIQAAKIQQGTDLAEVAPILC 181

Query: 179 GVTTGYGAAIKTANVQKGDTVAVFG-AGTVGLSVVQGAKARGASRIIVVDINDQKKQWAS 237
              T Y  A+K AN++ GD VA+ G AG +G   VQ A A G  R++ +D   +K++   
Sbjct: 182 AGVTVY-KALKEANLKAGDWVAISGAAGGLGSLAVQYATAMG-YRVLGIDAGAEKEKLFK 239

Query: 238 DFGATDFVNPSKDLKEGETIVSKLIELTDGGLDFTFDCTGNTKVMRDALEACHKGWGQSI 297
             G   F+    D  + + +VS + E T GG     + + +   +  + E      G  +
Sbjct: 240 QLGGEVFI----DFTKTKDMVSDIQEATKGGPQGVINVSVSEAAISLSTEYVRPT-GTVV 294

Query: 298 IIGVAAAGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGQLKVDEFITHRR 357
           ++G+ A     S     ++     KGS  G    R++    +  +  G +K    I    
Sbjct: 295 LVGLPANAYVKSEVFSHVIKSINIKGSYVG---NRADTREALDFFSRGLIKSPIKIVG-- 349

Query: 358 PFTEINAAFDDLHHGDCL-RTVLDLSK 383
             +E+   +D +  G  L R V+D SK
Sbjct: 350 -LSELPMVYDLMEKGKILGRYVVDTSK 375

>CAGL0I07843g Chr9 complement(756345..757403) [1059 bp, 352 aa] {ON}
           highly similar to uniprot|P00330 Saccharomyces
           cerevisiae YOL086c ADH1 alcohol dehydrogenase I or
           uniprot|P00331 Saccharomyces cerevisiae YMR303c ADH2
          Length = 352

 Score = 95.9 bits (237), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 78/264 (29%), Positives = 116/264 (43%), Gaps = 31/264 (11%)

Query: 8   PITCLAAVAYEAGKPLTVEEIIVEPPKAHEVRIRITYTAVCHTDAYTLSGVDPEGA-FPS 66
           P T    + YE    L  ++I V  PKA+E+ I + Y+ VCHTD +   G  P     P 
Sbjct: 8   PETQKGVIFYENNGKLEYKDIPVPKPKANEILINVKYSGVCHTDLHAWHGDWPLATKLPL 67

Query: 67  ILGHEGAGVVESVGKGVTNVKPGDHV-VALYTAECQKCKFCTSGKTNLCGSVRATQGKGV 125
           + GHEGAGVV  +G+ V   K GD+  +      C  C++C     + C           
Sbjct: 68  VGGHEGAGVVVGMGENVKGWKIGDYAGIKWLNGSCMACEYCEKSNESNC----------- 116

Query: 126 MPDGTSRFRTKNGESILHFMGCSTFSQYTXXXXXXXXXXXXQAPLDRICLLGCGVTTGYG 185
            P+      T +G          +F QY                L ++  + C   T Y 
Sbjct: 117 -PEADLSGYTHDG----------SFQQYATADYVQAARIPQGTDLAQVAPILCAGITVY- 164

Query: 186 AAIKTANVQKGDTVAVFG-AGTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFGATDF 244
            A+K+AN+  G+ VA+ G AG +G   VQ AKA G  RI+ +D  D+KK    + G   F
Sbjct: 165 KALKSANLNAGEWVAISGAAGGLGSLAVQYAKAMG-YRILGIDGGDEKKALFHELGGEIF 223

Query: 245 VNPSKDLKEGETIVSKLIELTDGG 268
           V    D  + + +   ++  T+GG
Sbjct: 224 V----DFTKSKNVEQDILVATNGG 243

>TPHA0G03210 Chr7 complement(688137..689270) [1134 bp, 377 aa] {ON}
           Anc_2.480 YMR083W
          Length = 377

 Score = 95.9 bits (237), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 103/380 (27%), Positives = 159/380 (41%), Gaps = 39/380 (10%)

Query: 8   PITCLAAVAYEAGKPLTVEEIIVEPPKAHEVRIRITYTAVCHTDAYTLSGVDPEGA-FPS 66
           P T    + YE   PL  ++I V  PK++E+ I + Y+ VCHTD +   G  P     P 
Sbjct: 33  PKTQKGVIFYENNGPLEYKDIPVPKPKSNEILINVEYSGVCHTDLHAWKGDWPLPVKLPL 92

Query: 67  ILGHEGAGVVESVGKGVTNVKPGDHV-VALYTAECQKCKFCTSGKTNLCGSVRATQGKGV 125
           + GHEGAGVV  +G  V N K GD   +      C  C+ C +G    C     +   G 
Sbjct: 93  VGGHEGAGVVVGMGDNVKNWKIGDLAGIKWLNGSCMSCELCENGFEANCEHADLS---GY 149

Query: 126 MPDGTSRFRTKNGESILHFMGCSTFSQYTXXXXXXXXXXXXQAPLDRICLLGCGVTTGYG 185
             DG                   +F QY                L  +  + C   T Y 
Sbjct: 150 THDG-------------------SFQQYATADAVQAARIPAGTDLANVAPILCAGVTVY- 189

Query: 186 AAIKTANVQKGDTVAVFG-AGTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFGATDF 244
            A+KTA+++ GD VA+ G AG +G   VQ A A G  R+I +D  + KK+     G   F
Sbjct: 190 KALKTADLKPGDWVAISGAAGGLGSLAVQYAAAMGL-RVIGIDGGEDKKKLFEKCGGEVF 248

Query: 245 VNPSKDLKEGETIVSKLIELTDGGLDFTFDCTGNTKVMRDALEACHKGWGQSIIIGVAAA 304
           +    D  + + IV  + E T GG     + + + K +  +++      G  +++G+ A 
Sbjct: 249 I----DFTKSKDIVKDIQEATHGGPHGVINVSVSDKAISQSVQYIRPT-GTVVVVGMPAN 303

Query: 305 GQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGQLKVDEFITHRRPFTEINA 364
               S    Q+V     KGS  G    R++    +  +  G +K    +      +E+  
Sbjct: 304 AVVKSDVFNQVVKSIQIKGSYVG---NRADTREALDFFTRGLVKSPIKVVG---LSELPK 357

Query: 365 AFDDLHHGDCL-RTVLDLSK 383
            ++ +  G  L R V+D SK
Sbjct: 358 VYELMETGKILGRYVVDTSK 377

>KAFR0A00790 Chr1 complement(140666..141799) [1134 bp, 377 aa] {ON}
           Anc_2.480 YMR083W
          Length = 377

 Score = 95.9 bits (237), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 78/271 (28%), Positives = 118/271 (43%), Gaps = 28/271 (10%)

Query: 1   MSETVGKPITCLAAVAYEAGKPLTVEEIIVEPPKAHEVRIRITYTAVCHTDAYTLSGVDP 60
           +  T+  P      + YE G PLT +++ V  PK +E+ I + Y+ VCHTD +   G  P
Sbjct: 23  LQSTIAIPKMQKGVIFYENGGPLTYKDMPVPVPKPNEILINVKYSGVCHTDLHAWKGDWP 82

Query: 61  EGA-FPSILGHEGAGVVESVGKGVTNVKPGDHV-VALYTAECQKCKFCTSGKTNLCGSVR 118
                P + GHEGAG+V + G  V N + GD   +      C  C+ C  G  + C    
Sbjct: 83  LPVKLPLVGGHEGAGIVVAKGSNVKNFEIGDLAGIKWLNGSCMACELCEKGYESNCEHAD 142

Query: 119 ATQGKGVMPDGTSRFRTKNGESILHFMGCSTFSQYTXXXXXXXXXXXXQAPLDRICLLGC 178
            +   G   DG                   +F QY                L  +  + C
Sbjct: 143 LS---GYTHDG-------------------SFQQYATADATQAAQIPRGTDLAEVAPILC 180

Query: 179 GVTTGYGAAIKTANVQKGDTVAVFGA-GTVGLSVVQGAKARGASRIIVVDINDQKKQWAS 237
              T Y  A+KTA +Q G+ VA+ GA G +G   +Q AKA G  R++ +D  + K +   
Sbjct: 181 AGVTVY-KALKTAALQPGEWVAISGACGGLGSLAIQYAKAMGL-RVLGIDGGEAKAKMFK 238

Query: 238 DFGATDFVNPSKDLKEGETIVSKLIELTDGG 268
           + G   F++ +K  K  E ++  + E T GG
Sbjct: 239 ELGGETFIDFTK-YKNNEAMIKDIQEATKGG 268

>Smik_13.520 Chr13 complement(856008..857054) [1047 bp, 348 aa] {ON}
           YMR303C (REAL)
          Length = 348

 Score = 95.1 bits (235), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 82/302 (27%), Positives = 135/302 (44%), Gaps = 32/302 (10%)

Query: 8   PITCLAAVAYEAGKPLTVEEIIVEPPKAHEVRIRITYTAVCHTDAYTLSGVDP-EGAFPS 66
           P T    + YE+   L  ++I V  PK +E+ I + Y+ VCHTD +   G  P     P 
Sbjct: 4   PKTQKGVIFYESNGKLEHKDIPVPKPKPNELLINVKYSGVCHTDLHAWHGDWPLPTKLPL 63

Query: 67  ILGHEGAGVVESVGKGVTNVKPGDHV-VALYTAECQKCKFCTSGKTNLCGSVRATQGKGV 125
           + GHEGAGVV ++G  V   K GD   +    + C  C++C  G  + C           
Sbjct: 64  VGGHEGAGVVVAIGDNVRGWKVGDLAGIKWLNSSCMACEYCELGNESNC----------- 112

Query: 126 MPDGTSRFRTKNGESILHFMGCSTFSQYTXXXXXXXXXXXXQAPLDRICLLGCGVTTGYG 185
            P       T +G          +F QY                L ++  + C   T Y 
Sbjct: 113 -PHADLSGYTHDG----------SFQQYATADAVQAARIPEGTDLAQVAPILCAGITVY- 160

Query: 186 AAIKTANVQKGDTVAVFG-AGTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFGATDF 244
            A+K+AN++ G  VA+ G AG +G   VQ AKA G  R++ +D  + K++  +  G   F
Sbjct: 161 KALKSANLRAGHWVAISGAAGGLGSLAVQYAKAMG-YRVLGIDGGEGKEELFTSLGGEVF 219

Query: 245 VNPSKDLKEGETIVSKLIELTDGGLDFTFDCTGNTKVMRDALEACHKGWGQSIIIGVAAA 304
           ++ +K+    + IVS +++ TDGG     + + +   +  +   C    G  +++G+ A 
Sbjct: 220 IDFTKE----KDIVSAVVKATDGGAHGIVNVSVSEAAIEASTRYCRAN-GTVVLVGLPAG 274

Query: 305 GQ 306
            +
Sbjct: 275 AK 276

>YOL086C Chr15 complement(159548..160594) [1047 bp, 348 aa] {ON}
           ADH1Alcohol dehydrogenase, fermentative isozyme active
           as homo- or heterotetramers; required for the reduction
           of acetaldehyde to ethanol, the last step in the
           glycolytic pathway
          Length = 348

 Score = 95.1 bits (235), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 103/383 (26%), Positives = 164/383 (42%), Gaps = 45/383 (11%)

Query: 8   PITCLAAVAYEAGKPLTVEEIIVEPPKAHEVRIRITYTAVCHTDAYTLSGVDPEGA-FPS 66
           P T    + YE+   L  ++I V  PKA+E+ I + Y+ VCHTD +   G  P     P 
Sbjct: 4   PETQKGVIFYESHGKLEYKDIPVPKPKANELLINVKYSGVCHTDLHAWHGDWPLPVKLPL 63

Query: 67  ILGHEGAGVVESVGKGVTNVKPGDHV-VALYTAECQKCKFCTSGKTNLCGSVRATQGKGV 125
           + GHEGAGVV  +G+ V   K GD+  +      C  C++C  G  + C           
Sbjct: 64  VGGHEGAGVVVGMGENVKGWKIGDYAGIKWLNGSCMACEYCELGNESNC----------- 112

Query: 126 MPDGTSRFRTKNGESILHFMGCSTFSQYTXXXXXXXXXXXXQAPLDRICLLGCGVTTGYG 185
            P       T +G          +F QY                L ++  + C   T Y 
Sbjct: 113 -PHADLSGYTHDG----------SFQQYATADAVQAAHIPQGTDLAQVAPILCAGITVY- 160

Query: 186 AAIKTANVQKGDTVAVFG-AGTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFGATDF 244
            A+K+AN+  G  VA+ G AG +G   VQ AKA G  R++ +D  + K++     G   F
Sbjct: 161 KALKSANLMAGHWVAISGAAGGLGSLAVQYAKAMG-YRVLGIDGGEGKEELFRSIGGEVF 219

Query: 245 VNPSKDLKEGETIVSKLIELTDGGLDFTFDCTGNTKVMRDALEACH---KGWGQSIIIGV 301
           ++ +K+    + IV  +++ TDGG         N  V   A+EA     +  G ++++G+
Sbjct: 220 IDFTKE----KDIVGAVLKATDGGAHGVI----NVSVSEAAIEASTRYVRANGTTVLVGM 271

Query: 302 AAAGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGQLKVDEFITHRRPFTE 361
            A  +  S    Q+V      GS  G    R++    +  +  G +K    +       E
Sbjct: 272 PAGAKCCSDVFNQVVKSISIVGSYVG---NRADTREALDFFARGLVKSPIKVVGLSTLPE 328

Query: 362 INAAFDDLHHGDCL-RTVLDLSK 383
           I   ++ +  G  + R V+D SK
Sbjct: 329 I---YEKMEKGQIVGRYVVDTSK 348

>Skud_13.240 Chr13 (408909..410036) [1128 bp, 375 aa] {ON} YMR083W
           (REAL)
          Length = 375

 Score = 95.1 bits (235), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 101/387 (26%), Positives = 160/387 (41%), Gaps = 39/387 (10%)

Query: 1   MSETVGKPITCLAAVAYEAGKPLTVEEIIVEPPKAHEVRIRITYTAVCHTDAYTLSGVDP 60
           +  T   P T    + YE    L  ++I V  PK +E+ I + Y+ VCHTD +   G  P
Sbjct: 24  LQSTAAIPKTQKGVIFYENNGKLHYKDIPVPQPKPNEILINVKYSGVCHTDLHAWHGDWP 83

Query: 61  EGA-FPSILGHEGAGVVESVGKGVTNVKPGDHV-VALYTAECQKCKFCTSGKTNLCGSVR 118
                P + GHEGAGVV  +G  V   K GD   +      C  C+FC SG  + C    
Sbjct: 84  LAVKLPLVGGHEGAGVVVKLGSNVKGWKVGDLAGIKWLNGSCMTCEFCESGHESNC---- 139

Query: 119 ATQGKGVMPDGTSRFRTKNGESILHFMGCSTFSQYTXXXXXXXXXXXXQAPLDRICLLGC 178
                   P+      T +G          +F Q+                L  +  + C
Sbjct: 140 --------PEADLSGYTHDG----------SFQQFATADAIQAAKIQPGTDLAEVAPILC 181

Query: 179 GVTTGYGAAIKTANVQKGDTVAVFG-AGTVGLSVVQGAKARGASRIIVVDINDQKKQWAS 237
              T Y  A+K AN++ GD VA+ G AG +G   VQ A A G  R++ +D  ++K++   
Sbjct: 182 AGVTVY-KALKEANLKAGDWVAISGAAGGLGSLAVQYATAMG-YRVLGIDAGEEKEKLFK 239

Query: 238 DFGATDFVNPSKDLKEGETIVSKLIELTDGGLDFTFDCTGNTKVMRDALEACHKGWGQSI 297
             G   F+    D  + + +VS + E T GG     + + +   +  + E   +  G  +
Sbjct: 240 QLGGEVFI----DFTKTKDMVSDIQEATKGGPHGVINVSVSEAAISLSTEYV-RPTGTVV 294

Query: 298 IIGVAAAGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGQLKVDEFITHRR 357
           ++G+ A     S     +V     KGS  G    R++    +  +  G +K    I    
Sbjct: 295 LVGLPANSYVKSEVFSHVVKSINIKGSYVG---NRADTREALDFFTRGLIKSPIKIVG-- 349

Query: 358 PFTEINAAFDDLHHGDCL-RTVLDLSK 383
             +E+   +D +  G  L R V+D +K
Sbjct: 350 -LSELPKVYDLMEQGKILGRYVVDTNK 375

>KAFR0L02010 Chr12 (379623..380678) [1056 bp, 351 aa] {ON} 
          Length = 351

 Score = 94.7 bits (234), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 100/383 (26%), Positives = 163/383 (42%), Gaps = 45/383 (11%)

Query: 8   PITCLAAVAYEAGKPLTVEEIIVEPPKAHEVRIRITYTAVCHTDAYTLSG-VDPEGAFPS 66
           P T  A +  E G  L  ++I V  PK++E+ I + Y+ VCH+D +   G +      P 
Sbjct: 7   PKTQKAIIFSEVGGKLEYKDIPVPVPKSNELLINVLYSGVCHSDLHIWQGDLPLPLKLPL 66

Query: 67  ILGHEGAGVVESVGKGVTNVKPGDHV-VALYTAECQKCKFCTSGKTNLCGSVRATQGKGV 125
           + GHEGAGVV  +G  V   K GD+  +      C  C+FC       C     T   G 
Sbjct: 67  VGGHEGAGVVVGMGSNVKGWKLGDYAGIKFLNGTCNACEFCEQSFEISCPHADFT---GT 123

Query: 126 MPDGTSRFRTKNGESILHFMGCSTFSQYTXXXXXXXXXXXXQAPLDRICLLGCGVTTGYG 185
           + DG                   +F QY                L  I  L C   T Y 
Sbjct: 124 VHDG-------------------SFQQYATADAVQAARIPQGTDLAAIAPLLCAGLTAY- 163

Query: 186 AAIKTANVQKGDTVAVFGA-GTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFGATDF 244
            A+K+AN++ G  VA+ GA G +G   +Q A A G  R++ +D  ++K ++    G   F
Sbjct: 164 KALKSANMRPGQWVAISGACGGLGTYAIQYATAMG-YRVLGIDSGEEKAKYFKTLGGEVF 222

Query: 245 VNPSKDLKEGETIVSKLIELTDGGLDFTFDCTGNTKVMRDALEACHKGWGQSIIIGV--- 301
           +    D K+ + +V+ +I+ TDGG     +   + + +  + +      G S+++ +   
Sbjct: 223 I----DYKKSKDVVADVIKATDGGAHGVLNIAVDPRAISMSTKYVRSN-GTSVLVSLPKD 277

Query: 302 AAAGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGQLKVDEFITHRRPFTE 361
           A    E+ T   Q+V      GS  G    R++    +  +  G +K+     H  P + 
Sbjct: 278 AVCESEVFT---QVVKSTSIVGSCVG---NRADTREAIDFFTRGLIKIP---IHMAPLSS 328

Query: 362 INAAFDDLHHGDCL-RTVLDLSK 383
           +   +D L   + + R V+D SK
Sbjct: 329 LPQIYDKLMQNEVVGRFVVDTSK 351

>TDEL0A02560 Chr1 complement(462053..463174) [1122 bp, 373 aa] {ON}
           Anc_2.480 YMR083W
          Length = 373

 Score = 95.1 bits (235), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 102/387 (26%), Positives = 162/387 (41%), Gaps = 53/387 (13%)

Query: 8   PITCLAAVAYEAGKPLTVEEIIVEPPKAHEVRIRITYTAVCHTDAYTLSGVDPEGA-FPS 66
           P T    + YE G  L  ++I V  PK +E+ I I Y+ VCHTD +   G  P     P 
Sbjct: 29  PATQKGVIFYENGGELHYKDIAVPKPKPNEILINIKYSGVCHTDLHAWKGDWPLPVKLPL 88

Query: 67  ILGHEGAGVVESVGKGVTNVKPGDHV-VALYTAECQKCKFCTSGKTNLCGSVRATQGKGV 125
           + GHEGAGVV + GK VTN + GD   V    + C  C++C  G  + C     +   G 
Sbjct: 89  VGGHEGAGVVVAKGKDVTNFEIGDLAGVKWLNSSCMACEYCELGHESNCAKADLS---GY 145

Query: 126 MPDGTSRFRTKNGESILHFMGCSTFSQYTXXXXXXXXXXXXQAPLDRICLLGCGVTTGYG 185
             DG                   +F QY                L  +  + C   T Y 
Sbjct: 146 THDG-------------------SFQQYATADAIQAAPIPKDTDLAEVAPILCAGVTVY- 185

Query: 186 AAIKTANVQKGDTVAVFG-AGTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFGATDF 244
            A+KT+  + G  VA+ G AG +G   VQ A A G  R++ +D  + K++     G   F
Sbjct: 186 KALKTSGAKPGQWVAISGAAGGLGSLAVQYATAMGL-RVLGIDGGEGKEELFKSLGGEVF 244

Query: 245 VNPSKDLKEGETIVSKLIELTDGGLDFTFDCTGNTKVMRDALEACHKGWGQSIIIGVAAA 304
           V    D  + + +VS + E T+GG     + + +   ++ + E   +  G  +++G+ A 
Sbjct: 245 V----DFTKTKDMVSAIQEATNGGPHAVVNVSVSEAAIQQSTEYV-RPTGTVVLVGLPAH 299

Query: 305 GQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGQLKVDEFITH--RRP---- 358
              + +  F  V            +K  S  G  V +  D +  +D F  +  + P    
Sbjct: 300 AY-VKSEIFSHV------------VKSISIKGSYVGNRADTREAIDFFSRNLVKSPIKII 346

Query: 359 -FTEINAAFDDLHHGDCL-RTVLDLSK 383
             +E+   ++ +  G  L R V+D S+
Sbjct: 347 GLSELPKVYELMEEGKILGRYVVDTSR 373

>KLLA0F13530g Chr6 (1251162..1252289) [1128 bp, 375 aa] {ON}
           uniprot|P49385 Kluyveromyces lactis ADH4 Alcohol
           dehydrogenase IV, mitochondrial precursor
          Length = 375

 Score = 95.1 bits (235), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 78/271 (28%), Positives = 121/271 (44%), Gaps = 31/271 (11%)

Query: 1   MSETVGKPITCLAAVAYEAGKPLTVEEIIVEPPKAHEVRIRITYTAVCHTDAYTLSGVDP 60
           ++ +   P T    + YE G  L  +++ V  PKA+E+ I + Y+ VCHTD +   G  P
Sbjct: 24  LNSSFAIPETQKGVIFYENGGKLEYKDLPVPKPKANEILINVKYSGVCHTDLHAWKGDWP 83

Query: 61  EGA-FPSILGHEGAGVVESVGKGVTNVKPGDHV-VALYTAECQKCKFCTSGKTNLCGSVR 118
                P + GHEGAG+V + G+ V N + GD+  +      C  C+ C  G  + C    
Sbjct: 84  LPVKLPLVGGHEGAGIVVAKGENVKNFEIGDYAGIKWLNGSCMSCELCEQGYESNCLQAD 143

Query: 119 ATQGKGVMPDGTSRFRTKNGESILHFMGCSTFSQYTXXXXXXXXXXXXQAPLDRICLLGC 178
            +   G   DG                   +F QY                L  I  + C
Sbjct: 144 LS---GYTHDG-------------------SFQQYATADAVQAAQIPKGTDLAEIAPILC 181

Query: 179 GVTTGYGAAIKTANVQKGDTVAVFG-AGTVGLSVVQGAKARGASRIIVVDINDQKKQWAS 237
              T Y  A+KTA+++ G  VA+ G AG +G   VQ AKA G  R++ +D  D K++   
Sbjct: 182 AGVTVY-KALKTADLKPGQWVAISGAAGGLGSLAVQYAKAMGL-RVLGIDGGDGKEELFK 239

Query: 238 DFGATDFVNPSKDLKEGETIVSKLIELTDGG 268
             G   F+    D ++ + +V+ + E T+GG
Sbjct: 240 QCGGEVFI----DFRKSKDMVADIQEATNGG 266

>SAKL0B08184g Chr2 (698686..699807) [1122 bp, 373 aa] {ON}
           uniprot|Q9P8S5 Saccharomyces kluyveri Alcohol
           dehydrogenase isozyme 3
          Length = 373

 Score = 94.7 bits (234), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 99/374 (26%), Positives = 158/374 (42%), Gaps = 41/374 (10%)

Query: 15  VAYEAGKPLTVEEIIVEPPKAHEVRIRITYTAVCHTDAYTLSGVDP-EGAFPSILGHEGA 73
           + YE G  L  E+I V  PK +E+ I + Y+ VCHTD +   G  P     P + GHEGA
Sbjct: 36  IFYENGGELKYEDIPVPKPKPNELLINVKYSGVCHTDLHAWKGDWPLPTKLPLVGGHEGA 95

Query: 74  GVVESVGKGVTNVKPGDHV-VALYTAECQKCKFCTSGKTNLCGSVRATQGKGVMPDGTSR 132
           GVV ++G+ V   K GD   +      C  C++C     + C            P     
Sbjct: 96  GVVVAMGENVKGWKIGDLAGIKWLNGSCLSCEYCEKSNESNC------------PHADLS 143

Query: 133 FRTKNGESILHFMGCSTFSQYTXXXXXXXXXXXXQAPLDRICLLGCGVTTGYGAAIKTAN 192
             T +G          +F QY                L  +  + C   T Y  A+K+AN
Sbjct: 144 GYTHDG----------SFQQYATADYVQAARIPEGTDLAEVSPILCAGVTVY-KALKSAN 192

Query: 193 VQKGDTVAVFG-AGTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFGATDFVNPSKDL 251
           ++ GD VA+ G AG +G   VQ AKA G  R++ +D   +K +     G   F+    D 
Sbjct: 193 LKAGDWVAISGAAGGLGSLAVQYAKAMG-YRVLGIDGGAEKGELVKKLGGEVFI----DF 247

Query: 252 KEGETIVSKLIELTDGGLDFTFDCTGNTKVMRDALEACHKGWGQSIIIGVAAAGQEISTR 311
            + + +V  + E T+GG     + + +   M  + +      G  +++G+  AG  I + 
Sbjct: 248 TKHKNLVEAVQEATNGGPHGVINVSVSEAAMTASTQFVRPT-GTVVLVGL-PAGAVIKSE 305

Query: 312 PFQLVTGRV-WKGSAFGGIKGRSEMGGLVSDYMDGQLKVDEFITHRRPFTEINAAFDDLH 370
            F  V   +  KGS  G    R++    +  +  G +K      H    +E+   ++ + 
Sbjct: 306 VFSHVVKSINIKGSYVG---NRADTREAIDFFARGMVKSP---IHVVGLSELPKVYELME 359

Query: 371 HGDCL-RTVLDLSK 383
            G  L R V+D +K
Sbjct: 360 KGKILGRYVVDTAK 373

>YMR083W Chr13 (434788..435915) [1128 bp, 375 aa] {ON}
           ADH3Mitochondrial alcohol dehydrogenase isozyme III;
           involved in the shuttling of mitochondrial NADH to the
           cytosol under anaerobic conditions and ethanol
           production
          Length = 375

 Score = 94.7 bits (234), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 102/387 (26%), Positives = 160/387 (41%), Gaps = 39/387 (10%)

Query: 1   MSETVGKPITCLAAVAYEAGKPLTVEEIIVEPPKAHEVRIRITYTAVCHTDAYTLSGVDP 60
           +  T   P T    + YE    L  ++I V  PK +E+ I + Y+ VCHTD +   G  P
Sbjct: 24  LQSTAAIPKTQKGVIFYENKGKLHYKDIPVPEPKPNEILINVKYSGVCHTDLHAWHGDWP 83

Query: 61  EGA-FPSILGHEGAGVVESVGKGVTNVKPGDHV-VALYTAECQKCKFCTSGKTNLCGSVR 118
                P + GHEGAGVV  +G  V   K GD   +      C  C+FC SG  + C    
Sbjct: 84  LPVKLPLVGGHEGAGVVVKLGSNVKGWKVGDLAGIKWLNGSCMTCEFCESGHESNC---- 139

Query: 119 ATQGKGVMPDGTSRFRTKNGESILHFMGCSTFSQYTXXXXXXXXXXXXQAPLDRICLLGC 178
                   PD      T +G          +F Q+                L  +  + C
Sbjct: 140 --------PDADLSGYTHDG----------SFQQFATADAIQAAKIQQGTDLAEVAPILC 181

Query: 179 GVTTGYGAAIKTANVQKGDTVAVFG-AGTVGLSVVQGAKARGASRIIVVDINDQKKQWAS 237
              T Y  A+K A+++ GD VA+ G AG +G   VQ A A G  R++ +D  ++K++   
Sbjct: 182 AGVTVY-KALKEADLKAGDWVAISGAAGGLGSLAVQYATAMG-YRVLGIDAGEEKEKLFK 239

Query: 238 DFGATDFVNPSKDLKEGETIVSKLIELTDGGLDFTFDCTGNTKVMRDALEACHKGWGQSI 297
             G   F+    D  + + +VS + E T GG     + + +   +  + E   +  G  +
Sbjct: 240 KLGGEVFI----DFTKTKNMVSDIQEATKGGPHGVINVSVSEAAISLSTEYV-RPCGTVV 294

Query: 298 IIGVAAAGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGQLKVDEFITHRR 357
           ++G+ A     S     +V     KGS  G    R++    +  +  G +K    I    
Sbjct: 295 LVGLPANAYVKSEVFSHVVKSINIKGSYVG---NRADTREALDFFSRGLIKSPIKIVG-- 349

Query: 358 PFTEINAAFDDLHHGDCL-RTVLDLSK 383
             +E+   +D +  G  L R V+D SK
Sbjct: 350 -LSELPKVYDLMEKGKILGRYVVDTSK 375

>KLTH0E05588g Chr5 complement(494815..495861) [1047 bp, 348 aa] {ON}
           highly similar to uniprot|P00330 Saccharomyces
           cerevisiae YOL086C ADH1 Alcohol dehydrogenase involved
           in the production of certain carboxylate esters
          Length = 348

 Score = 94.4 bits (233), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 80/264 (30%), Positives = 117/264 (44%), Gaps = 31/264 (11%)

Query: 8   PITCLAAVAYEAGKPLTVEEIIVEPPKAHEVRIRITYTAVCHTDAYTLSGVDPEGA-FPS 66
           P T  A V    G  L  ++I V  P A+E+ I + Y+ VCHTD +   G  P     P 
Sbjct: 4   PKTQKAVVFETNGGELEYKDIPVPKPAANEILINVKYSGVCHTDLHAWKGDWPLATKLPL 63

Query: 67  ILGHEGAGVVESVGKGVTNVKPGDHV-VALYTAECQKCKFCTSGKTNLCGSVRATQGKGV 125
           + GHEGAGVV  +G+ V   K GD   +      C  C+ C     + C           
Sbjct: 64  VGGHEGAGVVVGIGENVKGWKLGDLAGIKWLNGSCMACESCELSNESNC----------- 112

Query: 126 MPDGTSRFRTKNGESILHFMGCSTFSQYTXXXXXXXXXXXXQAPLDRICLLGCGVTTGYG 185
            P       T +G          +F QY                L  +  + C   T Y 
Sbjct: 113 -PHADLSGYTHDG----------SFQQYATADAVQAARIPEGTDLAEVAPILCAGITVY- 160

Query: 186 AAIKTANVQKGDTVAVFG-AGTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFGATDF 244
            A+K+AN++ G+ VA+ G AG +G   VQ AKA G  R+I +D  D+K+Q     G   F
Sbjct: 161 KALKSANLRAGNWVAISGAAGGLGSLAVQYAKAMG-YRVIGIDGGDEKEQLFKKLGGEYF 219

Query: 245 VNPSKDLKEGETIVSKLIELTDGG 268
           V    D ++ + +V++++E+T GG
Sbjct: 220 V----DFRKSKDVVAEILEVTGGG 239

>Skud_13.477 Chr13 complement(846790..847836) [1047 bp, 348 aa] {ON}
           YMR303C (REAL)
          Length = 348

 Score = 94.0 bits (232), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 92/348 (26%), Positives = 150/348 (43%), Gaps = 45/348 (12%)

Query: 8   PITCLAAVAYEAGKPLTVEEIIVEPPKAHEVRIRITYTAVCHTDAYTLSGVDP-EGAFPS 66
           P T    + YE+   L  + I V  PK +E+ I + Y+ VCHTD +   G  P     P 
Sbjct: 4   PETQKGVIFYESNGKLEHKNIPVPKPKPNELLINVKYSGVCHTDLHAWHGDWPLPTKLPL 63

Query: 67  ILGHEGAGVVESVGKGVTNVKPGDHV-VALYTAECQKCKFCTSGKTNLCGSVRATQGKGV 125
           + GHEGAGVV ++G  V   K GD   V    + C  C++C  G  + C           
Sbjct: 64  VGGHEGAGVVVAIGDNVRGWKVGDLAGVKWLNSSCMACEYCELGNESNC----------- 112

Query: 126 MPDGTSRFRTKNGESILHFMGCSTFSQYTXXXXXXXXXXXXQAPLDRICLLGCGVTTGYG 185
            P       T +G          +F QY                L  +  + C   T Y 
Sbjct: 113 -PHADLSGYTHDG----------SFQQYATADAVQAARIPEGTDLAEVAPILCAGITVY- 160

Query: 186 AAIKTANVQKGDTVAVFG-AGTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFGATDF 244
            A+K+AN++ G+ VA+ G AG +G   VQ AKA G  R++ +D    K++  +  G   F
Sbjct: 161 KALKSANLRAGNWVAISGAAGGLGSLAVQYAKAMG-YRVLGIDGGPGKQELFTSLGGEVF 219

Query: 245 VNPSKDLKEGETIVSKLIELTDGGLDFTFDCTGNTKVMRDALEACHKGWGQSIIIGVAAA 304
           ++ +K+    + I+  +++ TDGG     + + +   +  + + C    G  +++G+  A
Sbjct: 220 IDFTKE----KDIIGAVVKATDGGAHGIINVSVSEAAIEASTKYCRAN-GTVVLVGL-PA 273

Query: 305 GQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGQLKVDEF 352
           G + S+  F  V            +K  S +G  V +  D +  +D F
Sbjct: 274 GAKCSSDVFNHV------------VKSISIVGSYVGNRADTREALDFF 309

>KLLA0F18260g Chr6 complement(1683417..1684463) [1047 bp, 348 aa]
           {ON} uniprot|P49383 Kluyveromyces lactis KLLA0F18260g
           ADH2 Alcohol dehydrogenase 2
          Length = 348

 Score = 93.6 bits (231), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 78/266 (29%), Positives = 119/266 (44%), Gaps = 35/266 (13%)

Query: 8   PITCLAAVAYEAGKPLTVEEIIVEPPKAHEVRIRITYTAVCHTDAYTLSGVDP-EGAFPS 66
           P T    + YE G  L  ++I V  PKA+E+ I + Y+ VCHTD +   G  P     P 
Sbjct: 4   PETQKGVIFYENGGELQYKDIPVPKPKANELLINVKYSGVCHTDLHAWKGDWPLPTKLPL 63

Query: 67  ILGHEGAGVVESVGKGVTNVKPGDHV-VALYTAECQKCKFCTSGKTNLCGSVRATQGKGV 125
           + GHEGAGVV ++G+ V     GD   +      C  C++C     + C           
Sbjct: 64  VGGHEGAGVVVAMGENVKGWNIGDFAGIKWLNGSCMSCEYCELSNESNC----------- 112

Query: 126 MPDGTSRFRTKNGESILHFMGCSTFSQYTXXXXXXXXXXXXQAPLDRICLLGCGVTTGYG 185
            PD      T +G          +F QY                L  +  + C   T Y 
Sbjct: 113 -PDADLSGYTHDG----------SFQQYATADAVQAARIPKGTDLAEVAPILCAGVTVY- 160

Query: 186 AAIKTANVQKGDTVAVFGA-GTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFGATDF 244
            A+K+A+++ GD VA+ GA G +G   +Q AKA G  R++ +D   +K +   + G   F
Sbjct: 161 KALKSADLKAGDWVAISGACGGLGSLAIQYAKAMG-YRVLGIDTGAEKAKLFKELGGEYF 219

Query: 245 VN--PSKDLKEGETIVSKLIELTDGG 268
           V+   SKDL      + ++++ T+GG
Sbjct: 220 VDYAVSKDL------IKEIVDATNGG 239

>Smik_13.266 Chr13 (418869..419996) [1128 bp, 375 aa] {ON} YMR083W
           (REAL)
          Length = 375

 Score = 94.0 bits (232), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 102/387 (26%), Positives = 159/387 (41%), Gaps = 39/387 (10%)

Query: 1   MSETVGKPITCLAAVAYEAGKPLTVEEIIVEPPKAHEVRIRITYTAVCHTDAYTLSGVDP 60
           +  T   P T    + YE    L  ++I V  PK +E+ I + Y+ VCHTD +   G  P
Sbjct: 24  LQSTAAIPETQKGVIFYENKGKLHYKDIPVPEPKPNEILINVKYSGVCHTDLHAWHGDWP 83

Query: 61  EGA-FPSILGHEGAGVVESVGKGVTNVKPGDHV-VALYTAECQKCKFCTSGKTNLCGSVR 118
                P + GHEGAGVV  +G  V   K GD   +      C  C+FC SG  + C    
Sbjct: 84  LPVKLPLVGGHEGAGVVVKLGSNVKGWKIGDLAGIKWLNGSCMTCEFCESGHESNC---- 139

Query: 119 ATQGKGVMPDGTSRFRTKNGESILHFMGCSTFSQYTXXXXXXXXXXXXQAPLDRICLLGC 178
                   PD      T +G          +F Q+                L  +  + C
Sbjct: 140 --------PDADLSGYTHDG----------SFQQFATADAIQAAKIQQGTDLAEVAPILC 181

Query: 179 GVTTGYGAAIKTANVQKGDTVAVFG-AGTVGLSVVQGAKARGASRIIVVDINDQKKQWAS 237
              T Y  A+K A+++ GD VA+ G AG +G   VQ A A G  R++ +D  ++K++   
Sbjct: 182 AGVTVY-KALKEADLKAGDWVAISGAAGGLGSLAVQYATAMG-YRVLGIDAGEEKEKLFK 239

Query: 238 DFGATDFVNPSKDLKEGETIVSKLIELTDGGLDFTFDCTGNTKVMRDALEACHKGWGQSI 297
             G   F+    D  + + +VS + E T GG     + + +   +  + E      G  +
Sbjct: 240 KLGGEVFI----DFTKTKDMVSDIQEATKGGPHGVINVSVSEAAISLSTEYVRPT-GTVV 294

Query: 298 IIGVAAAGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGQLKVDEFITHRR 357
           ++G+ A     S     +V     KGS  G    R++    +  +  G +K    I    
Sbjct: 295 LVGLPANAYVKSEVFSHVVKSINIKGSYVG---NRADTREALDFFSRGLIKSPIKIVG-- 349

Query: 358 PFTEINAAFDDLHHGDCL-RTVLDLSK 383
             +E+   +D +  G  L R V+D SK
Sbjct: 350 -LSELPKVYDLMEKGKILGRYVVDTSK 375

>Smik_15.71 Chr15 complement(122645..123691) [1047 bp, 348 aa] {ON}
           YOL086C (REAL)
          Length = 348

 Score = 93.6 bits (231), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 85/302 (28%), Positives = 134/302 (44%), Gaps = 38/302 (12%)

Query: 8   PITCLAAVAYEAGKPLTVEEIIVEPPKAHEVRIRITYTAVCHTDAYTLSGVDP-EGAFPS 66
           P T    + YE+   L  ++I V  PKA+E+ I + Y+ VCHTD +   G  P     P 
Sbjct: 4   PETQKGVIFYESHGKLEYKDIPVPKPKANELLINVKYSGVCHTDLHAWHGDWPLPTKLPL 63

Query: 67  ILGHEGAGVVESVGKGVTNVKPGDHV-VALYTAECQKCKFCTSGKTNLCGSVRATQGKGV 125
           + GHEGAGVV ++G+ V     GD+  +      C  C++C  G  + C           
Sbjct: 64  VGGHEGAGVVVAMGENVKGWNIGDYAGIKWLNGSCMACEYCELGNESNC----------- 112

Query: 126 MPDGTSRFRTKNGESILHFMGCSTFSQYTXXXXXXXXXXXXQAPLDRICLLGCGVTTGYG 185
            P       T +G          +F QY                L  +  + C   T Y 
Sbjct: 113 -PHADLSGYTHDG----------SFQQYATADAVQAAHIPQGTDLAEVAPVLCAGITVY- 160

Query: 186 AAIKTANVQKGDTVAVFG-AGTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFGATDF 244
            A+K+AN+  G  VA+ G AG +G   VQ AKA G  R++ +D  + K++     G   F
Sbjct: 161 KALKSANLMAGHWVAISGAAGGLGSLAVQYAKAMG-YRVLGIDGGEGKEELFRSIGGEVF 219

Query: 245 VNPSKDLKEGETIVSKLIELTDGGLDFTFDCTGNTKVMRDALEACH---KGWGQSIIIGV 301
           ++ +K+    + IV+ +++ TDGG         N  V   A+EA     +  G ++++G+
Sbjct: 220 IDFTKE----KDIVNAVLKATDGGAHGVI----NVSVSEAAIEASTRYVRANGTTVLVGM 271

Query: 302 AA 303
            A
Sbjct: 272 PA 273

>YBR145W Chr2 (533762..534817) [1056 bp, 351 aa] {ON}  ADH5Alcohol
           dehydrogenase isoenzyme V; involved in ethanol
           production
          Length = 351

 Score = 93.6 bits (231), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 97/375 (25%), Positives = 154/375 (41%), Gaps = 39/375 (10%)

Query: 13  AAVAYEAGKPLTVEEIIVEPPKAHEVRIRITYTAVCHTDAYTLSGVDP-EGAFPSILGHE 71
           A V YE    L  +++ V  PK +E+ + + Y+ VCH+D +   G  P +  FP I GHE
Sbjct: 12  AIVFYETDGKLEYKDVTVPEPKPNEILVHVKYSGVCHSDLHAWHGDWPFQLKFPLIGGHE 71

Query: 72  GAGVVESVGKGVTNVKPGDHV-VALYTAECQKCKFCTSGKTNLCGSVRATQGKGVMPDGT 130
           GAGVV  +G  V   K GD   +      C  C++C  G  + C  +    G G   DG 
Sbjct: 72  GAGVVVKLGSNVKGWKVGDFAGIKWLNGTCMSCEYCEVGNESQCPYL---DGTGFTHDG- 127

Query: 131 SRFRTKNGESILHFMGCSTFSQYTXXXXXXXXXXXXQAPLDRICLLGCGVTTGYGAAIKT 190
                             TF +Y                L  +  + C   T Y  A+K 
Sbjct: 128 ------------------TFQEYATADAVQAAHIPPNVNLAEVAPILCAGITVY-KALKR 168

Query: 191 ANVQKGDTVAVFGA-GTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFGATDFVNPSK 249
           ANV  G  V + GA G +G   +Q A A G  R+I +D  + K++     G   F+    
Sbjct: 169 ANVIPGQWVTISGACGGLGSLAIQYALAMG-YRVIGIDGGNAKRKLFEQLGGEIFI---- 223

Query: 250 DLKEGETIVSKLIELTDGGLDFTFDCTGNTKVMRDALEACHKGWGQSIIIGVAAAGQEIS 309
           D  E + IV  +I+ T+GG     + + +   +  +   C    G  +++G+ A     S
Sbjct: 224 DFTEEKDIVGAIIKATNGGSHGVINVSVSEAAIEASTRYCRPN-GTVVLVGMPAHAYCNS 282

Query: 310 TRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGQLKVDEFITHRRPFTEINAAFDDL 369
               Q+V      GS  G    R++    +  +  G +K      H    +++   F  +
Sbjct: 283 DVFNQVVKSISIVGSCVG---NRADTREALDFFARGLIKSP---IHLAGLSDVPEIFAKM 336

Query: 370 HHGDCL-RTVLDLSK 383
             G+ + R V++ SK
Sbjct: 337 EKGEIVGRYVVETSK 351

>ZYRO0B05940g Chr2 (480279..481418) [1140 bp, 379 aa] {ON} highly
           similar to uniprot|P00330 Saccharomyces cerevisiae
           YOL086C ADH1 Alcohol dehydrogenase involved in the
           production of certain carboxylate esters
          Length = 379

 Score = 94.0 bits (232), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 105/391 (26%), Positives = 157/391 (40%), Gaps = 61/391 (15%)

Query: 8   PITCLAAVAYEAGKPLTVEEIIVEPPKAHEVRIRITYTAVCHTDAYTLSGVDP-EGAFPS 66
           P T    V  E+  PL  +EI V  PK +E+ I + Y+ VCHTD +   G  P     P 
Sbjct: 35  PKTQKGVVFNESNGPLEYKEIPVPTPKPNEILIHVRYSGVCHTDLHAWKGDWPLPTKLPL 94

Query: 67  ILGHEGAGVVESVGKGVTNVKPGDHV-VALYTAECQKCKFCTSGKTNLCGSVRATQGKGV 125
           + GHEGAG V ++G  V N K GD   +      C  C+ C     + C           
Sbjct: 95  VGGHEGAGEVIALGSNVKNWKVGDLAGIKWLNGSCMSCESCEQSNESNC----------- 143

Query: 126 MPDGTSRFRTKNGESILHFMGCSTFSQYTXXXXXXXXXXXXQAPLDRICLLGCGVTTGYG 185
            PD      T +G          +F QY                L  +  + C   T Y 
Sbjct: 144 -PDADLSGYTHDG----------SFQQYATADAVQAAHIPPGTDLAEVAPVLCAGITVY- 191

Query: 186 AAIKTANVQKGDTVAVFG-AGTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFGATDF 244
            A+K+AN++ G  VA+ G AG +G   VQ AKA G  R++ +D    K++     G   F
Sbjct: 192 KALKSANLKAGQWVAISGAAGGLGSLAVQFAKAMGL-RVVGIDGGPGKEELFKTLGGEVF 250

Query: 245 VNPSKDLKEGETIVSKLIELTDGGLDFTFDCTGNTKVMRDALEACHK---GWGQSIIIGV 301
           +    D ++   IV  ++  T+GG         N  V   A+ A  K     G S+++G+
Sbjct: 251 I----DFQKESDIVGAVVNATNGGAHGVV----NVSVSEGAISASTKYVRACGTSVLVGM 302

Query: 302 AAAGQEISTRPFQLVTGRVWKGSAFGG-IKGRSEMGGLVSDYMDGQLKVDEF---ITHRR 357
            A              G V K   F   ++    +G  V +  D +  +D F   + H  
Sbjct: 303 PA--------------GAVCKSEVFDQVVRSTKIVGSYVGNRADTREALDFFARGLVHAP 348

Query: 358 ----PFTEINAAFDDLHHGDCL-RTVLDLSK 383
               P + +   F+ +  G  + R V+D SK
Sbjct: 349 INVVPLSTLPEIFEKMEKGQIIGRYVVDTSK 379

>Suva_13.494 Chr13 complement(856051..857097) [1047 bp, 348 aa] {ON}
           YMR303C (REAL)
          Length = 348

 Score = 93.2 bits (230), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 92/348 (26%), Positives = 150/348 (43%), Gaps = 45/348 (12%)

Query: 8   PITCLAAVAYEAGKPLTVEEIIVEPPKAHEVRIRITYTAVCHTDAYTLSGVDPEGA-FPS 66
           P T    + YE+   L  ++I V  PK +E+ I + Y+ VCHTD +   G  P     P 
Sbjct: 4   PKTQKGVIFYESNGKLEHKDIPVPTPKPNELLINVKYSGVCHTDLHAWHGDWPLATKLPL 63

Query: 67  ILGHEGAGVVESVGKGVTNVKPGDHV-VALYTAECQKCKFCTSGKTNLCGSVRATQGKGV 125
           + GHEGAGVV ++G+ V   K GD   +    + C  C++C  G  + C           
Sbjct: 64  VGGHEGAGVVVAMGENVRGWKVGDLAGIKWLNSSCMACEYCELGNESNC----------- 112

Query: 126 MPDGTSRFRTKNGESILHFMGCSTFSQYTXXXXXXXXXXXXQAPLDRICLLGCGVTTGYG 185
            P       T +G          +F QY                L  +  + C   T Y 
Sbjct: 113 -PHADLSGYTHDG----------SFQQYATADAVQAAHIPEGTDLAEVAPILCAGITVY- 160

Query: 186 AAIKTANVQKGDTVAVFG-AGTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFGATDF 244
            A+K+AN++ G  VA+ G AG +G   VQ AKA G  R++ +D    K++  +  G   F
Sbjct: 161 KALKSANLRAGHWVAISGAAGGLGSLAVQYAKAMG-YRVVGIDGGPGKEELFTSLGGEVF 219

Query: 245 VNPSKDLKEGETIVSKLIELTDGGLDFTFDCTGNTKVMRDALEACHKGWGQSIIIGVAAA 304
           ++ +K+    + IV  +I+ TDGG     + + +   +  +   C    G  +++G+  A
Sbjct: 220 IDFTKE----KDIVGAVIKATDGGAHGIVNVSVSEAAIEASTRYCRAN-GTVVLVGL-PA 273

Query: 305 GQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGQLKVDEF 352
           G + ++  F  V            +K  S +G  V +  D +  +D F
Sbjct: 274 GAKCTSDVFNHV------------VKSISIVGSYVGNRADTREALDFF 309

>NDAI0H02160 Chr8 (528551..529696) [1146 bp, 381 aa] {ON} Anc_2.480
          Length = 381

 Score = 93.2 bits (230), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 102/380 (26%), Positives = 156/380 (41%), Gaps = 39/380 (10%)

Query: 8   PITCLAAVAYEAGKPLTVEEIIVEPPKAHEVRIRITYTAVCHTDAYTLSGVDP-EGAFPS 66
           P T  A V YE G PL  ++I V  PKA+E+ I + Y+ VCHTD +   G  P     P 
Sbjct: 37  PKTQKAVVFYENGGPLHYKDIPVPKPKANEILINVKYSGVCHTDLHAWKGDWPLPTKLPL 96

Query: 67  ILGHEGAGVVESVGKGVTNVKPGDHV-VALYTAECQKCKFCTSGKTNLCGSVRATQGKGV 125
           + GHEG+GVV  VG+ V   K GD   +      C  C+ C +G  + C     +   G 
Sbjct: 97  VGGHEGSGVVMQVGENVKGWKVGDLAGIKWLNGSCMACELCETGNESNCEHADLS---GY 153

Query: 126 MPDGTSRFRTKNGESILHFMGCSTFSQYTXXXXXXXXXXXXQAPLDRICLLGCGVTTGYG 185
             DG                   +F QY                L  +  + C   T Y 
Sbjct: 154 THDG-------------------SFQQYATADAVQAARIPEGTNLAEVAPILCAGITVY- 193

Query: 186 AAIKTANVQKGDTVAVFG-AGTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFGATDF 244
            A+K A+++ G  V + G AG +G   VQ AKA G  R+I +D    K++     G   F
Sbjct: 194 KALKEADLKAGQWVCISGAAGGLGSLAVQYAKAMG-YRVIGIDGGKAKEELFKSMGGEVF 252

Query: 245 VNPSKDLKEGETIVSKLIELTDGGLDFTFDCTGNTKVMRDALEACHKGWGQSIIIGVAAA 304
           +    D  + + +V  + E T GG     + + +   +  + +      G  +++G+ A 
Sbjct: 253 I----DFTKSKDMVKDIQEATKGGPQGVINVSVSEAAISLSTQYVRPT-GTVVLVGLPAH 307

Query: 305 GQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGQLKVDEFITHRRPFTEINA 364
               S     +V     KGS  G    R++    +  +  G +K    I      +E+  
Sbjct: 308 AYVKSEVFSHVVKSINIKGSYVG---NRADTREALDFFARGLIKSPIKIVG---LSELPK 361

Query: 365 AFDDLHHGDCL-RTVLDLSK 383
            +D +  G  L R V+D SK
Sbjct: 362 VYDLMEKGQILGRYVVDTSK 381

>YMR303C Chr13 complement(873291..874337) [1047 bp, 348 aa] {ON}
           ADH2Glucose-repressible alcohol dehydrogenase II,
           catalyzes the conversion of ethanol to acetaldehyde;
           involved in the production of certain carboxylate
           esters; regulated by ADR1
          Length = 348

 Score = 92.8 bits (229), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 91/348 (26%), Positives = 150/348 (43%), Gaps = 45/348 (12%)

Query: 8   PITCLAAVAYEAGKPLTVEEIIVEPPKAHEVRIRITYTAVCHTDAYTLSGVDP-EGAFPS 66
           P T  A + YE+   L  ++I V  PK +E+ I + Y+ VCHTD +   G  P     P 
Sbjct: 4   PETQKAIIFYESNGKLEHKDIPVPKPKPNELLINVKYSGVCHTDLHAWHGDWPLPTKLPL 63

Query: 67  ILGHEGAGVVESVGKGVTNVKPGDHV-VALYTAECQKCKFCTSGKTNLCGSVRATQGKGV 125
           + GHEGAGVV  +G+ V   K GD+  +      C  C++C  G  + C           
Sbjct: 64  VGGHEGAGVVVGMGENVKGWKIGDYAGIKWLNGSCMACEYCELGNESNC----------- 112

Query: 126 MPDGTSRFRTKNGESILHFMGCSTFSQYTXXXXXXXXXXXXQAPLDRICLLGCGVTTGYG 185
            P       T +G          +F +Y                L  +  + C   T Y 
Sbjct: 113 -PHADLSGYTHDG----------SFQEYATADAVQAAHIPQGTDLAEVAPILCAGITVY- 160

Query: 186 AAIKTANVQKGDTVAVFG-AGTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFGATDF 244
            A+K+AN++ G   A+ G AG +G   VQ AKA G  R++ +D    K++  +  G   F
Sbjct: 161 KALKSANLRAGHWAAISGAAGGLGSLAVQYAKAMG-YRVLGIDGGPGKEELFTSLGGEVF 219

Query: 245 VNPSKDLKEGETIVSKLIELTDGGLDFTFDCTGNTKVMRDALEACHKGWGQSIIIGVAAA 304
           ++ +K+    + IVS +++ T+GG     + + +   +  +   C    G  +++G+  A
Sbjct: 220 IDFTKE----KDIVSAVVKATNGGAHGIINVSVSEAAIEASTRYCRAN-GTVVLVGL-PA 273

Query: 305 GQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGQLKVDEF 352
           G + S+  F  V            +K  S +G  V +  D +  +D F
Sbjct: 274 GAKCSSDVFNHV------------VKSISIVGSYVGNRADTREALDFF 309

>Skud_2.272 Chr2 (501260..502315) [1056 bp, 351 aa] {ON} YBR145W
           (REAL)
          Length = 351

 Score = 92.4 bits (228), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 98/380 (25%), Positives = 157/380 (41%), Gaps = 39/380 (10%)

Query: 8   PITCLAAVAYEAGKPLTVEEIIVEPPKAHEVRIRITYTAVCHTDAYTLSGVDP-EGAFPS 66
           P T  A V YE    L  +++ V  PK +E+ + + Y+ VCH+D +   G  P +  FP 
Sbjct: 7   PKTQKAIVFYETDGKLEYKDVAVPEPKPNEILVHVKYSGVCHSDLHAWHGDWPFQLKFPL 66

Query: 67  ILGHEGAGVVESVGKGVTNVKPGDHV-VALYTAECQKCKFCTSGKTNLCGSVRATQGKGV 125
           I GHEGAGVV  +G  V   K GD   +      C  C++C  G  + C  +    G G 
Sbjct: 67  IGGHEGAGVVVKLGSNVKGWKVGDIAGIKWLNGTCMSCEYCEVGNESQCPHL---DGTGF 123

Query: 126 MPDGTSRFRTKNGESILHFMGCSTFSQYTXXXXXXXXXXXXQAPLDRICLLGCGVTTGYG 185
             DG                   TF +Y                L  +  + C   T Y 
Sbjct: 124 THDG-------------------TFQEYATADAVQAAHIPQNVDLAEVAPILCAGITVY- 163

Query: 186 AAIKTANVQKGDTVAVFGA-GTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFGATDF 244
            A+K AN+  G  V + GA G +G   VQ A A G  R+I +D  + K++   +     F
Sbjct: 164 KALKRANLMPGQWVTISGACGGLGSLAVQYALAMG-YRVIGIDGGEAKQKLFEELHGEIF 222

Query: 245 VNPSKDLKEGETIVSKLIELTDGGLDFTFDCTGNTKVMRDALEACHKGWGQSIIIGVAAA 304
           ++ +K+    + +V  +I+ TDGG     + + +   +  +   C    G  +++G+ A 
Sbjct: 223 IDFTKE----KDVVGAVIKATDGGSHGVINVSVSEAAIEASTRYCRPN-GTVVLVGMPAH 277

Query: 305 GQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGQLKVDEFITHRRPFTEINA 364
               S    Q+V      GS  G    R++    +  +  G +K      H    +++  
Sbjct: 278 AYCKSDVFNQVVKSISIVGSCVG---NRADTREALDFFARGLIKSP---IHLAGLSDVPE 331

Query: 365 AFDDLHHGDCL-RTVLDLSK 383
            F  +  G  + R V+D SK
Sbjct: 332 IFGKMERGQIVGRYVVDTSK 351

>TBLA0E03430 Chr5 (850493..851548) [1056 bp, 351 aa] {ON} 
          Length = 351

 Score = 92.4 bits (228), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 103/383 (26%), Positives = 164/383 (42%), Gaps = 45/383 (11%)

Query: 8   PITCLAAVAYEAGKPLTVEEIIVEPPKAHEVRIRITYTAVCHTDAYTLSGVDP-EGAFPS 66
           P T  A + YE+G  L  +++ V  PK +E+ I I Y+ VCHTD +   G  P +   P 
Sbjct: 7   PKTQKAVIFYESGGALEYKDVPVPTPKPNEILINIKYSGVCHTDLHAWKGDWPLDTKLPL 66

Query: 67  ILGHEGAGVVESVGKGVTNVKPGDHV-VALYTAECQKCKFCTSGKTNLCGSVRATQGKGV 125
           I GHEGAGVV  +G  V   K GD+  V      C  C+ C     + C           
Sbjct: 67  IGGHEGAGVVVGMGANVRGWKIGDYAGVKWLNGSCMSCEECELSNESNC----------- 115

Query: 126 MPDGTSRFRTKNGESILHFMGCSTFSQYTXXXXXXXXXXXXQAPLDRICLLGCGVTTGYG 185
            P+      T +G          +F +Y              A L  +  + C   T Y 
Sbjct: 116 -PEADLSGYTHDG----------SFQEYCTADAVQAARIPQGADLAEVAPILCAGVTVY- 163

Query: 186 AAIKTANVQKGDTVAVFGA-GTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFGATDF 244
            A+K+A++  G+ VA+ GA G +G   VQ AKA G  R++ +D  ++KK+   + G   F
Sbjct: 164 KALKSADLAAGEWVAISGACGGLGSLAVQFAKAMGL-RVLGIDGGEEKKKMFHEMGGEVF 222

Query: 245 VNPSKDLKEGETIVSKLIELTDGGLDFTFDCTGNTKVMRDALEACH---KGWGQSIIIGV 301
           +    D +  + + + +I+ T+GG         N  V   A+EA     +  G  +++G+
Sbjct: 223 L----DFRLEKDMEAAVIKATNGGAHGVI----NVSVSEAAIEASTRYVRSNGTVVLVGL 274

Query: 302 AAAGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGQLKVDEFITHRRPFTE 361
            A     S    Q+V      GS  G    R++    +  ++ G +K    I       E
Sbjct: 275 PANAYCKSEVFSQVVKSYKIVGSYVG---NRADTREALDFFVRGLVKSPIHIVGLSTLPE 331

Query: 362 INAAFDDLHHGDCL-RTVLDLSK 383
           I   ++ +  G  + R V+D +K
Sbjct: 332 I---YEKMEKGQIVGRYVVDTTK 351

>Kwal_26.7799 s26 complement(515580..516743) [1164 bp, 387 aa] {ON}
           YMR083W (ADH3) - 1:1 [contig 55] FULL
          Length = 387

 Score = 92.4 bits (228), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 101/380 (26%), Positives = 157/380 (41%), Gaps = 39/380 (10%)

Query: 8   PITCLAAVAYEAGKPLTVEEIIVEPPKAHEVRIRITYTAVCHTDAYTLSGVDP-EGAFPS 66
           P T    + YE G  L  +++ V  PK +E+ I + Y+ VCHTD +   G  P +   P 
Sbjct: 43  PTTQKGVIFYEHGGELQYKDLPVPKPKPNEILINVKYSGVCHTDLHAWKGDWPLDVKLPL 102

Query: 67  ILGHEGAGVVESVGKGVTNVKPGDHV-VALYTAECQKCKFCTSGKTNLCGSVRATQGKGV 125
           + GHEGAGVV + G+ VTN + GD   +      C  C+ C  G    C     +   G 
Sbjct: 103 VGGHEGAGVVVAKGENVTNFEIGDLAGIKWLNGSCMSCELCEQGHEPNCEHADLS---GY 159

Query: 126 MPDGTSRFRTKNGESILHFMGCSTFSQYTXXXXXXXXXXXXQAPLDRICLLGCGVTTGYG 185
             DG                   +F QY                L  +  + C   T Y 
Sbjct: 160 THDG-------------------SFQQYATADAVQAAQLPKGINLAEVAPILCAGVTVY- 199

Query: 186 AAIKTANVQKGDTVAVFG-AGTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFGATDF 244
            A+KTA++  G  VA+ G AG +G   VQ AKA G  R++ +D  D+KK+     G   F
Sbjct: 200 KALKTADLIPGQWVAISGAAGGLGSLAVQYAKAMGL-RVLGIDGGDEKKELFHKLGGEIF 258

Query: 245 VNPSKDLKEGETIVSKLIELTDGGLDFTFDCTGNTKVMRDALEACHKGWGQSIIIGVAAA 304
           +    D    + +V  + E T GG     + + +   +  + +   +  G  +++G+ A 
Sbjct: 259 I----DYTTTKDMVGAIQEATQGGPQGVINVSVSEAAISLSTQYV-RPTGSVVLVGLPAN 313

Query: 305 GQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGQLKVDEFITHRRPFTEINA 364
               S     +V     KGS  G    R++    +  +  G +K    I      +E+  
Sbjct: 314 AYVKSEVFSHVVKSISIKGSYVG---NRADTREAIDFFNRGLIKAPIKIIG---LSELPQ 367

Query: 365 AFDDLHHGDCL-RTVLDLSK 383
           A+  +  G  L R V+D SK
Sbjct: 368 AYKMMEAGKILGRYVVDTSK 387

>TBLA0E03440 Chr5 (852767..853822) [1056 bp, 351 aa] {ON} Anc_3.118
           YBR145W
          Length = 351

 Score = 91.7 bits (226), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 77/264 (29%), Positives = 119/264 (45%), Gaps = 31/264 (11%)

Query: 8   PITCLAAVAYEAGKPLTVEEIIVEPPKAHEVRIRITYTAVCHTDAYTLSGVDP-EGAFPS 66
           P T  A + Y+ G PL  +++ V  PK +E+ I I Y+ VCHTD +   G  P +   P 
Sbjct: 7   PQTQKAVIFYKNGGPLEYKDVPVPTPKPNEILINIKYSGVCHTDLHAWKGDWPLDTKLPL 66

Query: 67  ILGHEGAGVVESVGKGVTNVKPGDHV-VALYTAECQKCKFCTSGKTNLCGSVRATQGKGV 125
           I GHEGAGVV  +G  V   K GD+  V      C  C+ C     + C           
Sbjct: 67  IGGHEGAGVVVGMGSNVKGWKIGDYAGVKWLNGSCMSCEECELSNESNC----------- 115

Query: 126 MPDGTSRFRTKNGESILHFMGCSTFSQYTXXXXXXXXXXXXQAPLDRICLLGCGVTTGYG 185
            P+      T +G          +F +Y                L ++  L C   T Y 
Sbjct: 116 -PEADLSGYTHDG----------SFQEYCTADAVQAARIPQGTDLAQVAPLLCAGVTVY- 163

Query: 186 AAIKTANVQKGDTVAVFGA-GTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFGATDF 244
            A+K+A++  G  VA+ GA G +G   +Q AKA G  R++ +D  ++KK+   + G   F
Sbjct: 164 KALKSADLAAGQWVAISGACGGLGSLAIQFAKAMGL-RVLGIDGGEEKKKMFHELGGEVF 222

Query: 245 VNPSKDLKEGETIVSKLIELTDGG 268
           +    D +  + + + +I+ T+GG
Sbjct: 223 L----DFRLEKDMEAAIIKATNGG 242

>Skud_15.68 Chr15 complement(118795..119841) [1047 bp, 348 aa] {ON}
           YOL086C (REAL)
          Length = 348

 Score = 91.3 bits (225), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 86/302 (28%), Positives = 132/302 (43%), Gaps = 38/302 (12%)

Query: 8   PITCLAAVAYEAGKPLTVEEIIVEPPKAHEVRIRITYTAVCHTDAYTLSGVDP-EGAFPS 66
           P T    + YE+   L  ++I V  PKA+E+ I + Y+ VCHTD +   G  P     P 
Sbjct: 4   PKTQKGVIFYESHGKLEYKDIPVPKPKANELLINVKYSGVCHTDLHAWHGDWPLPTKLPL 63

Query: 67  ILGHEGAGVVESVGKGVTNVKPGDHV-VALYTAECQKCKFCTSGKTNLCGSVRATQGKGV 125
           + GHEGAGVV ++G+ V     GD   +      C  C++C  G  + C           
Sbjct: 64  VGGHEGAGVVVAMGENVKGWNIGDFAGIKWLNGSCMACEYCELGNESNC----------- 112

Query: 126 MPDGTSRFRTKNGESILHFMGCSTFSQYTXXXXXXXXXXXXQAPLDRICLLGCGVTTGYG 185
            P       T +G          +F QY                L  +  + C   T Y 
Sbjct: 113 -PHADLSGYTHDG----------SFQQYATADAVQAAHVAPGTDLAEVAPVLCAGITVY- 160

Query: 186 AAIKTANVQKGDTVAVFG-AGTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFGATDF 244
            A+K+AN+  G  VA+ G AG +G   VQ AKA G  R+I +D  + K++     G   F
Sbjct: 161 KALKSANLMAGHWVAISGAAGGLGSLAVQYAKAMG-YRVIGIDGGEGKEELFRSIGGEVF 219

Query: 245 VNPSKDLKEGETIVSKLIELTDGGLDFTFDCTGNTKVMRDALEACH---KGWGQSIIIGV 301
           V+ +K+    + IV  +++ T+GG         N  V   A+EA     +  G ++++G+
Sbjct: 220 VDFTKE----KDIVGAVLKATNGGAHGVI----NVSVSEAAIEASTRYVRANGTTVLVGM 271

Query: 302 AA 303
            A
Sbjct: 272 PA 273

>AAR084W Chr1 (494021..495178) [1158 bp, 385 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YMR303C (ADH2)
          Length = 385

 Score = 91.7 bits (226), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 77/264 (29%), Positives = 118/264 (44%), Gaps = 31/264 (11%)

Query: 8   PITCLAAVAYEAGKPLTVEEIIVEPPKAHEVRIRITYTAVCHTDAYTLSGVDP-EGAFPS 66
           P T  A V  + G PL   EI V  PK  E+ I + Y+ VCHTD +   G  P     P 
Sbjct: 41  PKTQHAIVFDKNGGPLEYREIEVPEPKPTELLINVKYSGVCHTDLHAWKGDWPLPTKLPL 100

Query: 67  ILGHEGAGVVESVGKGVTNVKPGDHV-VALYTAECQKCKFCTSGKTNLCGSVRATQGKGV 125
           + GHEGAGVV ++G+ V   + GD   +      C  C+ C  G  + C           
Sbjct: 101 VGGHEGAGVVVAMGENVRGWQVGDLAGIKWLNGSCMSCEACEQGHESNC----------- 149

Query: 126 MPDGTSRFRTKNGESILHFMGCSTFSQYTXXXXXXXXXXXXQAPLDRICLLGCGVTTGYG 185
            P+      T +G          +F QY                L ++  + C   T Y 
Sbjct: 150 -PEADLSGYTHDG----------SFQQYATADAVQAAHIPAGTDLAQVAPILCAGITVY- 197

Query: 186 AAIKTANVQKGDTVAVFGA-GTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFGATDF 244
            A+K+AN++ G+ VA+ GA G +G   +Q A+A G  R++ +D  D+K+      G   F
Sbjct: 198 KALKSANLRAGNWVAISGACGGLGSLAIQYARAMG-YRVLEIDGGDEKEALFRKLGGEVF 256

Query: 245 VNPSKDLKEGETIVSKLIELTDGG 268
           V    D ++ + +V+ +++ T GG
Sbjct: 257 V----DFRKSKDVVADVVKATGGG 276

>SAKL0E02838g Chr5 (226264..227397) [1134 bp, 377 aa] {ON}
           uniprot|Q6XQ71 Saccharomyces kluyveri ADH4 Alcohol
           dehydrogenase 4
          Length = 377

 Score = 91.7 bits (226), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 80/264 (30%), Positives = 114/264 (43%), Gaps = 31/264 (11%)

Query: 8   PITCLAAVAYEAGKPLTVEEIIVEPPKAHEVRIRITYTAVCHTDAYTLSGVDP-EGAFPS 66
           P T    + YE+G  L  ++I V  PK +E+ I + Y+ VCHTD +   G  P     P 
Sbjct: 33  PTTQKGVIFYESGGKLEYKDIPVPKPKPNEILINVKYSGVCHTDLHAWKGDWPLPTKLPL 92

Query: 67  ILGHEGAGVVESVGKGVTNVKPGDHV-VALYTAECQKCKFCTSGKTNLCGSVRATQGKGV 125
           + GHEGAGVV + G+ V N + GD   +      C  C+ C  G  + C     +   G 
Sbjct: 93  VGGHEGAGVVVAKGENVMNFEIGDLAGIKWLNGSCMACELCEQGHESNCLHADLS---GY 149

Query: 126 MPDGTSRFRTKNGESILHFMGCSTFSQYTXXXXXXXXXXXXQAPLDRICLLGCGVTTGYG 185
             DG                   +F QY                L  +  + C   T Y 
Sbjct: 150 THDG-------------------SFQQYATADAVQAAQIPKGTDLAEVAPILCAGVTVY- 189

Query: 186 AAIKTANVQKGDTVAVFG-AGTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFGATDF 244
            A+KTA+++ G  VA+ G AG +G   VQ AKA G  RI+ +D    K++     G   F
Sbjct: 190 KALKTADLKPGQWVAISGAAGGLGSLAVQYAKAMGL-RILGIDGGPGKEELFKSLGGEVF 248

Query: 245 VNPSKDLKEGETIVSKLIELTDGG 268
           +    D  + + IVS + E T GG
Sbjct: 249 I----DFTKTKDIVSAIQEATKGG 268

>Suva_15.81 Chr15 complement(132739..133785) [1047 bp, 348 aa] {ON}
           YOL086C (REAL)
          Length = 348

 Score = 91.3 bits (225), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 99/380 (26%), Positives = 157/380 (41%), Gaps = 39/380 (10%)

Query: 8   PITCLAAVAYEAGKPLTVEEIIVEPPKAHEVRIRITYTAVCHTDAYTLSGVDPEGA-FPS 66
           P T    + YE+   L  ++I V  PKA+E+ I + Y+ VCHTD +   G  P     P 
Sbjct: 4   PKTQKGVIFYESHGKLEYKDIPVPTPKANELLINVKYSGVCHTDLHAWHGDWPLPVKLPL 63

Query: 67  ILGHEGAGVVESVGKGVTNVKPGDHV-VALYTAECQKCKFCTSGKTNLCGSVRATQGKGV 125
           + GHEGAGVV ++G+ V     GD   +      C  C++C  G  + C           
Sbjct: 64  VGGHEGAGVVVAMGENVKGWNIGDFAGIKWLNGSCMACEYCELGNESNC----------- 112

Query: 126 MPDGTSRFRTKNGESILHFMGCSTFSQYTXXXXXXXXXXXXQAPLDRICLLGCGVTTGYG 185
            P       T +G          +F QY                L     + C   T Y 
Sbjct: 113 -PHADLSGYTHDG----------SFQQYATADSVQAAHIPKGTDLAECAPVLCAGITVY- 160

Query: 186 AAIKTANVQKGDTVAVFG-AGTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFGATDF 244
            A+K+AN+  G  VA+ G AG +G   VQ AKA G  R++ +D  + K++     G   F
Sbjct: 161 KALKSANLSAGQWVAISGAAGGLGSLAVQYAKAMG-YRVVGIDGGEGKEELFRSIGGEVF 219

Query: 245 VNPSKDLKEGETIVSKLIELTDGGLDFTFDCTGNTKVMRDALEACHKGWGQSIIIGVAAA 304
           +    D    + IV  +I+ TDGG     + + +   +  +   C    G ++++G+ A 
Sbjct: 220 I----DFTTEKDIVGAVIKATDGGAHGIINVSVSEAAIEASTRYCRAN-GTTVLVGMPAG 274

Query: 305 GQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGQLKVDEFITHRRPFTEINA 364
            +  S    Q+V      GS  G    R++    +  +  G +K    +       EI  
Sbjct: 275 AKCCSDVFNQVVKSISIVGSYVG---NRADTREALDFFARGLVKSPIKVVGLSTLPEI-- 329

Query: 365 AFDDLHHGDCL-RTVLDLSK 383
            ++ +  G  + R V+D SK
Sbjct: 330 -YEKMEKGQIVGRYVVDTSK 348

>Smik_2.284 Chr2 (518341..519396) [1056 bp, 351 aa] {ON} YBR145W
           (REAL)
          Length = 351

 Score = 90.5 bits (223), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 95/380 (25%), Positives = 156/380 (41%), Gaps = 39/380 (10%)

Query: 8   PITCLAAVAYEAGKPLTVEEIIVEPPKAHEVRIRITYTAVCHTDAYTLSGVDP-EGAFPS 66
           P T  A V YE    L  +++ V  PK +E+ + + Y+ VCH+D +   G  P +  FP 
Sbjct: 7   PKTQKAIVFYETDGKLEYKDVTVPEPKPNEILVHVKYSGVCHSDLHAWHGDWPFQLKFPL 66

Query: 67  ILGHEGAGVVESVGKGVTNVKPGDHV-VALYTAECQKCKFCTSGKTNLCGSVRATQGKGV 125
           I GHEGAGVV  +G  V   K GD   +      C  C++C  G  + C  +    G G 
Sbjct: 67  IGGHEGAGVVVKLGSNVKGWKVGDLAGIKWLNGTCMSCEYCEVGNESQCPHL---DGTGF 123

Query: 126 MPDGTSRFRTKNGESILHFMGCSTFSQYTXXXXXXXXXXXXQAPLDRICLLGCGVTTGYG 185
             DG                   TF +Y                L  +  + C   T Y 
Sbjct: 124 THDG-------------------TFQEYATADAVQAAHIPQNVNLAEVAPILCAGITVY- 163

Query: 186 AAIKTANVQKGDTVAVFGA-GTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFGATDF 244
            A+K AN+  G  V + GA G +G   +Q A A G  R+I +D  + K++     G   F
Sbjct: 164 KALKRANLMPGQWVTISGACGGLGSLAIQYALAMG-FRVIGIDGGEAKRKLFEKLGGEIF 222

Query: 245 VNPSKDLKEGETIVSKLIELTDGGLDFTFDCTGNTKVMRDALEACHKGWGQSIIIGVAAA 304
           ++ +K+      +   +I+ T+GG     + + +   +  +   C    G  +++G+ A 
Sbjct: 223 IDFTKE----RDVAGAVIKATNGGSHGIINVSVSEAAIEASTRYCRPN-GTVVLVGMPAH 277

Query: 305 GQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGQLKVDEFITHRRPFTEINA 364
               S    Q+V      GS  G    R++    +  +  G +   E   H    +++  
Sbjct: 278 AHCKSDVFNQVVKSISIVGSCVG---NRADTREALDFFARGLI---ESPIHLAGLSDVPE 331

Query: 365 AFDDLHHGDCL-RTVLDLSK 383
            F  +  G+ + R V+D S+
Sbjct: 332 IFGKMEKGEIVGRYVVDTSR 351

>Smik_48.1 Chr48 complement(1..1074) [1074 bp, 357 aa] {ON} YJR159W
           (REAL)
          Length = 357

 Score = 90.5 bits (223), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 107/377 (28%), Positives = 158/377 (41%), Gaps = 77/377 (20%)

Query: 30  VEPPKAHEVRIRITYTAVCHTDA--YTLSGVDPEGAF----PSILGHEGAGVVESVGKGV 83
           +E P  H V++ I  T +C +D   Y   G+   G +    P +LGHE +G V  VG  V
Sbjct: 27  IEDP--HYVKLAIKATGICGSDVHYYRSGGI---GKYILKAPMVLGHESSGEVVEVGNAV 81

Query: 84  TNVKPGDHVVALYTAECQKCKFCTSGKTNLCGSVRATQGKGVMPDGTSRFRTKNGESILH 143
           T VK GD V        +       G+ NLC  +       +           +G  + +
Sbjct: 82  TRVKVGDRVAIEPGVPSRYSDETKEGRYNLCPHMAFAATPPI-----------DGTLVKY 130

Query: 144 FMGCSTFSQYTXXXXXXXXXXXXQAPLDRICLLGCGVTTGYGAAI----------KTANV 193
           ++                      +P D +  L  GV+   GA +          K A V
Sbjct: 131 YL----------------------SPEDFLVKLPEGVSYEEGACVEPLSVGVHSNKLAGV 168

Query: 194 QKGDTVAVFGAGTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFGATDFVNPSK-DLK 252
           +    V VFGAG VGL     A+A GAS ++ VD+ D K Q A DFGAT+  N SK    
Sbjct: 169 RFSTRVVVFGAGPVGLLTGAVARAFGASDVVFVDVFDNKLQRAKDFGATNTFNSSKIPTD 228

Query: 253 EGETIVSKLIELTDGG-LDFTFDCTGNTKVMRDALEACHKGWGQSIIIGVAAAGQEISTR 311
           + + + S++ +L  G   D  F+C+G   V  DA     K  G  + +G+   G+  +  
Sbjct: 229 KAQELASEVEKLLGGNHADVVFECSG-ADVCIDAGVKVTKVGGTMVQVGM---GKNYTNF 284

Query: 312 PFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMD-------GQLKVDEFITHRRPFTEINA 364
           P   V+G+  K    G    R   G    DY D       G++ V   ITHR  F +   
Sbjct: 285 PIAEVSGKEMK--LIGCF--RYSFG----DYRDAVNLVATGKVNVKPLITHRFKFEDAAK 336

Query: 365 AFDD--LHHGDCLRTVL 379
           A+D    H GD ++T++
Sbjct: 337 AYDYNISHGGDVVKTII 353

>Kwal_55.19574 s55 complement(32260..33330) [1071 bp, 356 aa] {ON}
           YJR159W (SOR1) - sorbitol-induced sorbitol dehydrogenase
           [contig 159] FULL
          Length = 356

 Score = 90.5 bits (223), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 100/360 (27%), Positives = 157/360 (43%), Gaps = 53/360 (14%)

Query: 36  HEVRIRITYTAVCHTDA--YTLSGVDPEGAF----PSILGHEGAGVVESVGKGVTNVKPG 89
           +  ++ +  T +C +D   Y   G+   G +    P +LGHE +GVV  VG  V  +K G
Sbjct: 30  YYAKVAVKATGICGSDVHYYRSGGI---GKYILNSPMVLGHESSGVVVEVGPKVEKIKVG 86

Query: 90  DHVVALYTAECQKCKFCTSGKTNLCGSVRATQGKGVMPDGT-SRFRTKNGESILHFMGCS 148
           D V        +      +GK NLC  +       +  DGT  ++     + ++      
Sbjct: 87  DRVAIEPGVPDRYSDETKAGKYNLCPHMAFAATPPI--DGTLVKYYLSPADFLVKLPDHV 144

Query: 149 TFSQYTXXXXXXXXXXXXQAPLDRICLLGCGVTTGYGAAIKTANVQKGDTVAVFGAGTVG 208
           +F +                    I  L  GV +      K A V+ G TV VFGAG VG
Sbjct: 145 SFEEGAC-----------------IEPLSVGVHSN-----KLAKVRFGQTVVVFGAGPVG 182

Query: 209 LSVVQGAKARGASRIIVVDINDQKKQWASDFGATDFVNPSKDLKEGETIVSKLIELTDGG 268
           L     AKA GAS ++ VD+ DQK + A +FGAT  +N +K  K     ++  +E   GG
Sbjct: 183 LLTGAVAKAFGASDVVFVDVFDQKLERAKNFGATHVINSTKLPKNDPQALADEVEKLLGG 242

Query: 269 --LDFTFDCTGNTKVMRDALEACHKGWGQSIIIGVAAAGQEISTRPFQLVTGRVWK---- 322
              D  F+C+G    +   ++A   G G  + IG+   G+     P   V+G+       
Sbjct: 243 ALADVVFECSGAESCIDAGVKATKNG-GTMVQIGM---GKNYVNFPIAEVSGKEMTLVGC 298

Query: 323 -GSAFGGIKGRSEMGGLVSDYMDGQLKVDEFITHRRPFTEINAAFD--DLHHGDCLRTVL 379
              ++G  K   +   LVS    G++ V + ITHR  F +   A+D    H G+ ++T++
Sbjct: 299 FRYSYGDYK---DAVNLVS---TGRVDVKKLITHRFSFEDAAKAYDFNIAHGGEVVKTII 352

>ZYRO0G03410g Chr7 complement(269170..270291) [1122 bp, 373 aa] {ON}
           similar to uniprot|P07246 Saccharomyces cerevisiae
           YMR083W ADH3
          Length = 373

 Score = 90.5 bits (223), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 105/370 (28%), Positives = 154/370 (41%), Gaps = 41/370 (11%)

Query: 20  GKPLTVEEIIVEPPKAHEVRIRITYTAVCHTDAYTLSGVDP-EGAFPSILGHEGAGVVES 78
           G  L  E++ V  P ++EV I + Y+ VCHTD +T  G  P +   P + GHEGAGVV +
Sbjct: 39  GPLLYREDLPVPTPASNEVLINVKYSGVCHTDLHTWKGEIPFKTKLPLVGGHEGAGVVVA 98

Query: 79  VGKGVTNVKPGDHV-VALYTAECQKCKFCTSGKTNLCGSVRATQGKGVMPDGTSRFRTKN 137
            GK V   + GD   V    + C  C+ C  G    C      +  G   DG        
Sbjct: 99  KGKDVKTFEIGDLAGVKQLVSSCMGCESCEIGHEFGC---EQAEMSGSSHDG-------- 147

Query: 138 GESILHFMGCSTFSQYTXXXXXXXXXXXXQAPLDRICLLGCGVTTGYGAAIKTANVQKGD 197
                      TF QY                L  +  + C   + Y  A+K  N+Q   
Sbjct: 148 -----------TFQQYVAIDALQAPPLPANVDLAAVAPIFCAGVSVY-KALKNGNLQTNQ 195

Query: 198 TVAVFGA-GTVGLSVVQGAKARGASRIIVVD-INDQKKQWASDFGATDFVNPSKDLKEGE 255
            VA+FGA G +G   VQ AKA G  R++ +D   +++KQ     G   F+    D  + +
Sbjct: 196 WVAIFGATGGLGSIAVQYAKAMG-YRVLGIDGPGEERKQLFHSLGGEVFL----DYTQVD 250

Query: 256 TIVSKLIELTDGGLDFTFDCTGNTKVMRDALEACHKGWGQSIIIGVAAAGQEISTRPFQL 315
            I + + + T GG     + T +       ++ C +  G  + +GV      + T  F +
Sbjct: 251 NIPAAVKQATQGGAHCVLNVTASLAAYDQTIK-CVRPLGTVVPVGVPPDSGLLKTDIFTI 309

Query: 316 VT-GRVWKGSAFGGIKGRSEMGGLVSDYMDGQLKVDEFITHRRPFTEINAAFDDLHHGDC 374
           V  G   KGSA G    R++    V  +  G +K    I      +E+  AF+ L  G  
Sbjct: 310 VQHGFSIKGSASG---SRADTREAVDFFTRGLIKSPIKILG---LSELPKAFELLESGQT 363

Query: 375 L-RTVLDLSK 383
             R VLD SK
Sbjct: 364 TGRLVLDTSK 373

>NCAS0A07780 Chr1 (1548197..1549318) [1122 bp, 373 aa] {ON}
           Anc_2.480
          Length = 373

 Score = 89.4 bits (220), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 79/271 (29%), Positives = 116/271 (42%), Gaps = 31/271 (11%)

Query: 1   MSETVGKPITCLAAVAYEAGKPLTVEEIIVEPPKAHEVRIRITYTAVCHTDAYTLSGVDP 60
           +  TV  P      + YE G PL  ++I V  PKA+E+ I + Y+ VCHTD +   G  P
Sbjct: 22  LQSTVTIPKMQKGVIFYETGGPLHYKDIPVPKPKANEILINVKYSGVCHTDLHAWKGDWP 81

Query: 61  EGA-FPSILGHEGAGVVESVGKGVTNVKPGDHV-VALYTAECQKCKFCTSGKTNLCGSVR 118
                P + GHEG+G V ++G+ V   K GD   +      C  C+ C SG  + C    
Sbjct: 82  LATKLPLVGGHEGSGEVVAMGENVKGWKIGDLAGIKWLNGSCMSCELCESGHESNCEHAD 141

Query: 119 ATQGKGVMPDGTSRFRTKNGESILHFMGCSTFSQYTXXXXXXXXXXXXQAPLDRICLLGC 178
            +   G   DG                   +F QY                +  +  + C
Sbjct: 142 LS---GYTHDG-------------------SFQQYATADAVQAARIPKGTNMAEVAPILC 179

Query: 179 GVTTGYGAAIKTANVQKGDTVAVFG-AGTVGLSVVQGAKARGASRIIVVDINDQKKQWAS 237
              T Y  A+K A+++ G  V + G AG +G   VQ AKA G  R+I +D    K++   
Sbjct: 180 AGITVY-KALKEADMRAGQWVCISGAAGGLGSLAVQYAKAMG-YRVIGIDGGPGKEELFK 237

Query: 238 DFGATDFVNPSKDLKEGETIVSKLIELTDGG 268
             G   FV    D  + + IV+++ E T GG
Sbjct: 238 SLGGEIFV----DFTKTKDIVAEIQEATRGG 264

>Kwal_26.6684 s26 (21910..22980) [1071 bp, 356 aa] {ON} YJR159W
           (SOR1) - sorbitol-induced sorbitol dehydrogenase [contig
           381] FULL
          Length = 356

 Score = 89.0 bits (219), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 107/369 (28%), Positives = 159/369 (43%), Gaps = 57/369 (15%)

Query: 29  IVEPPKAHEVRIRITYTAVCHTDA-YTLSGVDPEGAF----PSILGHEGAGVVESVGKGV 83
           + E P  H V++ I  T +C +D  Y  SG    G +    P +LGHE +G V  VG  V
Sbjct: 23  VPELPNEHYVKVAIKATGICGSDIHYYKSG--SIGKYVVNQPMVLGHESSGEVVEVGSAV 80

Query: 84  TNVKPGDHVVALYTAECQKCKFCTSGKTNLCGSVRATQGKGVMPDGT-SRFRTKNGESIL 142
            ++K GD V        +       G+ NLC  +       +  DGT  ++     + ++
Sbjct: 81  RSIKVGDRVAIEPGVPDRYSDETKQGRYNLCPDMAFAATPPI--DGTLVKYYVSPADFLV 138

Query: 143 HFMGCSTFSQYTXXXXXXXXXXXXQAPLDRICLLGCGVTTGYGAAIKTANVQKGDTVAVF 202
                 +F +                    I  L  GV      A K A V  G  V VF
Sbjct: 139 KLPDHVSFEEGAC-----------------IEPLSVGVH-----ANKLAKVHFGSVVVVF 176

Query: 203 GAGTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFGATDFVNPSKDLK--EGETIVSK 260
           GAG VGL     AKA GAS +I VD+ D K + A  FGAT  +N SK L   EG+ + + 
Sbjct: 177 GAGPVGLLTGAVAKAFGASEVIYVDVFDNKLERAKGFGATHTIN-SKSLPRGEGDAVSAA 235

Query: 261 LIELTDGGL-DFTFDCTGNTKVMRDALEACHKGWGQSIIIGVAAAGQEISTRPFQLVTGR 319
           +     G L D  F+C+G    +   + +   G G  + IG+   G+     P   V+G+
Sbjct: 236 VSNYLGGALADVVFECSGAEPCINSGVLSTKNG-GTMVQIGM---GKNYINFPLAEVSGK 291

Query: 320 VWKGSAFGGIKGRSEMGGLVSDYMD-------GQLKVDEFITHRRPFTEINAAFDD--LH 370
             + S  G    R   G    DY D       GQ++V + IT+R  F +  AA+D    +
Sbjct: 292 --EMSVIGCF--RYSFG----DYRDAVRLVATGQVEVKKMITNRFKFEDAAAAYDYNIAN 343

Query: 371 HGDCLRTVL 379
            G+ ++T++
Sbjct: 344 GGEVVKTII 352

>Kwal_56.23198 s56 (443881..444936) [1056 bp, 351 aa] {ON} YOL086C
           (ADH1) - Alcohol dehydrogenase [contig 183] FULL
          Length = 351

 Score = 88.6 bits (218), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 76/264 (28%), Positives = 114/264 (43%), Gaps = 31/264 (11%)

Query: 8   PITCLAAVAYEAGKPLTVEEIIVEPPKAHEVRIRITYTAVCHTDAYTLSGVDP-EGAFPS 66
           P T  A + YE G PL  ++I V  P A E+ I + Y+ VCHTD +   G  P     P 
Sbjct: 7   PKTQKAVIFYENGGPLEYKDIPVPKPSATELLINVKYSGVCHTDLHAWKGDWPLPTKLPL 66

Query: 67  ILGHEGAGVVESVGKGVTNVKPGDHV-VALYTAECQKCKFCTSGKTNLCGSVRATQGKGV 125
           + GHEGAGVV ++G+ V   K GD+  +      C  C+ C     + C           
Sbjct: 67  VGGHEGAGVVVAMGENVKGWKIGDYAGIKWLNGSCMSCESCELSNESNC----------- 115

Query: 126 MPDGTSRFRTKNGESILHFMGCSTFSQYTXXXXXXXXXXXXQAPLDRICLLGCGVTTGYG 185
            P+      T +G          +F QY                L  +  + C   T Y 
Sbjct: 116 -PEADLSGYTHDG----------SFQQYATADAVQAAKIPQGTDLAEVAPVLCAGITVY- 163

Query: 186 AAIKTANVQKGDTVAVFGA-GTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFGATDF 244
            A+K+AN+  GD VA+ GA G +G   +Q A A G  R++ +D   +K +     G   F
Sbjct: 164 KALKSANLSAGDWVAISGACGGLGSLCIQYATAMG-YRVLGIDGGAEKAELFKQLGGEVF 222

Query: 245 VNPSKDLKEGETIVSKLIELTDGG 268
           +    D    + +  ++I+ T+GG
Sbjct: 223 I----DFTTCKDVEGEIIKATNGG 242

>Kpol_1036.19 s1036 (51276..52337) [1062 bp, 353 aa] {ON}
           (51276..52337) [1062 nt, 354 aa]
          Length = 353

 Score = 88.2 bits (217), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 83/284 (29%), Positives = 120/284 (42%), Gaps = 35/284 (12%)

Query: 8   PITCLAAVAYEAGKPLTVEEIIVEPPKAHEVRIRITYTAVCHTDAYTLSGVDP-EGAFPS 66
           P T    + YE    L  +++ V  PK  E+ I + Y+ VCHTD +   G  P +   P 
Sbjct: 9   PKTQKGVIFYENNGELQYKDLPVPQPKPTELLIHVLYSGVCHTDLHAWKGDWPLDTKLPL 68

Query: 67  ILGHEGAGVVESVGKGVTNVKPGDHV-VALYTAECQKCKFCTSGKTNLCGSVRATQGKGV 125
           + GHEGAGVV  +G  V   K GD   +      C  C+ C     + C           
Sbjct: 69  VGGHEGAGVVVGMGSSVKGWKMGDLAGIKWLNGSCMNCEECELSNESNC----------- 117

Query: 126 MPDGTSRFRTKNGESILHFMGCSTFSQYTXXXXXXXXXXXXQAPLDRICLLGCGVTTGYG 185
            P+      T +G          +F QY              A +  +  + C   T Y 
Sbjct: 118 -PEADLSGYTHDG----------SFQQYATADAVQAAHIPQGADMAEVAPILCAGVTVY- 165

Query: 186 AAIKTANVQKGDTVAVFG-AGTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFGATDF 244
            A+K+A ++ GD VA+ G AG +G   VQ AKA G  R++ +D  D+K+++    G   F
Sbjct: 166 KALKSAELKAGDWVAISGAAGGLGSLAVQYAKAMG-YRVLGIDGGDEKEKFFKSMGGEVF 224

Query: 245 VNPSKDLKEGETIVSKLIELTDGGLDFTFDCTGNTKVMRDALEA 288
           V    D    + IV  + E T+GG      C  N  V   A+EA
Sbjct: 225 V----DFMTCKDIVGAVKEATNGG---AHGCI-NVSVSEKAIEA 260

>KAFR0L02000 Chr12 (378013..379098) [1086 bp, 361 aa] {ON} 
          Length = 361

 Score = 87.8 bits (216), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 77/264 (29%), Positives = 112/264 (42%), Gaps = 31/264 (11%)

Query: 8   PITCLAAVAYEAGKPLTVEEIIVEPPKAHEVRIRITYTAVCHTDAYTLSGVDP-EGAFPS 66
           P T  A V  E G  L   +I V   KA+E+ I + Y+ VCH+D Y      P     P 
Sbjct: 17  PKTQKAMVFSEYGGDLEYRDIPVPTKKANEILINVKYSGVCHSDLYVWKNRTPMTSKLPL 76

Query: 67  ILGHEGAGVVESVGKGVTNVKPGDHV-VALYTAECQKCKFCTSGKTNLCGSVRATQGKGV 125
           + GHEGAGVV  +G  V N K GD   V    + C  C+ C  G    C           
Sbjct: 77  VGGHEGAGVVVGMGSNVKNWKIGDKAGVKWLNSTCMTCEHCELGNEPSC----------- 125

Query: 126 MPDGTSRFRTKNGESILHFMGCSTFSQYTXXXXXXXXXXXXQAPLDRICLLGCGVTTGYG 185
           +    + F T+NG          +F QY                L  +    C   T Y 
Sbjct: 126 LKSEYNGF-TRNG----------SFQQYVAVDAIHAPRLPDNCDLAELAPASCAGVTVY- 173

Query: 186 AAIKTANVQKGDTVAVFGA-GTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFGATDF 244
            AIK+AN++ G  +A+ GA G +G   +Q  KA G  R++ +D  + K     + G   F
Sbjct: 174 KAIKSANIRAGQWMAITGACGGLGSVAIQYCKAMG-YRVVGIDAGEAKANLFKELGGEVF 232

Query: 245 VNPSKDLKEGETIVSKLIELTDGG 268
           +    D  + + +V+ ++  T+GG
Sbjct: 233 I----DFTKSKDLVADVVSATNGG 252

>ZYRO0C12562g Chr3 (993434..994480) [1047 bp, 348 aa] {ON} highly
           similar to uniprot|P00331 Saccharomyces cerevisiae
           YMR303C ADH2 Glucose-repressible alcohol dehydrogenase
           II involved in the production of certain carboxylate
           esters
          Length = 348

 Score = 87.4 bits (215), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 85/302 (28%), Positives = 127/302 (42%), Gaps = 38/302 (12%)

Query: 8   PITCLAAVAYEAGKPLTVEEIIVEPPKAHEVRIRITYTAVCHTDAYTLSGVDP-EGAFPS 66
           P T  A +  E   PL  ++I V  PK +E+ I + Y+ VCHTD +   G  P     P 
Sbjct: 4   PETQKAVIFSENNGPLEYKDIPVPKPKPNEILIHVRYSGVCHTDLHAWKGDWPLPTKLPL 63

Query: 67  ILGHEGAGVVESVGKGVTNVKPGDHV-VALYTAECQKCKFCTSGKTNLCGSVRATQGKGV 125
           + GHEGAG V ++G  V N K GD   +      C  C+ C     + C           
Sbjct: 64  VGGHEGAGEVVALGSDVKNWKIGDLAGIKWLNGSCMSCEACEQSHESNC----------- 112

Query: 126 MPDGTSRFRTKNGESILHFMGCSTFSQYTXXXXXXXXXXXXQAPLDRICLLGCGVTTGYG 185
            PD      T +G          +F QY                L  +  + C   T Y 
Sbjct: 113 -PDADLSGYTHDG----------SFQQYATADAVQAAHIPAGTNLAEVAPVLCAGITVY- 160

Query: 186 AAIKTANVQKGDTVAVFG-AGTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFGATDF 244
            A+K+AN++ G  VA+ G AG +G   VQ A+A G  R++ +D    K++     G   F
Sbjct: 161 KALKSANLKAGQWVAISGAAGGLGSLAVQYARAMGL-RVLGIDGGPGKEELFKTLGGECF 219

Query: 245 VNPSKDLKEGETIVSKLIELTDGGLDFTFDCTGNTKVMRDALEACHK---GWGQSIIIGV 301
           ++ +K+      I   +I+ T+GG         N  V   A+ A  K     G S+++G+
Sbjct: 220 IDFTKE----HDIAEAVIKATNGGAHGVI----NVSVSEGAISASTKYVRSCGTSVLVGM 271

Query: 302 AA 303
            A
Sbjct: 272 PA 273

>Skud_20.2 Chr20 (1588..2661) [1074 bp, 357 aa] {ON} YJR159W (REAL)
          Length = 357

 Score = 87.4 bits (215), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 101/369 (27%), Positives = 154/369 (41%), Gaps = 71/369 (19%)

Query: 36  HEVRIRITYTAVCHTDA--YTLSGVDPEGAF----PSILGHEGAGVVESVGKGVTNVKPG 89
           H V++ I  T +C +D   Y   G+   G +    P +LGHE +G V  VG  VT VK G
Sbjct: 31  HYVKLAIKATGICGSDVHYYRSGGI---GKYILKAPMVLGHESSGQVVEVGDAVTRVKIG 87

Query: 90  DHVVALYTAECQKCKFCTSGKTNLCGSVRATQGKGVMPDGTSRFRTKNGESILHFMGCST 149
           D V        +       G+ NLC  +       +           +G  + +++    
Sbjct: 88  DRVAIEPGVPGRYSDETKEGRYNLCPHMAFAATPPI-----------DGTLVRYYL---- 132

Query: 150 FSQYTXXXXXXXXXXXXQAPLDRICLLGCGVTTGYGAAI----------KTANVQKGDTV 199
                             +P D +  L  GV+   GA +          K A V+ G  V
Sbjct: 133 ------------------SPEDFLVKLPDGVSYEEGACVEPLSVGVHSNKLAGVRFGTRV 174

Query: 200 AVFGAGTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFGATDFVNPSK-DLKEGETIV 258
            VFGAG VGL     A A GAS +I VD+ D + Q A DFGA+   N SK  + E + + 
Sbjct: 175 VVFGAGPVGLLTGAVAHAFGASDVIFVDVFDNRLQRAKDFGASGTFNSSKFSVDEAQQLA 234

Query: 259 SKLIELTDG-GLDFTFDCTGNTKVMRDALEACHKGWGQSIIIGVAAAGQEISTRPFQLVT 317
            ++ +L  G   D  F+C+G   V  DA     K  G  + +G+   G+  +  P   V+
Sbjct: 235 DEVEKLLGGHHADVVFECSG-ADVCIDAGVKTTKVGGTMVQVGM---GKNYTNFPIAEVS 290

Query: 318 GRVWK-----GSAFGGIKGRSEMGGLVSDYMDGQLKVDEFITHRRPFTEINAAFDD--LH 370
           G+  +       +FG  +        V+    G++ V   ITHR  F +   A+D    H
Sbjct: 291 GKEMRLIGCFRYSFGDYR------DAVNLVASGKVNVKPLITHRFKFEDAAKAYDYNIAH 344

Query: 371 HGDCLRTVL 379
            GD ++T++
Sbjct: 345 GGDVVKTII 353

>Skud_4.2 Chr4 complement(6287..7360) [1074 bp, 357 aa] {ON} YJR159W
           (REAL)
          Length = 357

 Score = 87.4 bits (215), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 101/369 (27%), Positives = 154/369 (41%), Gaps = 71/369 (19%)

Query: 36  HEVRIRITYTAVCHTDA--YTLSGVDPEGAF----PSILGHEGAGVVESVGKGVTNVKPG 89
           H V++ I  T +C +D   Y   G+   G +    P +LGHE +G V  VG  VT VK G
Sbjct: 31  HYVKLAIKATGICGSDVHYYRSGGI---GKYILKAPMVLGHESSGQVVEVGDAVTRVKIG 87

Query: 90  DHVVALYTAECQKCKFCTSGKTNLCGSVRATQGKGVMPDGTSRFRTKNGESILHFMGCST 149
           D V        +       G+ NLC  +       +           +G  + +++    
Sbjct: 88  DRVAIEPGVPGRYSDETKEGRYNLCPHMAFAATPPI-----------DGTLVRYYL---- 132

Query: 150 FSQYTXXXXXXXXXXXXQAPLDRICLLGCGVTTGYGAAI----------KTANVQKGDTV 199
                             +P D +  L  GV+   GA +          K A V+ G  V
Sbjct: 133 ------------------SPEDFLVKLPDGVSYEEGACVEPLSVGVHSNKLAGVRFGTRV 174

Query: 200 AVFGAGTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFGATDFVNPSK-DLKEGETIV 258
            VFGAG VGL     A A GAS +I VD+ D + Q A DFGA+   N SK  + E + + 
Sbjct: 175 VVFGAGPVGLLTGAVAHAFGASDVIFVDVFDNRLQRAKDFGASGTFNSSKFSVDEAQQLA 234

Query: 259 SKLIELTDG-GLDFTFDCTGNTKVMRDALEACHKGWGQSIIIGVAAAGQEISTRPFQLVT 317
            ++ +L  G   D  F+C+G   V  DA     K  G  + +G+   G+  +  P   V+
Sbjct: 235 DEVEKLLGGHHADVVFECSG-ADVCIDAGVKTTKVGGTMVQVGM---GKNYTNFPIAEVS 290

Query: 318 GRVWK-----GSAFGGIKGRSEMGGLVSDYMDGQLKVDEFITHRRPFTEINAAFDD--LH 370
           G+  +       +FG  +        V+    G++ V   ITHR  F +   A+D    H
Sbjct: 291 GKEMRLIGCFRYSFGDYR------DAVNLVASGKVNVKPLITHRFKFEDAAKAYDYNIAH 344

Query: 371 HGDCLRTVL 379
            GD ++T++
Sbjct: 345 GGDVVKTII 353

>Kpol_431.8 s431 (21043..22185) [1143 bp, 380 aa] {ON}
           (21043..22185) [1143 nt, 381 aa]
          Length = 380

 Score = 87.4 bits (215), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 75/249 (30%), Positives = 110/249 (44%), Gaps = 31/249 (12%)

Query: 23  LTVEEIIVEPPKAHEVRIRITYTAVCHTDAYTLSGVDPEGA-FPSILGHEGAGVVESVGK 81
           L   +I V  PK++E+ I + Y+ VCHTD +   G  P     P + GHEGAGVV  +G+
Sbjct: 51  LKYTDIPVPTPKSNEILINVKYSGVCHTDLHAWKGDWPLAVKLPLVGGHEGAGVVVGIGE 110

Query: 82  GVTNVKPGDHV-VALYTAECQKCKFCTSGKTNLCGSVRATQGKGVMPDGTSRFRTKNGES 140
            V   K GD   +      C  C+ C +G    C     +   G   DG           
Sbjct: 111 NVKGWKLGDLAGIKWLNGSCMSCELCETGHEANCEHADLS---GYTHDG----------- 156

Query: 141 ILHFMGCSTFSQYTXXXXXXXXXXXXQAPLDRICLLGCGVTTGYGAAIKTANVQKGDTVA 200
                   +F QY              + L +I  + C   T Y  A+KTAN++ G+ VA
Sbjct: 157 --------SFQQYATADAVQAARIPEGSDLAQIAPILCAGITVY-KALKTANLKPGEWVA 207

Query: 201 VFG-AGTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFGATDFVNPSKDLKEGETIVS 259
           + G AG +G   VQ AKA G  R++ +D  ++K++     G   FV    D  + + IV+
Sbjct: 208 ISGAAGGLGSLAVQYAKAMG-YRVVGIDGGEEKEKLFRSLGGEVFV----DFTKSKDIVA 262

Query: 260 KLIELTDGG 268
            +   T GG
Sbjct: 263 DIQNATKGG 271

>YJR159W Chr10 (736044..737117) [1074 bp, 357 aa] {ON}  SOR1Sorbitol
           dehydrogenase; expression is induced in the presence of
           sorbitol or xylose
          Length = 357

 Score = 87.0 bits (214), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 107/378 (28%), Positives = 156/378 (41%), Gaps = 89/378 (23%)

Query: 36  HEVRIRITYTAVCHTDA--YTLSGVDPEGAF----PSILGHEGAGVVESVGKGVTNVKPG 89
           H V++ I  T +C +D   Y   G+   G +    P +LGHE +G V  VG  VT VK G
Sbjct: 31  HYVKLAIKATGICGSDIHYYRSGGI---GKYILKAPMVLGHESSGQVVEVGDAVTRVKVG 87

Query: 90  DHVVALYTAECQKCKFCTSGKTNLCGSVRATQGKGVMPDGTSRFRTKNGESILHFMGCST 149
           D V        +       G+ NLC  +       +           +G  + +++    
Sbjct: 88  DRVAIEPGVPSRYSDETKEGRYNLCPHMAFAATPPI-----------DGTLVKYYL---- 132

Query: 150 FSQYTXXXXXXXXXXXXQAPLDRICLLGCGVTTGYGAAI----------KTANVQKGDTV 199
                             +P D +  L  GV+   GA +          K A V+ G  V
Sbjct: 133 ------------------SPEDFLVKLPEGVSYEEGACVEPLSVGVHSNKLAGVRFGTKV 174

Query: 200 AVFGAGTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFGATDFVNPS-------KDLK 252
            VFGAG VGL     A+A GA+ +I VD+ D K Q A DFGAT+  N S       +DL 
Sbjct: 175 VVFGAGPVGLLTGAVARAFGATDVIFVDVFDNKLQRAKDFGATNTFNSSQFSTDKAQDLA 234

Query: 253 EGETIVSKLIELTDGGLDFTFDCTGNTKVMRDALEACHKGWGQSIIIGVAAAGQEISTRP 312
           +G   V KL  L     D  F+C+G   V  DA     K  G  + +G+   G+  +  P
Sbjct: 235 DG---VQKL--LGGNHADVVFECSG-ADVCIDAAVKTTKVGGTMVQVGM---GKNYTNFP 285

Query: 313 FQLVTGRVWKGSAFGGIKG--RSEMGGLVSDYMD-------GQLKVDEFITHRRPFTEIN 363
              V+G+  K      + G  R   G    DY D       G++ V   ITH+  F +  
Sbjct: 286 IAEVSGKEMK------LIGCFRYSFG----DYRDAVNLVATGKVNVKPLITHKFKFEDAA 335

Query: 364 AAFDD--LHHGDCLRTVL 379
            A+D    H G+ ++T++
Sbjct: 336 KAYDYNIAHGGEVVKTII 353

>TDEL0D05050 Chr4 (921065..922120) [1056 bp, 351 aa] {ON} Anc_3.118
           YBR145W
          Length = 351

 Score = 86.7 bits (213), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 75/264 (28%), Positives = 115/264 (43%), Gaps = 31/264 (11%)

Query: 8   PITCLAAVAYEAGKPLTVEEIIVEPPKAHEVRIRITYTAVCHTDAYTLSGVDPEGA-FPS 66
           P T    + YE    L  ++I V  P  +E+ I + Y+ VCHTD +   G  P     P 
Sbjct: 7   PETQKGVIFYENNGTLEYKDIPVPKPAPNELLINVKYSGVCHTDLHAWKGDWPLPVKLPL 66

Query: 67  ILGHEGAGVVESVGKGVTNVKPGDHV-VALYTAECQKCKFCTSGKTNLCGSVRATQGKGV 125
           + GHEGAGVV ++G  V N K GD+  +      C  C+ C  G  + C           
Sbjct: 67  VGGHEGAGVVVALGSNVKNWKVGDYAGIKWLNGCCMSCEDCELGNESNC----------- 115

Query: 126 MPDGTSRFRTKNGESILHFMGCSTFSQYTXXXXXXXXXXXXQAPLDRICLLGCGVTTGYG 185
            P       T +G          +F QY                L  +  + C   T Y 
Sbjct: 116 -PQADLSGYTHDG----------SFQQYATTDAVQAAKISPGTDLAEVAPVLCAGLTVY- 163

Query: 186 AAIKTANVQKGDTVAVFGA-GTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFGATDF 244
            A+K+A ++ G  VA+ GA G +G   VQ AKA G  R++ +D  D+K +   + G   F
Sbjct: 164 KALKSAELEAGQWVAISGACGGLGSLAVQYAKAMG-YRVLGIDGGDEKAKMFKELGGEYF 222

Query: 245 VNPSKDLKEGETIVSKLIELTDGG 268
           +    D  + + I+ ++++ T+GG
Sbjct: 223 I----DFTKCKDIIGEVVKATNGG 242

>Suva_12.260 Chr12 (427406..428479) [1074 bp, 357 aa] {ON} YJR159W
           (REAL)
          Length = 357

 Score = 86.7 bits (213), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 103/378 (27%), Positives = 156/378 (41%), Gaps = 77/378 (20%)

Query: 29  IVEPPKAHEVRIRITYTAVCHTDA--YTLSGVDPEGAF----PSILGHEGAGVVESVGKG 82
           I+E P  H V+I I  T +C +D   Y   G+   G +    P +LGHE +G V  VG  
Sbjct: 26  IIEDP--HYVKIAIKATGICGSDIHYYRSGGI---GKYILKAPMVLGHESSGQVVEVGSA 80

Query: 83  VTNVKPGDHVVALYTAECQKCKFCTSGKTNLCGSVRATQGKGVMPDGTSRFRTKNGESIL 142
           VT VK GD V        +       G+ NLC  +       +           +G  + 
Sbjct: 81  VTRVKVGDRVAIEPGVPSRYSDETKEGRYNLCPHMAFAATPPI-----------DGTLVK 129

Query: 143 HFMGCSTFSQYTXXXXXXXXXXXXQAPLDRICLLGCGVTTGYGAAI----------KTAN 192
           +++                      +P D +  L  GV+   GA +          K A 
Sbjct: 130 YYL----------------------SPEDFLVKLPEGVSYEEGACVEPLSVGVHSNKLAG 167

Query: 193 VQKGDTVAVFGAGTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFGATDFVN----PS 248
           V+ G  V VFGAG VGL     A+A GAS ++ +D+ D K   A +FGAT   N    P+
Sbjct: 168 VRFGSRVVVFGAGPVGLLTGAVARAFGASDVVFIDVFDNKLDRAKEFGATHTFNSSKFPA 227

Query: 249 KDLKEGETIVSKLIELTDGGLDFTFDCTGNTKVMRDALEACHKGWGQSIIIGVAAAGQEI 308
              +E    V KL  L+    D  F+C+G    + DA     K  G  + IG+   G+  
Sbjct: 228 DKTQELADEVEKL--LSGHHADIVFECSGADACI-DAGVKITKVGGTMVQIGM---GKNY 281

Query: 309 STRPFQLVTGRVWK-----GSAFGGIKGRSEMGGLVSDYMDGQLKVDEFITHRRPFTEIN 363
           +  P   V+G+  K       +FG  +   ++         G++ V   ITHR  F +  
Sbjct: 282 TNFPIAEVSGKEMKLIGCFRYSFGDYRDAVKL------VASGKVNVKAMITHRFKFEDAA 335

Query: 364 AAFD--DLHHGDCLRTVL 379
            A+D    H G+ ++T++
Sbjct: 336 KAYDFNIAHGGEVVKTII 353

>TDEL0C00390 Chr3 (53995..55056) [1062 bp, 353 aa] {ON} Anc_8.16
           YLR070C
          Length = 353

 Score = 86.3 bits (212), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 102/383 (26%), Positives = 155/383 (40%), Gaps = 56/383 (14%)

Query: 14  AVAYEAGKPLTVE-EIIVEPPKAHEVRIRITYTAVCHTDAYTLSGVDPEGAF-------P 65
           AV  E  + + +E   I E    H+V+I+I  T +C +D +  +    +G+        P
Sbjct: 6   AVVLEKKELIQIESRPIPEIKNPHDVKIQIKATGICGSDVHYFT----QGSIGDFVVKSP 61

Query: 66  SILGHEGAGVVESVGKGVTNVKPGDHVVALYTAECQKCKFCTSGKTNLCGSVRATQGKGV 125
            +LGHE AGVV  VG  V++VK GD V        +  K   SG  NLC  +        
Sbjct: 62  LVLGHESAGVVVEVGDAVSSVKVGDRVAVEPGVPSRYSKETMSGHYNLCPHMAFA----- 116

Query: 126 MPDGTSRFRTKNGESILHFMGCSTFSQYTXXXXXXXXXXXXQAPLDRICLLGCGVTTGYG 185
               T  +   +G  + +++    F                    D I      V     
Sbjct: 117 ---ATPPY---DGTLVKYYLSPEDFVYKLA---------------DHISFEEGAVVEPLS 155

Query: 186 AAI---KTANVQKGDTVAVFGAGTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFGAT 242
            A+   + AN   G  V V GAG VGL     AKA GA+ ++ VDI + K + A  FGAT
Sbjct: 156 VAVHANRLANTAFGQAVLVLGAGPVGLLAGAVAKAFGATDVVFVDIFESKLEKAKQFGAT 215

Query: 243 DFVNPSKDLKEGETIVSKLIELTDGGL--DFTFDCTGNTKVMRDALEACHKGWGQSIIIG 300
             V    D  E + +   L+  + GGL  D  F+C+G  K +R A+++  +G G  + +G
Sbjct: 216 RTVLFKPDSDENDLV--SLVTKSLGGLHPDVVFECSGAEKCIRAAVKSVKRG-GTFVQVG 272

Query: 301 VAAAGQEISTRPFQLVTGRVWKGSAFGGIKGRSE--MGGLVSDYMDGQLKVDEFITHRRP 358
           +           F        K + F G     E      V     G++ V   IT   P
Sbjct: 273 MGKDNINFPINEFS------QKEATFKGCFRYYEGDFDDAVKLLSTGKVNVKPLITKVFP 326

Query: 359 FTEINAAF--DDLHHGDCLRTVL 379
           F +   A+  +  H  D  +T++
Sbjct: 327 FEQAVEAYKHNVEHAKDVTKTII 349

>ABL033C Chr2 complement(337866..338987) [1122 bp, 373 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR083W
           (ADH3)
          Length = 373

 Score = 86.3 bits (212), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 87/299 (29%), Positives = 130/299 (43%), Gaps = 36/299 (12%)

Query: 8   PITCLAAVAYEAGKPLTVEEIIVEPPKAHEVRIRITYTAVCHTDAYTLSG---VDPEGAF 64
           P T  A V YE G  L   +I V  PK +E+ + I Y+ VCHTD +   G   + P+   
Sbjct: 29  PTTQKAVVFYEHGGELKYTDIPVPKPKPNEILVNIKYSGVCHTDLHAWKGDWAIKPK--L 86

Query: 65  PSILGHEGAGVVESVGKGVTNVKPGDHV-VALYTAECQKCKFCTSGKTNLCGSVRATQGK 123
           P + GHEGAGVV + G  VTN + GD+  V      C +C+FC  G    C +   +   
Sbjct: 87  PLVGGHEGAGVVVAKGANVTNFEIGDYAGVKWLGKTCMECEFCQKGFEPNCETPTLS--- 143

Query: 124 GVMPDGTSRFRTKNGESILHFMGCSTFSQYTXXXXXXXXXXXXQAPLDRICLLGCGVTTG 183
           G   DG                   TF QY                L ++  + C   T 
Sbjct: 144 GYTHDG-------------------TFQQYATADAIHAAHIPPGTDLAKVAPILCAGITV 184

Query: 184 YGAAIKTANVQKGDTVAV-FGAGTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFGAT 242
           Y  A+KTA +  G  VA+    G +G   VQ A A G  R++ +D  ++K+      G  
Sbjct: 185 Y-KALKTAALIPGQWVAISGAGGGLGSLAVQYAVAMG-YRVVGIDGGNEKEALFRSLGGE 242

Query: 243 DFVNPSKDLKEGETIVSKLIELTDGGLDFTFDCTGNTKVMRDALEACHKGWGQSIIIGV 301
            FV    D  + + IVS + E T GG     + + +T  +  ++E   +  G  +++G+
Sbjct: 243 TFV----DFHKNKDIVSAVREATGGGPHGVVNVSVSTNAILQSVEYV-RPTGTVVLVGL 296

>YDL246C Chr4 complement(8683..9756) [1074 bp, 357 aa] {ON}
           SOR2Protein of unknown function; protein sequence is 99%
           identical to the Sor1p sorbitol dehydrogenase;
           computational analysis of large-scale protein-protein
           interaction data also suggests a role in fructose or
           mannose metabolism
          Length = 357

 Score = 85.9 bits (211), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 107/378 (28%), Positives = 155/378 (41%), Gaps = 89/378 (23%)

Query: 36  HEVRIRITYTAVCHTDA--YTLSGVDPEGAF----PSILGHEGAGVVESVGKGVTNVKPG 89
           H V++ I  T +C +D   Y   G+   G +    P +LGHE +G V  VG  VT VK G
Sbjct: 31  HYVKLAIKATGICGSDIHYYRSGGI---GKYILKAPMVLGHESSGQVVEVGDAVTRVKVG 87

Query: 90  DHVVALYTAECQKCKFCTSGKTNLCGSVRATQGKGVMPDGTSRFRTKNGESILHFMGCST 149
           D V        +       G  NLC  +       +           +G  + +++    
Sbjct: 88  DRVAIEPGVPSRYSDETKEGSYNLCPHMAFAATPPI-----------DGTLVKYYL---- 132

Query: 150 FSQYTXXXXXXXXXXXXQAPLDRICLLGCGVTTGYGAAI----------KTANVQKGDTV 199
                             +P D +  L  GV+   GA +          K A V+ G  V
Sbjct: 133 ------------------SPEDFLVKLPEGVSYEEGACVEPLSVGVHSNKLAGVRFGTKV 174

Query: 200 AVFGAGTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFGATDFVNPS-------KDLK 252
            VFGAG VGL     A+A GA+ +I VD+ D K Q A DFGAT+  N S       +DL 
Sbjct: 175 VVFGAGPVGLLTGAVARAFGATDVIFVDVFDNKLQRAKDFGATNTFNSSQFSTDKAQDLA 234

Query: 253 EGETIVSKLIELTDGGLDFTFDCTGNTKVMRDALEACHKGWGQSIIIGVAAAGQEISTRP 312
           +G   V KL  L     D  F+C+G   V  DA     K  G  + +G+   G+  +  P
Sbjct: 235 DG---VQKL--LGGNHADVVFECSG-ADVCIDAAVKTTKVGGTMVQVGM---GKNYTNFP 285

Query: 313 FQLVTGRVWKGSAFGGIKG--RSEMGGLVSDYMD-------GQLKVDEFITHRRPFTEIN 363
              V+G+  K      + G  R   G    DY D       G++ V   ITH+  F +  
Sbjct: 286 IAEVSGKEMK------LIGCFRYSFG----DYRDAVNLVATGKVNVKPLITHKFKFEDAA 335

Query: 364 AAFDD--LHHGDCLRTVL 379
            A+D    H G+ ++T++
Sbjct: 336 KAYDYNIAHGGEVVKTII 353

>KLTH0D00616g Chr4 (59883..61031) [1149 bp, 382 aa] {ON} similar to
           uniprot|P39713 Saccharomyces cerevisiae YAL061W putative
           polyol dehydrogenase
          Length = 382

 Score = 85.9 bits (211), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 85/345 (24%), Positives = 140/345 (40%), Gaps = 77/345 (22%)

Query: 12  LAAVAYEAGKPLTVEEIIVEPPKAHE--VRIRITYTAVCHTD----------------AY 53
           + A+AY   K +   + + +P  +HE  V I +++  VC +D                 +
Sbjct: 1   MRALAYFGQKDIRFTDSLAQPQVSHEDEVEIDVSWCGVCGSDLHEYLDGPIFFPANGKTH 60

Query: 54  TLSGVDPEGAFPSILGHEGAGVVESVGKGVTNVKPGDHVVALYTAECQK----------- 102
            +SG       P  +GHE +G+V  VG  V+ VK GDHVV      C+            
Sbjct: 61  AMSG----QGLPQAMGHEMSGIVSKVGSDVSKVKVGDHVVVGACCTCEDRARWPDVKHER 116

Query: 103 ---CKFCTSGKTNLCGSVRATQGKGVMPDGTSRFRTKNGESILHF--MGCST--FSQYTX 155
              C  C +G  N C                         + L F  +GC +  F++   
Sbjct: 117 EGLCIACKTGNPNCC-------------------------TDLGFCGLGCQSGGFAEKIV 151

Query: 156 XXXXXXXXXXXQAPLDRICLLGCGVTTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGA 215
                        PLD   L+     + +  A++ + +Q G T  V GAG +GL+ V   
Sbjct: 152 LSERNVVKIPNSLPLDVAALVEPISVSWH--AVRISKLQPGQTALVLGAGPIGLAAVLAL 209

Query: 216 KARGASRIIVVDINDQKKQWASDFGATDFVNPSKDLKEGETIVSKLIELTDG--GLDFTF 273
           ++ GA  IIV +  D ++Q A   GA  F NP+   + G+ ++  L +L  G  G +F++
Sbjct: 210 QSHGAGTIIVSEPADTRRQKAEALGAQTF-NPT---EHGDNVIEALRKLAPGGEGFNFSY 265

Query: 274 DCTGNTKVMRDALEACHKGWGQSIIIGVAAAG-QEISTRPFQLVT 317
           DC G ++     L   H    + + + +A  G + I   P  + T
Sbjct: 266 DCCGTSETFSAGL---HTLTPKGVAVNIAVWGPKPIDFYPMDVTT 307

>KNAG0E02590 Chr5 complement(513565..514689) [1125 bp, 374 aa] {ON}
           Anc_2.480 YMR083W
          Length = 374

 Score = 85.9 bits (211), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 77/271 (28%), Positives = 114/271 (42%), Gaps = 28/271 (10%)

Query: 1   MSETVGKPITCLAAVAYEAGKPLTVEEIIVEPPKAHEVRIRITYTAVCHTDAYTLSGVDP 60
           +  TV  P T    + YE G  L  ++I V  PK +E+ + + Y+ VCHTD +   G  P
Sbjct: 20  LQSTVSIPQTQKGVIFYEHGGDLHYKDIPVPKPKPNEILVNVKYSGVCHTDLHAWKGDWP 79

Query: 61  EGA-FPSILGHEGAGVVESVGKGVTNVKPGDHV-VALYTAECQKCKFCTSGKTNLCGSVR 118
                P + GHEGAGVV + G  V N + GD   +      C  C+ C SG  + C    
Sbjct: 80  LSVKLPLVGGHEGAGVVVAKGSNVNNFEIGDLAGIKWLNGSCMSCELCESGHESNCEHAD 139

Query: 119 ATQGKGVMPDGTSRFRTKNGESILHFMGCSTFSQYTXXXXXXXXXXXXQAPLDRICLLGC 178
            +   G   DG                   +F QY                L  +  + C
Sbjct: 140 LS---GYTHDG-------------------SFQQYATADAVQAAKIPEGTNLAEVAPVLC 177

Query: 179 GVTTGYGAAIKTANVQKGDTVAVFG-AGTVGLSVVQGAKARGASRIIVVDINDQKKQWAS 237
              T Y  A+K A++  G  V + G AG +G   VQ  KA G  R+I +D    K++   
Sbjct: 178 AGITVY-KALKEASLSPGQWVCISGAAGGLGSLAVQYGKAMGL-RVIGIDGGPGKEELFK 235

Query: 238 DFGATDFVNPSKDLKEGETIVSKLIELTDGG 268
             G   F++ +K  K    +V+ + + T+GG
Sbjct: 236 SLGGEVFIDFTKQ-KTDSDMVAAIQKATNGG 265

>Kpol_1058.11 s1058 (41165..42226) [1062 bp, 353 aa] {ON}
           (41165..42226) [1062 nt, 354 aa]
          Length = 353

 Score = 85.5 bits (210), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 98/349 (28%), Positives = 143/349 (40%), Gaps = 72/349 (20%)

Query: 36  HEVRIRITYTAVCHTDAY--TLSGVDPEGAF----PSILGHEGAGVVESVGKGVTNVKPG 89
           H V+++I  T +C +D +  T   +   G+F    P +LGHE +G+V  VG  VT V  G
Sbjct: 31  HFVKVQIKATGICGSDVHFCTHGAI---GSFIVKEPMVLGHESSGIVVEVGSEVTKVAVG 87

Query: 90  DHVVALYTAECQKCKFCTSGKTNLCGSVRATQGKGVMPDGTSRFRTKNGESILHFMGCST 149
           D V        +  +   SG  NLC  ++      V  DGT          +L +     
Sbjct: 88  DRVAIEPGYPSRYSEETVSGHYNLCPGMKFAATPPV--DGT----------LLKYF---- 131

Query: 150 FSQYTXXXXXXXXXXXXQAPLDRICLLGCGVTTGYGA----------AIKTANVQKGDTV 199
                            Q P D +  L   VT   GA          A+K A V+ GD V
Sbjct: 132 -----------------QVPEDFVYKLPDDVTFEEGALVEPLAVAVHAVKLAGVKFGDKV 174

Query: 200 AVFGAGTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFGATDFVNPSKDLKEGETIVS 259
            VFGAG VGL V    KA GA+ ++ +D+ D+K   + + G+T  +N SKD+ E    + 
Sbjct: 175 VVFGAGPVGLLVGSVCKAFGATEVVSIDVVDKKLDKSLEMGSTIAIN-SKDMAEEALALE 233

Query: 260 KLIELTDGGLDFTFDCTGNTKVMRDALEACHKGWGQSIIIGVAAAGQEISTRPFQLVTGR 319
              +L     +   DCTG    +R ++ AC  G G  + +G+      +       V+  
Sbjct: 234 IQNDLNGQHPNKVIDCTGAEPCLRSSILACKPG-GTVVQVGMGTTNASLP------VSDI 286

Query: 320 VWKGSAFGGIKGRSEMGGLVSDYMDG-------QLKVDEFITHRRPFTE 361
           V K   F G      M     DY D        ++ V   ITHR  F +
Sbjct: 287 VIKELTFKG-----SMRYCHGDYQDAIQLLKYKKVDVKAIITHRFSFDD 330

>CAGL0D00198g Chr4 (27559..28710) [1152 bp, 383 aa] {ON} similar to
           uniprot|P39714 Saccharomyces cerevisiae YAL060w FUN49 or
           uniprot|P39713 Saccharomyces cerevisiae YAL061w FUN50
          Length = 383

 Score = 85.1 bits (209), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 83/318 (26%), Positives = 132/318 (41%), Gaps = 68/318 (21%)

Query: 36  HEVRIRITYTAVCHTD----------------AYTLSGVDPEGAFPSILGHEGAGVVESV 79
           HE+ I + +  +C TD                 + LSG+D     P  +GHE +G+V+ V
Sbjct: 27  HELMIDVAWCGICGTDLHEFLEGPIFMPKDGDTHYLSGLD----LPLPMGHEMSGIVKEV 82

Query: 80  GKGVTNVKPGDHVVALYTAEC--------------QKCKFCTSGKTNLCGSVRATQGKGV 125
           GKGVT  KPGD VV   T  C              + C  C  G  N C +  + QG G 
Sbjct: 83  GKGVTRFKPGDRVVIEATTSCGDTHRWPKSKVAKGELCPACEMGLPNCC-THGSFQGLGS 141

Query: 126 MPDGTSRFRTKNGESILHFMGCSTFSQYTXXXXXXXXXXXXQAPLDRICLLGCGVTTGYG 185
           +  G                    F++              + PLD   L+   ++  + 
Sbjct: 142 VGGG--------------------FAEQVVVGEKHVVKIPDKLPLDVAALVE-PLSVAWH 180

Query: 186 AAIKTANVQKGDTVAVFGAGTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFGATDFV 245
           AA + A  ++G    V G+G +GL+++   K   A +I+V +    +++ A       F 
Sbjct: 181 AA-RLAEFKEGSNALVLGSGPIGLAMILALKGMKAGKIVVSEPAKLRRELAEKLNVVVF- 238

Query: 246 NPSKDLKEGETIVSKLIELT--DGGLDFTFDCTGNTKVMRDALE-ACHKGWGQSIIIGVA 302
           NP+      +  + KL EL+  D G D+TFDC+G       A++ AC +G     I+ VA
Sbjct: 239 NPTH--TRAQNAIEKLKELSPKDHGFDYTFDCSGVQDTFNAAVKAACIQGH----IVNVA 292

Query: 303 AAG-QEISTRPFQLVTGR 319
             G + ++  P  +  G 
Sbjct: 293 IWGPKPVAFHPMDMTYGE 310

>YAL060W Chr1 (35155..36303) [1149 bp, 382 aa] {ON}
           BDH1NAD-dependent (R,R)-butanediol dehydrogenase,
           catalyzes oxidation of (R,R)-2,3-butanediol to
           (3R)-acetoin, oxidation of meso-butanediol to
           (3S)-acetoin, and reduction of acetoin; enhances use of
           2,3-butanediol as an aerobic carbon source
          Length = 382

 Score = 84.7 bits (208), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 78/278 (28%), Positives = 117/278 (42%), Gaps = 51/278 (18%)

Query: 37  EVRIRITYTAVCHTDAYT-LSGV-----DPE------GAFPSILGHEGAGVVESVGKGVT 84
           EV I +++  +C +D +  L G      D E       A P  +GHE +G+V  VG  VT
Sbjct: 28  EVIIDVSWCGICGSDLHEYLDGPIFMPKDGECHKLSNAALPLAMGHEMSGIVSKVGPKVT 87

Query: 85  NVKPGDHVVALYTAEC--------------QKCKFCTSGKTNLCGSVRATQGKGVMPDGT 130
            VK GDHVV    + C              + C  C  G  NLC       G GV+  G 
Sbjct: 88  KVKVGDHVVVDAASSCADLHCWPHSKFYNSKPCDACQRGSENLCTHA-GFVGLGVISGG- 145

Query: 131 SRFRTKNGESILHFMGCSTFSQYTXXXXXXXXXXXXQAPLDRICLLGCGVTTGYGAAIKT 190
                              F++              + PLD   L+     T +  A+K 
Sbjct: 146 -------------------FAEQVVVSQHHIIPVPKEIPLDVAALVEPLSVTWH--AVKI 184

Query: 191 ANVQKGDTVAVFGAGTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFGATDFVNPSKD 250
           +  +KG +  V GAG +GL  +   K  GAS+I+V +I +++ + A   G   F NPSK 
Sbjct: 185 SGFKKGSSALVLGAGPIGLCTILVLKGMGASKIVVSEIAERRIEMAKKLGVEVF-NPSKH 243

Query: 251 LKEGETIVSKLIELTDGGLDFTFDCTGNTKVMRDALEA 288
             +   I+  L +  D G D+++DC+G       +L+A
Sbjct: 244 GHKSIEILRGLTKSHD-GFDYSYDCSGIQVTFETSLKA 280

>TBLA0A04290 Chr1 (1063289..1064476) [1188 bp, 395 aa] {ON} Anc_7.3
           YAL060W
          Length = 395

 Score = 82.4 bits (202), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 79/279 (28%), Positives = 113/279 (40%), Gaps = 53/279 (18%)

Query: 37  EVRIRITYTAVCHTD--AYTLSGV----DPE------GAFPSILGHEGAGVVESVGKGVT 84
           E+ I I++  +C TD   YT   +    D E         P  +GHE AGVV  VG GV 
Sbjct: 28  ELMIDISWCGICGTDLKEYTEGAIFFPNDGECHQISGEPLPQAMGHEMAGVVSRVGPGVK 87

Query: 85  NVKPGDHVVALYTAECQK--------------CKFCTSGKTNLCGSVRATQGKGVMPDGT 130
             K GDHVV   T  C+               C  C  G  N+C  +    G GV   G 
Sbjct: 88  KFKVGDHVVVEPTGTCKDRYRWKNSPSKNDDMCNACKKGYYNICSKL-GLCGAGVQSGGF 146

Query: 131 SRFRTKNGESILHFMGCSTFSQYTXXXXXXXXXXXXQAPLDRICLLGCGVTTGYGAAIKT 190
           +  R    ES  H                         PLD   L+       +  A++ 
Sbjct: 147 AE-RVVMNESHCH-------------------KVPDDLPLDIAALIQPIAVCWH--ALRI 184

Query: 191 ANVQKGDTVAVFGAGTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFGATDFVNPSKD 250
            N +KG +  V G+G +GL ++      G + I+V +    ++ +A + GAT F +PS  
Sbjct: 185 CNFKKGSSALVVGSGPIGLGIILALHGHGCTDIVVSEPAKIRRDFAKELGATVF-DPSS- 242

Query: 251 LKEGETIVSKLIELTDG--GLDFTFDCTGNTKVMRDALE 287
           L   E  +  L  +  G  G D+TFDC+GN      ++E
Sbjct: 243 LPTHEESIKYLRSIAPGGDGFDYTFDCSGNQYTFNASIE 281

>TDEL0F03190 Chr6 (583849..584904) [1056 bp, 351 aa] {ON}  possible
           pseudogene; NNN added to avoid internal stop codon
          Length = 351

 Score = 81.6 bits (200), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 74/265 (27%), Positives = 115/265 (43%), Gaps = 32/265 (12%)

Query: 8   PITCLAAVAYEAGKPLTVEEIIVEPPKAHEVRIRITYTAVCHTDAYTLSGVDP-EGAFPS 66
           P T  A V    G  L  ++I V  P+ +E+ I + Y+ VCHTD +   G  P     P 
Sbjct: 6   PKTQKAVVFDTNGGELQYKDIPVPEPQPNELLINVKYSGVCHTDLHAWKGDWPLPTKLPL 65

Query: 67  ILGHEGAGVVESVGKGV-TNVKPGDHV-VALYTAECQKCKFCTSGKTNLCGSVRATQGKG 124
           + GHEGAG+V + G  V    + GD   +      C  C++C     + C          
Sbjct: 66  VGGHEGAGIVVAKGSMVXXGWEIGDLAGIKWLNGSCMSCEYCEKANESNC---------- 115

Query: 125 VMPDGTSRFRTKNGESILHFMGCSTFSQYTXXXXXXXXXXXXQAPLDRICLLGCGVTTGY 184
             P       T +G          +F QY                L  +  + C   T Y
Sbjct: 116 --PQADLSGYTHDG----------SFQQYATADAVQAARVPKGTDLAEVAPILCAGITVY 163

Query: 185 GAAIKTANVQKGDTVAVFGA-GTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFGATD 243
             A+K+AN++ G+ VA+ GA G +G   VQ AKA G  R++ +D  D+K +     G   
Sbjct: 164 -KALKSANLRAGEWVAISGASGGLGSLAVQYAKAMG-YRVLGIDGGDEKAKLFKQLGGEY 221

Query: 244 FVNPSKDLKEGETIVSKLIELTDGG 268
           F+    D  + + +++++I+ TDGG
Sbjct: 222 FI----DFTKSKDVIAEVIKATDGG 242

>KNAG0K01040 Chr11 complement(204636..205811) [1176 bp, 391 aa] {ON}
           
          Length = 391

 Score = 82.0 bits (201), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 70/305 (22%), Positives = 117/305 (38%), Gaps = 51/305 (16%)

Query: 37  EVRIRITYTAVCHTDAYTLS---------GVDPE---GAFPSILGHEGAGVVESVGKGVT 84
           E+ I I +  +C TD +  +         G   E      P  +GHE AG+V  VG GVT
Sbjct: 28  ELLIDIIFCGICGTDLHEYTDGPIFFPSDGHKHEISNNELPQAMGHEMAGIVREVGSGVT 87

Query: 85  NVKPGDHVVALYTAEC--------------QKCKFCTSGKTNLCGSVRATQGKGVMPDGT 130
             K GDHV    T  C              +KC  C  G  N+C  +    G GV   G 
Sbjct: 88  QFKVGDHVSVEPTGTCRDRYRWPEAPGVNKEKCAACKRGMYNVCSHL-GLIGNGVQSGG- 145

Query: 131 SRFRTKNGESILHFMGCSTFSQYTXXXXXXXXXXXXQAPLDRICLLGCGVTTGYGAAIKT 190
                              F++                P++ + L+     + +  A++ 
Sbjct: 146 -------------------FAERVVINESHCYKLPNHIPMEVVALVQPIAVSWH--AVRV 184

Query: 191 ANVQKGDTVAVFGAGTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFGATDFVNPSKD 250
           +  + G +V + G G +GLS +      G + I+V +    ++  A   GA  + +P + 
Sbjct: 185 SKFKPGSSVLILGGGPIGLSTILALNGHGCTEIVVSEPAKIRRDLAEKMGAVVY-DPMQH 243

Query: 251 LKEGETIVSKLIELTDGGLDFTFDCTGNTKVMRDALEACHKGWGQSIIIGVAAAGQEIST 310
             E      + +     G D+ FDC+G    +R ++E C    G ++ + + A G+ I  
Sbjct: 244 SYEENIKYLRALAPDKDGFDYCFDCSGTPATLRSSIE-CLTFRGTAVNVAMWATGKPIDF 302

Query: 311 RPFQL 315
            P  +
Sbjct: 303 FPMDI 307

>Smik_1.6 Chr1 (18115..19263) [1149 bp, 382 aa] {ON} YAL060W (REAL)
          Length = 382

 Score = 81.6 bits (200), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 74/278 (26%), Positives = 119/278 (42%), Gaps = 51/278 (18%)

Query: 37  EVRIRITYTAVCHTDAYT-LSGV-----DPE------GAFPSILGHEGAGVVESVGKGVT 84
           EV I +++  +C +D +  L G      D E         P  +GHE +G+V  VG  VT
Sbjct: 28  EVLIDVSWCGICGSDLHEYLDGPIFMPKDGECHALSNAGLPLAMGHEMSGIVAEVGPKVT 87

Query: 85  NVKPGDHVVALYTAEC--------------QKCKFCTSGKTNLCGSVRATQGKGVMPDGT 130
            VK GDHVV    + C              + C+ C  G  NLC +     G GV+  G 
Sbjct: 88  KVKVGDHVVVDAASSCADLHCWPQSKHYSSKPCEACKKGSENLC-THGGFIGLGVISGG- 145

Query: 131 SRFRTKNGESILHFMGCSTFSQYTXXXXXXXXXXXXQAPLDRICLLGCGVTTGYGAAIKT 190
                              F++              + PLD   L+     T +  A+K 
Sbjct: 146 -------------------FAEQVAVSEHHIIPVPKEIPLDVAALVEPLSVTWH--AVKI 184

Query: 191 ANVQKGDTVAVFGAGTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFGATDFVNPSKD 250
           +  +KG +  V GAG +GL  +   K  GA +I+V ++ +++ + A + G   F NPSK 
Sbjct: 185 SGFKKGSSALVLGAGPIGLCTILVLKGMGAGKIVVSEVAERRIEMAKNLGVEVF-NPSKH 243

Query: 251 LKEGETIVSKLIELTDGGLDFTFDCTGNTKVMRDALEA 288
            ++   ++  L +  D G D+++DC+G       +L+A
Sbjct: 244 GQKSIEVLRGLTKSHD-GFDYSYDCSGIQVTFETSLKA 280

>ABR229C Chr2 complement(831895..832956) [1062 bp, 353 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR070C
           (XYL2)
          Length = 353

 Score = 81.3 bits (199), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 96/362 (26%), Positives = 144/362 (39%), Gaps = 51/362 (14%)

Query: 14  AVAYEAGKPLTVEEIIVEPPKAHEVRIRITYTAVCHTDA-YTLSGVDPEGAF----PSIL 68
           A+ YE  +P+ V    +E P  H V+++I  T +C +D  Y L G    G F    P +L
Sbjct: 16  AIVYE-HRPVPV----IEDP--HYVKVKIEKTGICGSDVHYYLHGSI--GPFVVRSPMVL 66

Query: 69  GHEGAGVVESVGKGVTNVKPGDHVVALYTAECQKCKFCTSGKTNLCGSVRATQGKGVMPD 128
           GHE +G V  VG  VT V+ GD V        +  +   SG  NLC  +R          
Sbjct: 67  GHESSGTVVEVGSDVTRVRIGDRVAIEPGVPSRYSEETKSGHYNLCREMRFA-------- 118

Query: 129 GTSRFRTKNGESILHFMGCSTFSQYTXXXXXXXXXXXXQAPLDRICLLGCGVTTGYGAAI 188
            T  +   +G  + +++    F                + P D + L    +      A+
Sbjct: 119 ATPPY---DGTLVKYYISPEDF--------------LVKLP-DSVSLEEGALCEPLAVAV 160

Query: 189 ---KTANVQKGDTVAVFGAGTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFGATDFV 245
              + A  Q    V VFGAG VGL     AKA GA+ + +VDI+  K   A   G T  V
Sbjct: 161 HANRLAGTQFPSRVVVFGAGPVGLLTASVAKAFGATTVAIVDISKHKLCVAPALGVTHPV 220

Query: 246 NPSKDLKEGETIVSKLIELTDGGLDFTFDCTGNTKVMRDALEACHKGWGQSIIIGVAAAG 305
           + S D    E + +KL       +D  FDC+G    +  A+  C  G      + V ++ 
Sbjct: 221 D-SSDCSSPEALANKLRAELRSDVDIAFDCSGAEICIAAAVLICRPGGTH---VQVGSSR 276

Query: 306 QEISTRPFQLVTGRVWKGSAFGGIK-GRSEMGGLVSDYMDGQLKVDEFITHRRPFTEINA 364
             +S   F L    V +    G  +    +    V      ++     +THR PF     
Sbjct: 277 DYVS---FPLAEATVKQLRILGSFRYAAGDYATAVELLASKRVDAARLVTHRFPFDRAVE 333

Query: 365 AF 366
           A+
Sbjct: 334 AY 335

>Suva_10.154 Chr10 complement(275737..276807) [1071 bp, 356 aa] {ON}
           YLR070C (REAL)
          Length = 356

 Score = 81.3 bits (199), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 108/389 (27%), Positives = 166/389 (42%), Gaps = 65/389 (16%)

Query: 13  AAVAYEAGKPLTVEEIIVEPPKAHEVRIRITYTAVCHTDA-YTLSGVDPEGAF--PSILG 69
           A V  + GK +     I +   A++V ++I  T +C +D  Y   G         P +LG
Sbjct: 9   AVVLEQPGKIVLTNVNIPKISDANDVIVQIKATGICGSDIHYYTHGRISHFVVKSPMVLG 68

Query: 70  HEGAGVVESVGKGVTNVKPGDHVVALYTAECQKCKFCTSGKTNLCGSVRATQGKGVMPDG 129
           HE +GVV  +G  V  +K GD V        +       G+ NL   ++         DG
Sbjct: 69  HESSGVVVLIGDNVKTLKVGDRVALEPGFPNRFSSELKEGRYNLDPDLKFAATPPY--DG 126

Query: 130 TSRFRTKNGESILHFMGCSTFSQYTXXXXXXXXXXXXQAPLDRICLLGCGVTTGYGA--- 186
           T                    ++Y             +AP D +  +   V+   GA   
Sbjct: 127 T-------------------LTKY------------YRAPKDFVYKIPDHVSFEEGALME 155

Query: 187 -------AIKTANVQKGDTVAVFGAGTVGLSVVQGAKARGASRIIVVDINDQKKQWASDF 239
                  A + A ++ G    VFGAG VGL   + A   GA+ ++ VD+++ K + A  F
Sbjct: 156 PLSVAVHANRLAKMRFGARCVVFGAGPVGLLTGKVASVFGATDVVFVDLSETKLERAKQF 215

Query: 240 GATDFVNPSKDLKEG---ETIVSKLIELTDGGLDFTFDCTGNTKVMRDALEACHKGWGQS 296
           GAT  VN S DL +G   ET++ K I     G D  F+C+G    +R  +E C  G G  
Sbjct: 216 GATHMVN-SGDLPQGVSAETVIRKAI--GKKGADVVFECSGAQPCIRTGIEVCKAG-GTY 271

Query: 297 IIIGVAAAGQEISTRPFQLVTGR--VWKGSAFGGIKG-RSEMGGLVSDYMDGQLKVDEFI 353
           + +G+   GQE    P   +  +   ++GS F   +G  S+   LVS    G+L +   I
Sbjct: 272 VQVGM---GQEEIQFPISKIPAKEITFQGS-FRYCQGDYSDSIELVS---SGKLSLKPLI 324

Query: 354 THRRPFTEINAAFDDL--HHGDCLRTVLD 380
           T R  F E   AFD+   H  D ++T+++
Sbjct: 325 TRRYQFKEAIEAFDENRDHPLDNVKTIIE 353

>KLLA0F00506g Chr6 complement(36518..37675) [1158 bp, 385 aa] {ON}
           similar to uniprot|P39714 Saccharomyces cerevisiae
           YAL060W BDH1 NAD-dependent (2R 3R)-2 3-butanediol
           dehydrogenase
          Length = 385

 Score = 81.6 bits (200), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 72/279 (25%), Positives = 117/279 (41%), Gaps = 53/279 (18%)

Query: 25  VEEIIVEPPKAHEVRIRITYTAVCHTDAYT-LSG--VDPEGA---------FPSILGHEG 72
           +EE ++E      + I +++  +C +D +  L G    PE            P  +GHE 
Sbjct: 18  LEEPVIETDDG--IEIEVSWCGICGSDLHEYLDGPIFFPEDGKVHDVSGLGLPQAMGHEM 75

Query: 73  AGVVESVGKGVTNVKPGDHVVALYTAEC--------------QKCKFCTSGKTNLCGSVR 118
           +G+V  VG  VTN+K GDHVV   T  C               +C  C  G  N C  + 
Sbjct: 76  SGIVSKVGPKVTNIKAGDHVVVEATGTCLDHYTWPNAAHAKDAECAACQRGFYNCCAHL- 134

Query: 119 ATQGKGVMPDGTSRFRTKNGESILHFMGCSTFSQYTXXXXXXXXXXXXQAPLDRICLLGC 178
              G GV   G                    F++                PLD   L+  
Sbjct: 135 GFMGLGVHSGG--------------------FAEKVVVSEKHVVKIPNTLPLDVAALVEP 174

Query: 179 GVTTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKARGASRIIVVDINDQKKQWASD 238
              + +  A++ + +QKG +  V GAG +GL+ +   +  GAS+I+V +  + ++  A+ 
Sbjct: 175 ISVSWH--AVRISKLQKGQSALVLGAGPIGLATILALQGHGASKIVVSEPAEIRRNQAAK 232

Query: 239 FGATDFVNPSKDLKEGETIVSKLIELTDGGLDFTFDCTG 277
            G   F +PS+  ++   I+ KL    + G DF +DC+G
Sbjct: 233 LGVETF-DPSEHKEDAVNILKKLAPGGE-GFDFAYDCSG 269

>Kwal_55.20564 s55 complement(459253..459903) [651 bp, 216 aa] {ON}
           YOL086C (ADH1) - Alcohol dehydrogenase [contig 146] FULL
          Length = 216

 Score = 78.2 bits (191), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 67/230 (29%), Positives = 100/230 (43%), Gaps = 27/230 (11%)

Query: 8   PITCLAAVAYEAGKPLTVEEIIVEPPKAHEVRIRITYTAVCHTDAYTLSGVDP-EGAFPS 66
           P T  A V    G  L  ++I V  P + E+ I + Y+ VCHTD +   G  P     P 
Sbjct: 4   PKTQKAIVFASNGGELEYKDIPVPKPSSTEILINVKYSGVCHTDLHAWKGDWPLPTKLPL 63

Query: 67  ILGHEGAGVVESVGKGVTNVKPGDHV-VALYTAECQKCKFCTSGKTNLCGSVRATQGKGV 125
           + GHEGAGVV ++G+ V   K GD   +      C  C++C  G  + C           
Sbjct: 64  VGGHEGAGVVVALGENVKGWKVGDLAGIKWLNGSCMACEYCELGNESNC----------- 112

Query: 126 MPDGTSRFRTKNGESILHFMGCSTFSQYTXXXXXXXXXXXXQAPLDRICLLGCGVTTGYG 185
            P       T +G          +F QY                L ++  + C   T Y 
Sbjct: 113 -PHADLSGYTHDG----------SFQQYATADAVQAAKIPQGTDLAQVAPILCAGITVY- 160

Query: 186 AAIKTANVQKGDTVAVFGA-GTVGLSVVQGAKARGASRIIVVDINDQKKQ 234
            A+K+A+++ G  VA+ GA G +G   VQ A+A G  R++ +D  D K++
Sbjct: 161 KALKSADLKAGQWVAISGACGGLGSLAVQYARAMG-YRVLGIDGGDDKRK 209

>KLTH0A00418g Chr1 complement(34685..35755) [1071 bp, 356 aa] {ON}
           similar to uniprot|P00331 Saccharomyces cerevisiae
           YMR303C ADH2 Glucose-repressible alcohol dehydrogenase
           II involved in the production of certain carboxylate
           esters
          Length = 356

 Score = 80.5 bits (197), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 70/261 (26%), Positives = 115/261 (44%), Gaps = 31/261 (11%)

Query: 8   PITCLAAVAYEAGKPLTVEEIIVEPPKAHEVRIRITYTAVCHTDAYTLSGVDP-EGAFPS 66
           P+T  A +  +    L ++ I V+ PKA+E+ I + ++ VCH+D +   G  P +   P 
Sbjct: 10  PLTQRAVIFKKHSGKLELKSIEVQSPKANELLINVKFSGVCHSDLHAWKGDWPTKTKLPL 69

Query: 67  ILGHEGAGVVESVGKGVTNVKPGDHV-VALYTAECQKCKFCTSGKTNLCGSVRATQGKGV 125
           + GHEGAG+V ++G  V   K GD+  +    + C  C+ C       C     +   G 
Sbjct: 70  VGGHEGAGIVVAMGASVRGWKIGDYAGIKWLNSCCMSCEQCELSNEPNCAYADIS---GF 126

Query: 126 MPDGTSRFRTKNGESILHFMGCSTFSQYTXXXXXXXXXXXXQAPLDRICLLGCGVTTGYG 185
             DG                   +F QY                L  +  + C   T + 
Sbjct: 127 TRDG-------------------SFQQYATADAVQAARIPPGTNLAEVSPVLCAGITVF- 166

Query: 186 AAIKTANVQKGDTVAVFGA-GTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFGATDF 244
            A+KTAN+  G+ VA+ GA G +G   +Q AKA G S ++ +D   +K+   +D G   F
Sbjct: 167 KALKTANLTAGNWVAISGACGGLGSMAIQYAKAMGYS-VVGIDSGAEKEHLFNDLGGDVF 225

Query: 245 VNPSKDLKEGETIVSKLIELT 265
           +    D  + E +V +++  T
Sbjct: 226 L----DFSKSENLVPEVVSAT 242

>TDEL0H04460 Chr8 complement(769988..771136) [1149 bp, 382 aa] {ON}
           Anc_7.2 YAL061W
          Length = 382

 Score = 80.5 bits (197), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 76/278 (27%), Positives = 110/278 (39%), Gaps = 56/278 (20%)

Query: 37  EVRIRITYTAVCHTDAYTLS----------GVDPEGA--FPSILGHEGAGVVESVGKGVT 84
           EV I +++  +C TD +  S          G  P      P  +GHE +G+V  +G  VT
Sbjct: 28  EVLIEVSWAGICGTDLHEYSDGPIFMPQDGGSHPLSGKKLPQPMGHEMSGIVSKIGSKVT 87

Query: 85  NVKPGDHVVALYTAEC--------------QKCKFCTSGKTNLCGSVRATQGKGVMPDGT 130
            VK GDHVV      C              + C  C  G  N+C     T G G    G 
Sbjct: 88  KVKVGDHVVVEAGCSCMDVKRWKESPLKGGKTCSACEKGLVNICAHACFT-GLGTSGGG- 145

Query: 131 SRFRTKNGESILHFMGCSTFSQYTXXXXXXXXXXXXQAPLDRICLLGCGVTTGYGAAIKT 190
                              F++                PLD   L+     T + A  K 
Sbjct: 146 -------------------FAERLTVSQDHCIPIPKDLPLDVAALVEPLSVTWHAA--KV 184

Query: 191 ANVQKGDTVAVFGAGTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFGATDFVNPSKD 250
           A  QKG T  V GAG +GL+ +   K  GAS+I+V ++   ++  A+  G   F NP+  
Sbjct: 185 AGFQKGQTACVLGAGPIGLATILTLKGLGASKIVVSELAQIRRDMAASMGVEVF-NPA-- 241

Query: 251 LKEGETIVSKLIELTDG--GLDFTFDCTGNTKVMRDAL 286
             E +  +++L ++ +G  G D  FDC+G       AL
Sbjct: 242 --EHKDAIAELRKIPEGATGFDAAFDCSGVKATFNTAL 277

>ZYRO0F02552g Chr6 (203037..204092) [1056 bp, 351 aa] {ON} similar
           to uniprot|Q07786 Saccharomyces cerevisiae YDL246C SOR2
           Protein of unknown function computational analysis of
           large-scale protein-protein interaction data suggests a
           possible role in fructose or mannose metabolism
          Length = 351

 Score = 79.7 bits (195), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 98/354 (27%), Positives = 151/354 (42%), Gaps = 45/354 (12%)

Query: 36  HEVRIRITYTAVCHTDA--YTLSGVDPEGAF----PSILGHEGAGVVESVGKGVTNVKPG 89
           H V++ I  T +C +D   YT   +   G F    P +LGHE +G+V  VG  VTNVK G
Sbjct: 29  HYVKLHIKATGICGSDVHYYTQGAI---GQFVVKSPMVLGHESSGIVAEVGSAVTNVKVG 85

Query: 90  DHVVALYTAECQKCKFCTSGKTNLCGSVRATQGKGVMPDGTSRFRTKNGESILHFMGCST 149
           D V        +      SG  NLC  +          DGT    TK      +++    
Sbjct: 86  DRVAIEPGIPSRYSDETMSGNYNLCPHMVFAATPPY--DGT---LTK------YYLAPED 134

Query: 150 FSQYTXXXXXXXXXXXXQAPLDRICLLGCGVTTGYGAAIKTANVQKGDTVAVFGAGTVGL 209
           F  Y               P+        GV      A K A  + G  V V GAG VGL
Sbjct: 135 FV-YKMPDHLSFEEGALAEPMS------VGVH-----ANKLAGTRFGSKVLVSGAGPVGL 182

Query: 210 SVVQGAKARGASRIIVVDINDQKKQWASDFGATDFVNPSKDLKEGETIVSKLIELTDGGL 269
                A+A GA+ ++ VDI ++K + +  FGAT  V+ S D    E  VS++ ++  G L
Sbjct: 183 LAGAVARAFGATEVVFVDIAEEKLERSKQFGATHTVSSSSD---EERFVSEVSKVLGGDL 239

Query: 270 -DFTFDCTGNTKVMRDALEACHKGWGQSIIIGVAAAGQEISTRPFQLV-TGRVWKGSAFG 327
            +   +C+G    +R  ++AC K  G  + +G+   G++    P   V +  +     F 
Sbjct: 240 PNIVLECSGAQPAIRCGVKAC-KAGGHYVQVGM---GKDDVNFPISAVGSKEITFHGCFR 295

Query: 328 GIKGRSEMGGLVSDYMDGQLKVDEFITHRRPFTEINAA--FDDLHHGDCLRTVL 379
             KG  +    V+    G++     I+HR  F +   A  F+  H  + ++T++
Sbjct: 296 YKKG--DFADSVALLSSGRINGKPLISHRFAFDKAPEAYKFNAEHGNEVVKTII 347

>YLR070C Chr12 complement(274141..275211) [1071 bp, 356 aa] {ON}
           XYL2Xylitol dehydrogenase, converts xylitol to
           D-xylulose; expression induced by xylose, even though
           this pentose sugar is not well utilized by S.
           cerevisiae; null mutant has cell wall defect
          Length = 356

 Score = 79.3 bits (194), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 95/353 (26%), Positives = 154/353 (43%), Gaps = 39/353 (11%)

Query: 36  HEVRIRITYTAVCHTDAYTLSG---VDPEGAFPSILGHEGAGVVESVGKGVTNVKPGDHV 92
           +EV I+I  T +C +D +  +     +     P +LGHE +G+V  +G+ V  +K GD V
Sbjct: 32  NEVIIQIKATGICGSDIHYYTHGRIANYVVESPMVLGHESSGIVALIGENVKTLKVGDRV 91

Query: 93  VALYTAECQKCKFCTSGKTNLCGSVRATQGKGVMPDGTSRFRTKNGESILHFMGCSTFSQ 152
                   +       G+ NL  +++         DGT    TK  +++  F+       
Sbjct: 92  ALEPGIPDRFSPEMKEGRYNLDPNLKFAATPPF--DGT---LTKYYKTMKDFV------- 139

Query: 153 YTXXXXXXXXXXXXQAPLDRICLLGCGVTTGYGAAIKTANVQKGDTVAVFGAGTVGLSVV 212
           Y               PL                A K A ++ G    VFGAG +GL   
Sbjct: 140 YKLPDDVSFEEGALIEPLSVAI-----------HANKLAKIKFGARCVVFGAGPIGLLAG 188

Query: 213 QGAKARGASRIIVVDINDQKKQWASDFGATDFVNPSKDLKEGETIVSKLIE-LTDGGLDF 271
           + A   GA+ ++ VD+ + K + A  FGAT  VN S DL  G T+ S + + +   G D 
Sbjct: 189 KVASVFGAADVVFVDLLENKLETARQFGATHIVN-SGDLPHGVTVDSVIKKAIGKKGADV 247

Query: 272 TFDCTGNTKVMRDALEACHKGWGQSIIIGVAAAGQEISTRPFQLV-TGRVWKGSAFGGIK 330
            F+C+G    +R  +E C  G G  + +G+   GQE    P  ++ T  +     F   +
Sbjct: 248 VFECSGAEPCVRAGIEVCKAG-GTIVQVGM---GQEEIQFPISIIPTKELTFQGCFRYCQ 303

Query: 331 G-RSEMGGLVSDYMDGQLKVDEFITHRRPFTEINAAFDDLHHG--DCLRTVLD 380
           G  S+   LVS     +L +  FITHR  F +   AF++  H   + ++T+++
Sbjct: 304 GDYSDSIELVSSR---KLSLKPFITHRYSFKDAVEAFEETSHHPLNNIKTIIE 353

>Skud_1.3 Chr1 (11174..12322) [1149 bp, 382 aa] {ON} YAL060W (REAL)
          Length = 382

 Score = 79.7 bits (195), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 71/278 (25%), Positives = 114/278 (41%), Gaps = 51/278 (18%)

Query: 37  EVRIRITYTAVC------HTDAYTLSGVDPE------GAFPSILGHEGAGVVESVGKGVT 84
           EV I +++  +C      +TD       D E       A P  +GHE +G++  VG  VT
Sbjct: 28  EVIIDVSWCGICGSDLHEYTDGPIFMPKDGECHALSNAALPLAMGHEMSGIIAKVGPRVT 87

Query: 85  NVKPGDHVVALYTAEC--------------QKCKFCTSGKTNLCGSVRATQGKGVMPDGT 130
            VK GDHVV    + C              + C+ C  G  NLC       G GV+  G 
Sbjct: 88  KVKVGDHVVVDAGSSCADLHCWPHSKYYNSKPCEACKKGSENLCAH-SGFVGLGVISGG- 145

Query: 131 SRFRTKNGESILHFMGCSTFSQYTXXXXXXXXXXXXQAPLDRICLLGCGVTTGYGAAIKT 190
                              F++              + PLD   L+     T +  A+K 
Sbjct: 146 -------------------FAEQVVVSEHHIIPVPKEIPLDVAALVEPLSVTWH--AVKL 184

Query: 191 ANVQKGDTVAVFGAGTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFGATDFVNPSKD 250
           +  +KG +  V GAG +GL  +   K  GA +I+V ++ +++ + A       F NP++ 
Sbjct: 185 SGFKKGSSALVLGAGPIGLCTILVLKGMGAGKIVVSEVAERRLKMAKSLDVEVF-NPAQH 243

Query: 251 LKEGETIVSKLIELTDGGLDFTFDCTGNTKVMRDALEA 288
             +   ++  L E  D G D+++DC+G       +L+A
Sbjct: 244 GHKSVELLRGLTESHD-GFDYSYDCSGIQATFETSLKA 280

>Kwal_26.6739 s26 (46044..47192) [1149 bp, 382 aa] {ON} YAL060W
           (BDH1) - (2R,3R)-2,3-butanediol dehydrogenase [contig
           44] FULL
          Length = 382

 Score = 79.0 bits (193), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 78/315 (24%), Positives = 126/315 (40%), Gaps = 73/315 (23%)

Query: 12  LAAVAYEAGKPLTVEEIIVEP--PKAHEVRIRITYTAVCHTD----------------AY 53
           + A+AY   K +     + EP    + +V+I I++  VC +D                 +
Sbjct: 1   MRALAYFGQKDIRFTNDLPEPTIQASDDVQIAISWCGVCGSDLHEYLDGPIFFPKDGEKH 60

Query: 54  TLSGVDPEGAFPSILGHEGAGVVESVGKGVTNVKPGDHVVALYTAEC------------- 100
            +SGV      P  +GHE +GVV  +G GV N+K GDHVV   T  C             
Sbjct: 61  AMSGV----GLPQAMGHEMSGVVAKIGPGVKNIKVGDHVVVETTGTCKDRYRWPDVKHAS 116

Query: 101 -QKCKFCTSGKTNLCGSVRATQGKGVMPDGTSRFRTKNGESILHF--MGCST--FSQYTX 155
            ++C  C     N C                         S L F  +GC +  F++   
Sbjct: 117 DEECAACKKDFYNCC-------------------------SELGFCGLGCHSGGFAEKVV 151

Query: 156 XXXXXXXXXXXQAPLDRICLLGCGVTTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGA 215
                        PLD   L+     + +  A++ + ++ G +  + GAG +GL+ V   
Sbjct: 152 ISEKHVVKVPKDIPLDVAALVEPLAVSWH--AVRISQLKAGQSALILGAGPIGLATVLAL 209

Query: 216 KARGASRIIVVDINDQKKQWASDFGATDFVNPSKDLKEGETIVSKLIELTDG--GLDFTF 273
           +  GA  I+V + +  +++ A   GA  F NP      G+  V +L ++  G  G DF++
Sbjct: 210 QGHGAGTIVVSEPSASRRKQAEALGALTF-NP---FDHGDKAVDELRKIPPGSDGFDFSY 265

Query: 274 DCTGNTKVMRDALEA 288
           DC+G        L A
Sbjct: 266 DCSGLKATFNTGLYA 280

>NDAI0H02050 Chr8 complement(500914..502071) [1158 bp, 385 aa] {ON} 
          Length = 385

 Score = 78.6 bits (192), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 77/310 (24%), Positives = 128/310 (41%), Gaps = 60/310 (19%)

Query: 12  LAAVAYEAGKPLTVEEIIVEPP--KAHEVRIRITYTAVCHTDAYTLSG----------VD 59
           + AVAY     +     + EP      EV I ++Y  +C TD +  +            +
Sbjct: 1   MRAVAYYKKGDIHFSSTLPEPKINSPDEVLIEVSYCGICGTDLHEYTDGPIFFPKDGETN 60

Query: 60  PEG--AFPSILGHEGAGVVESVGKGVTNVKPGDHVVALYTAECQK--------------- 102
           P      P  +GHE +G V+++G  VT V+ GD VV      C+                
Sbjct: 61  PLSNIPLPQPMGHEFSGFVKAIGSNVTKVEVGDKVVVEAGCGCKDVHRWPDSKLYEKRKD 120

Query: 103 --CKFCTSGKTNLCGSVRATQGKGVMPDGTSRFRTKNGESILHFMGCSTFSQYTXXXXXX 160
             C  C +G  N C +   T G GV+                       F++        
Sbjct: 121 TFCSACENGIDNCCENYDFT-GLGVV--------------------GGAFAERVVVGERH 159

Query: 161 XXXXXXQAPLDRICLLGCGVTTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKARGA 220
                 + P D   L+   ++  +  A++ +  +KG +  + GAG +GL+ +   KA GA
Sbjct: 160 IVKLPEEVPTDVGALVE-PISVAW-HAVRVSKFEKGKSALILGAGPIGLAAILALKAHGA 217

Query: 221 SRIIVVDINDQKKQWASDFGATDFVNPSKDLKEGETIVSKLIELTDG--GLDFTFDCTGN 278
           S+I+V ++ ++++  AS  G   F +PS   K G+  V++L  +  G  G D+ FDC+G 
Sbjct: 218 SKIVVSELAERRRILASKMGVEVF-DPS---KHGDNAVTELRNIPRGQHGFDYAFDCSGV 273

Query: 279 TKVMRDALEA 288
                 AL+A
Sbjct: 274 KATFNTALKA 283

>NCAS0J00300 Chr10 (43719..44792) [1074 bp, 357 aa] {ON} Anc_8.16
          Length = 357

 Score = 77.4 bits (189), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 76/279 (27%), Positives = 111/279 (39%), Gaps = 62/279 (22%)

Query: 36  HEVRIRITYTAVCHTDA--YTLSGVDPEGAF----PSILGHEGAGVVESVGKGVTNVKPG 89
           H V+++I  T +C +D   Y    +   G F    P +LGHE +G++  VG  V  +K G
Sbjct: 31  HWVKVQIKATGICGSDVHFYKYGSI---GDFVVKSPMVLGHESSGIIAEVGSAVKTLKVG 87

Query: 90  DHVVALYTAECQKCKFCTSGKTNLCGSVRATQGKGVMPDGTSRFRTKNGESILHFMGCS- 148
           D V        +  +   SG  NLC                           +HF     
Sbjct: 88  DRVALEPGYPSRYTEATMSGHYNLC-------------------------PFMHFAATPP 122

Query: 149 ---TFSQYTXXXXXXXXXXXXQAPLDRICLLGCGVTTGYGAAI----------KTANVQK 195
              T ++Y               P D +  L   V+   GA +          K A  + 
Sbjct: 123 CDGTLTKYYL------------TPFDFVYKLPDNVSYEEGALLEPLSVGVHANKQAGTRF 170

Query: 196 GDTVAVFGAGTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFGATDFVNPSKDLKEGE 255
           GD V VFGAG VGL     AK  GA +++ +D+ D+K + A  FGAT  +N SK     E
Sbjct: 171 GDKVVVFGAGPVGLLNGAVAKVFGALQVVFIDVVDEKLERAKHFGATAVINSSKLRINDE 230

Query: 256 TIVSKLIELTDGGL--DFTFDCTGNTKVMRDALEACHKG 292
             ++  I+   GG+  D   +CTG    +R  + A   G
Sbjct: 231 FELAVAIKEKLGGVDPDIVLECTGAEPCIRAGIRALKTG 269

>SAKL0D14872g Chr4 complement(1226093..1227244) [1152 bp, 383 aa]
           {ON} highly similar to gnl|GLV|KLLA0F00506g
           Kluyveromyces lactis KLLA0F00506g and similar to YAL060W
           uniprot|P39714 Saccharomyces cerevisiae YAL060W BDH1
           NAD- dependent (2R 3R)-2 3-butanediol dehydrogenase a
           zinc- containing medium-chain alcohol dehydrogenase
           produces 2 3- butanediol from acetoin during
           fermentation and allows using 2 3-butanediol as a carbon
           source during aerobic growth
          Length = 383

 Score = 76.6 bits (187), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 81/301 (26%), Positives = 129/301 (42%), Gaps = 44/301 (14%)

Query: 12  LAAVAYEAGKPLTVEEIIVEPP--KAHEVRIRITYTAVCHTDAYT-LSG---VDPEG--- 62
           + A+AY   K +     I +P     +E+ I I++  +C +D +  L G      EG   
Sbjct: 1   MRALAYFGKKDIHFSADIAKPEIGADNELEIDISWCGICGSDLHEYLDGPIFFPEEGKTH 60

Query: 63  -----AFPSILGHEGAGVVESVGKGVT-NVKPGDHVVALYTAEC---QKCKFCTSGKTNL 113
                  P  +GHE +G+V  VG GV  + K GDHVV   T  C    +     S K   
Sbjct: 61  GVSGIGLPQPMGHEMSGIVSKVGPGVKGDYKVGDHVVVEATCTCLDRYRWPKIESSKLPP 120

Query: 114 CGSVRATQGKGVMPDGTSRFRTKNGESILHFMGCST----FSQYTXXXXXXXXXXXXQAP 169
           C + +    +G+           N  + L F G       FS+              + P
Sbjct: 121 CSACK----RGIY----------NCCTHLGFCGLGAHGGGFSEKVVISEQHVIKIPKEIP 166

Query: 170 LDRICLLGCGVTTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKARGASRIIVVDIN 229
           LD I  L   ++  +  A+K +N++ G +  V GAG +GL+ +   +  GA +I+V +  
Sbjct: 167 LD-IAALVEPISVSW-HAVKISNLKPGQSALVLGAGPIGLATILALQGHGAGKIVVSEPA 224

Query: 230 DQKKQWASDFGATDFVNPSKDLKEGETIVSKLIELTDG--GLDFTFDCTGNTKVMRDALE 287
             +++ A+  G   F NP    + GE  V +L ++  G  G DF+FDC+G        L 
Sbjct: 225 QIRREQAAKLGVETF-NP---FEHGEKAVEELRKIPPGGDGFDFSFDCSGMKATFDTGLH 280

Query: 288 A 288
           A
Sbjct: 281 A 281

>KLLA0D05511g Chr4 complement(476363..477427) [1065 bp, 354 aa] {ON}
           similar to uniprot|P35497 Saccharomyces cerevisiae
           YJR159W SOR1 Sorbitol dehydrogenase expression is
           induced in the presence of sorbitol
          Length = 354

 Score = 76.3 bits (186), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 105/388 (27%), Positives = 164/388 (42%), Gaps = 64/388 (16%)

Query: 14  AVAYEAGKPLTVEEIIV-EPPKAHEVRIRITYTAVCHTDA--YTLSGVDPEGAF----PS 66
           AV  +    +T E+I   E   +H V+I +  T +C +D   YT   +   G F    P 
Sbjct: 7   AVVLQKKGEITFEDIPAPEITDSHYVKIHVKKTGICGSDIHYYTHGSI---GEFVVKKPM 63

Query: 67  ILGHEGAGVVESVGKGVTNVKPGDHVVALYTAECQKCKFCTSGKTNLCGSVRATQGKGVM 126
           +LGHE +GVV  VGK VT V+ GD V        +      SG  NLC  +         
Sbjct: 64  VLGHESSGVVVEVGKDVTLVQVGDRVAIEPGVPSRYSDETKSGHYNLCPHMAFA------ 117

Query: 127 PDGTSRFRTKNGESILHFMGCSTFSQYTXXXXXXXXXXXXQAPLDRICLLGCGVTTGYGA 186
              T  +   +G  + +++                      AP D +  L   V+   GA
Sbjct: 118 --ATPPY---DGTLVKYYL----------------------APEDFLVKLPDHVSFEEGA 150

Query: 187 ----------AIKTANVQKGDTVAVFGAGTVGLSVVQGAKARGASRIIVVDINDQKKQWA 236
                     A + A    G  V VFGAG VGL     A A GAS ++ VD+ + K + +
Sbjct: 151 CAEPLAVGVHANRLAETSFGKNVVVFGAGPVGLVTGAVAAAFGASAVVYVDVFENKLERS 210

Query: 237 SDFGATDFVNPSKDLKEGETIVSKLIELTDGGLDFTFDCTGNTKVMRDALEACHKGWGQS 296
            DFGAT+ +N +K   E E       EL     +   DC+G    +R A++   K  G  
Sbjct: 211 KDFGATNTINSTKYKSEDELTEVIKSELKGEQPEIAIDCSGAEICIRTAIKVL-KAGGSY 269

Query: 297 IIIGVAAAGQEISTRPFQLVTGRVWK--GSAFGGIKGRSEMGGLVSDYMDGQLKVDEFIT 354
           + +G+   G++    P  ++  +  +  GS             L+S   +G++ V + IT
Sbjct: 270 VQVGM---GKDNINFPIAMIGAKELRVLGSFRYYFNDYKIAVKLIS---EGKVNVKKMIT 323

Query: 355 HRRPFTEINAAFD-DLHHG-DCLRTVLD 380
           H   F E   A++ +L HG + ++T++D
Sbjct: 324 HTFKFEEAIDAYNFNLEHGSEVVKTMID 351

>Kpol_1049.18 s1049 complement(35191..36351) [1161 bp, 386 aa] {ON}
           complement(35191..36351) [1161 nt, 387 aa]
          Length = 386

 Score = 76.3 bits (186), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 75/291 (25%), Positives = 121/291 (41%), Gaps = 57/291 (19%)

Query: 30  VEPPKAH---EVRIRITYTAVCHTD--AYTLSGVD-PE---------GAFPSILGHEGAG 74
           ++ P  H   +V I I++  +C TD   YT   +  PE            P  +GHE +G
Sbjct: 18  LKEPHIHAEDDVIIDISWCGICGTDLKEYTDGAIFFPEDGCVNHISNNNLPQAMGHEISG 77

Query: 75  VVESVGKGVTNVKPGDHVVALYTAEC--------------QKCKFCTSGKTNLCGSVRAT 120
           ++ SVG G    K GDHVV   TA C                C+ C +G  N+C  +  T
Sbjct: 78  IISSVGPGCKKFKIGDHVVVEPTATCIDRYRWPNAPNRDTPMCEACRNGMPNICKYLGLT 137

Query: 121 QGKGVMPDGTSRFRTKNGESILHFMGCSTFSQYTXXXXXXXXXXXXQAPLDRICLLGCGV 180
            G GV   G +       + +++   C     +               PLD   L+    
Sbjct: 138 -GAGVEGGGFAE------KMVINEHHCHKIPHHM--------------PLDVASLIQPIS 176

Query: 181 TTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFG 240
              +  A+K ++ ++G +V + G G +GL  +   K  G   I+V +    +++ A   G
Sbjct: 177 VCWH--AVKVSHYKQGGSVLIVGGGPIGLGTILALKGFGCEDIVVSEPALIRRELAEKMG 234

Query: 241 ATDFVNPSKDLKEGETIVSKLIELTDG--GLDFTFDCTGNTKVMRDALEAC 289
           A  F   +  L   +  +  L E+  G  G D+TFDC+G    ++ A+E C
Sbjct: 235 ARVFDPSNMSL---DNSIKTLTEMAPGSQGFDYTFDCSGIPATLKVAIECC 282

>KAFR0I00160 Chr9 (33043..34200) [1158 bp, 385 aa] {ON} Anc_7.2
           YAL061W
          Length = 385

 Score = 76.3 bits (186), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 81/344 (23%), Positives = 133/344 (38%), Gaps = 58/344 (16%)

Query: 12  LAAVAYEAGKPLTVEEIIVEP--PKAHEVRIRITYTAVCHTDAYTLSGVD-----PE--- 61
           + A+AY A   +   + +VEP      E+ + I Y  +C TD +    +D     PE   
Sbjct: 1   MRALAYFAKGDIHFTKDLVEPKISTPDELILEINYCGICGTDLHEY--IDGPIFFPEDGE 58

Query: 62  ------GAFPSILGHEGAGVVESVGKGVTNVKPGDHVVALYTAECQK------------- 102
                    P  +GHE AG V  +G  VT  K GDHVV      C+              
Sbjct: 59  TNELSGSGLPQAMGHEIAGTVVKIGPKVTKFKVGDHVVVQPNGTCKDRYRWPHSPHVNKP 118

Query: 103 -CKFCTSGKTNLCGSVRATQGKGVMPDGTSRFRTKNGESILHFMGCSTFSQYTXXXXXXX 161
            C  C  G  N+C ++    G GV   G +     N                        
Sbjct: 119 WCSACKKGHYNVCSNL-GLIGNGVQSGGCAERMCINESHCF------------------- 158

Query: 162 XXXXXQAPLDRICLLGCGVTTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKARGAS 221
                  P+D   L+     + +  AIK A  ++G +V V G G +GL  +   +  G S
Sbjct: 159 -KVPKDMPMDIAALIQPIAVSWH--AIKVARFKRGGSVLVIGGGPIGLCTLLALQGHGCS 215

Query: 222 RIIVVDINDQKKQWASDFGATDFVNPSKDLKEGETIVSKLIELTDGGLDFTFDCTGNTKV 281
            I+V +    +++ A   GAT + +PS+   E      + + L   G D+ FD +G  + 
Sbjct: 216 DIVVSEPAKVRRELAERMGATTY-DPSQHNTEKNIQNLRKMILGGDGFDYVFDNSGTPET 274

Query: 282 MRDALEACHKGWGQSIIIGVAAAGQEISTRPFQLVT-GRVWKGS 324
           +  A+E C    G ++ + +    + +   P  +    +++ GS
Sbjct: 275 LETAIE-CLTVRGTAVNVAMWPPHKRVEFSPMAVTKEEKIYTGS 317

>SAKL0D14894g Chr4 complement(1230497..1231654) [1158 bp, 385 aa]
           {ON} similar to uniprot|P39713 Saccharomyces cerevisiae
           YAL061W putative polyol dehydrogenase
          Length = 385

 Score = 75.9 bits (185), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 77/307 (25%), Positives = 124/307 (40%), Gaps = 56/307 (18%)

Query: 12  LAAVAYEAGKPLTVEEIIVEP--PKAHEVRIRITYTAVCHTDAYTLSG---VDPE----- 61
           + A+AY   K +   + + EP      ++ I I +  +C TD +  +      PE     
Sbjct: 1   MRALAYFGQKDIRFTDELPEPVISADDDLIIDIAWCGICGTDLHEYTDGPIFFPEDGHTH 60

Query: 62  ----GAFPSILGHEGAGVVESVGKGVTNVKPGDHVVALYTAEC--------------QKC 103
                  P  +GHE AGVV  +G GV   + GDHVV   T+ C              + C
Sbjct: 61  DISGNGLPQAMGHEMAGVVSKIGPGVQGFEVGDHVVVEPTSTCLDRYRFPNSKHSGEEPC 120

Query: 104 KFCTSGKTNLCGSVRATQGKGVMPDGTSRFRTKNGESILHFMGCSTFSQYTXXXXXXXXX 163
             C  G  N+C  +    G GV   G S     N + ++                     
Sbjct: 121 AACKRGLYNICSHL-GLCGVGVQSGGFSERVVMNQKHVIKI------------------- 160

Query: 164 XXXQAPLDRICLLGCGVTTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKARGASRI 223
                PLD   L+     + +  AI+ + +  G +  V G G +GL  +   +A GAS+I
Sbjct: 161 -PKHIPLDVAALVQPLAVSWH--AIRISGLTAGKSALVVGGGPIGLGTILALQAYGASKI 217

Query: 224 IVVDINDQKKQWASDFGATDFVNPSKDLKEGETIVSKLIELTDG--GLDFTFDCTGNTKV 281
           +V +    +++ A   GA  F +P++   E    V  L ++  G  G D++FDC+G    
Sbjct: 218 VVSEPAKNRRELAKLMGAEVF-DPTE--WEEHEAVEYLRKVAPGGDGFDYSFDCSGLPVT 274

Query: 282 MRDALEA 288
            R ++ A
Sbjct: 275 FRASVHA 281

>Suva_1.7 Chr1 (12310..13458) [1149 bp, 382 aa] {ON} YAL060W (REAL)
          Length = 382

 Score = 75.9 bits (185), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 72/280 (25%), Positives = 113/280 (40%), Gaps = 55/280 (19%)

Query: 37  EVRIRITYTAVCHTDAYTLSG------VDPE------GAFPSILGHEGAGVVESVGKGVT 84
           EV + +++  +C +D +  S        D E         P  +GHE +G++  VG  VT
Sbjct: 28  EVILDVSWCGICGSDLHEYSDGPIFMPKDGECHSLSNAGLPQAMGHEMSGIIAKVGPKVT 87

Query: 85  NVKPGDHVVALYTAEC--------------QKCKFCTSGKTNLCGSVRATQGKGVMPDGT 130
            VK GDHVV    + C              + C  C  G  NLC       G GV+  G 
Sbjct: 88  KVKVGDHVVVQAGSSCADLHCWPHSKHYNSKPCDACKKGCENLCTHA-GFIGLGVISGG- 145

Query: 131 SRFRTKNGESILHFMGCSTFSQYTXXXXXXXXXXXXQAPLDRICLLGCGVTTGYGAAIKT 190
                              F++              + PLD   L+     T +  A++ 
Sbjct: 146 -------------------FAEQVVVSEHHIIPVPKEIPLDVAALVEPLSVTWH--AVRL 184

Query: 191 ANVQKGDTVAVFGAGTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFGATDFVNPSKD 250
           +  +KG +  V GAG +GL  +   K  GA +I+V ++ +++ + A   G   F +P   
Sbjct: 185 SGFKKGSSALVLGAGPIGLCTILVLKGMGAGQIVVSEVAERRMELARRLGVEIF-DPR-- 241

Query: 251 LKEGETIVSKLIELTDG--GLDFTFDCTGNTKVMRDALEA 288
            K GE  V  L  LT    G D+++DC+G       +L+A
Sbjct: 242 -KHGEKSVESLRALTKSHDGFDYSYDCSGIQATFDASLKA 280

>NCAS0A07670 Chr1 complement(1527273..1528592) [1320 bp, 439 aa]
           {ON} 
          Length = 439

 Score = 70.9 bits (172), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 69/305 (22%), Positives = 115/305 (37%), Gaps = 54/305 (17%)

Query: 12  LAAVAYEAGKPLTVEEIIVEP--PKAHEVRIRITYTAVCHTDAYTLSG------------ 57
           + A+AY     +     + EP      E+ I +++  +C TD +                
Sbjct: 40  MRALAYFGKNDIKFTNDLPEPTISAPDEMIIDVSWCGICGTDLHEFQDGPIFFPHDGCCH 99

Query: 58  -VDPEGAFPSILGHEGAGVVESVGKGVTNVKPGDHVVALYTAEC--------------QK 102
            +  EG  P  +GHE AG +   G GVT  K GD VV   T  C              + 
Sbjct: 100 EISGEG-LPQAMGHEIAGTIIECGPGVTKFKVGDRVVVEPTGTCKDRYRWPNSPNVDKEP 158

Query: 103 CKFCTSGKTNLCGSVRATQGKGVMPDGTSRFRTKNGESILHFMGCSTFSQYTXXXXXXXX 162
           C  C  G  N+C ++    G GV   G                    F++          
Sbjct: 159 CAACKKGLYNICSNL-GLVGAGVQSGG--------------------FAERLVMNERQCY 197

Query: 163 XXXXQAPLDRICLLGCGVTTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKARGASR 222
                  +D   L+     + +  A++ +  +KG +V + GAG +GL  +      G S 
Sbjct: 198 KVPDHMSMDVAALIQPIAVSWH--AVRVSKFKKGASVLIVGAGPIGLGTILALNGHGVSE 255

Query: 223 IIVVDINDQKKQWASDFGATDFVNPSKDLKEGETIVSKLIELTDGGLDFTFDCTGNTKVM 282
           ++V +    ++ +A   GA  +   +KD  E    +  +    D G D+ FDC+GN   +
Sbjct: 256 VVVSEPAKIRRDFAEKMGAIVYDPSAKDHDESIKYLRSIAPGGD-GFDYAFDCSGNPATL 314

Query: 283 RDALE 287
           + A+E
Sbjct: 315 KAAIE 319

>YAL061W Chr1 (33448..34701) [1254 bp, 417 aa] {ON}  BDH2Putative
           medium-chain alcohol dehydrogenase with similarity to
           BDH1; transcription induced by constitutively active
           PDR1 and PDR3
          Length = 417

 Score = 70.5 bits (171), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 75/279 (26%), Positives = 106/279 (37%), Gaps = 54/279 (19%)

Query: 37  EVRIRITYTAVCHTDAYTLSG---VDPE---------GAFPSILGHEGAGVVESVGKGVT 84
           E+ I I +  +C TD +  +      PE            P  +GHE AG V  VG GV 
Sbjct: 28  ELVIDIEWCGICGTDLHEYTDGPIFFPEDGHTHEISHNPLPQAMGHEMAGTVLEVGPGVK 87

Query: 85  NVKPGDHVVALYTAECQK--------------CKFCTSGKTNLCGSVRATQGKGVMPDGT 130
           N+K GD VV   T  C+               C  C  G  N+C S     G GV   G 
Sbjct: 88  NLKVGDKVVVEPTGTCRDRYRWPLSPNVDKEWCAACKKGYYNIC-SYLGLCGAGVQSGGF 146

Query: 131 SRFRTKNGESILHFMGCSTFSQYTXXXXXXXXXXXXQAPLDRICLLGCGVTTGYGAAIKT 190
           +  R    ES  H      F                  PLD   L+       +  AI+ 
Sbjct: 147 AE-RVVMNES--HCYKVPDF-----------------VPLDVAALIQPLAVCWH--AIRV 184

Query: 191 ANVQKGDTVAVFGAGTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFGATDFVNPSKD 250
              + G T  + GAG +GL  +    A G   I+V +    +++ A   GA  +   +  
Sbjct: 185 CEFKAGSTALIIGAGPIGLGTILALNAAGCKDIVVSEPAKVRRELAEKMGARVYDPTAHA 244

Query: 251 LKEGETIVSKLIELTDG--GLDFTFDCTGNTKVMRDALE 287
            KE    +  L  + DG  G D+TFDC+G    +  A++
Sbjct: 245 AKES---IDYLRSIADGGDGFDYTFDCSGLEVTLNAAIQ 280

>YBR046C Chr2 complement(330507..331511) [1005 bp, 334 aa] {ON}
           ZTA1NADPH-dependent quinone reductase, GFP-tagged
           protein localizes to the cytoplasm and nucleus; has
           similarity to E. coli quinone oxidoreductase and to
           human zeta-crystallin
          Length = 334

 Score = 69.7 bits (169), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 71/244 (29%), Positives = 104/244 (42%), Gaps = 55/244 (22%)

Query: 36  HEVRIRITYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGVVESVGKGVTNVKPGDHVVAL 95
            E+ I+  YT V + ++Y   G+ P    P +LG E +G V + GKGVTN + GD V   
Sbjct: 36  EELLIKNKYTGVNYIESYFRKGIYPCEK-PYVLGREASGTVVAKGKGVTNFEVGDQV--- 91

Query: 96  YTAECQKCKFCTSGKTNLCGSVRATQGKGVMPDGTSRFRTKNGESILHFMGCSTFSQYTX 155
             A      F    K +  G V        +P GTS     + E  L+  G         
Sbjct: 92  --AYISNSTFAQYSKISSQGPVMK------LPKGTS-----DEELKLYAAGL-------- 130

Query: 156 XXXXXXXXXXXQAPLDRICLLGCGVTTGYGAAIKTANVQKGDTVAVFGA-GTVGLSVVQG 214
                                   V T      +  +V+KGD V +F A G VGL + Q 
Sbjct: 131 ----------------------LQVLTALSFTNEAYHVKKGDYVLLFAAAGGVGLILNQL 168

Query: 215 AKARGASRIIVVDINDQKKQWASDFGATDFVNPSKDLKEGETIVSKLIELTDG-GLDFTF 273
            K +GA  I V    D+K + A ++GA   +N SK     E I+ ++++ T+G G+D +F
Sbjct: 169 LKMKGAHTIAVAS-TDEKLKIAKEYGAEYLINASK-----EDILRQVLKFTNGKGVDASF 222

Query: 274 DCTG 277
           D  G
Sbjct: 223 DSVG 226

>KNAG0I00120 Chr9 (9352..10497) [1146 bp, 381 aa] {ON} 
          Length = 381

 Score = 68.2 bits (165), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 72/275 (26%), Positives = 110/275 (40%), Gaps = 41/275 (14%)

Query: 37  EVRIRITYTAVCHTDAYTLS------------GVDPEGAFPSILGHEGAGVVESVGKGVT 84
           E+ + + +  +C TD +  +             V    + P  +GHE +G V  VG  VT
Sbjct: 28  ELIVDVAFCGICGTDLHEYTDGPIFMPKDGEKNVLSNKSIPQAMGHEFSGYVAKVGPKVT 87

Query: 85  NVKPGDHVVALYTAEC---QKCKFCTSGKTNLCGSVRATQGKGVMPDGTSRFRTKNGESI 141
            VK GD VV   T  C    +       KT  C + +               R  N    
Sbjct: 88  KVKVGDRVVVEATCSCVDLHRWPESKHYKTPACNACKD--------------RCDNCCEY 133

Query: 142 LHFMGCST----FSQYTXXXXXXXXXXXXQAPLDRICLLGCGVTTGYGAAIKTANVQKGD 197
             FMG       F++                P+D   L+   ++  + AA + +    G 
Sbjct: 134 AGFMGLGVVGGAFAERIVTIEHHVVKLPDGFPMDVAALIE-PLSVAWHAA-RVSKFPPGK 191

Query: 198 TVAVFGAGTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFGATDFVNPSKDLKEGETI 257
           +  V GAG +GL+++   KA+GAS+IIV +    +++ A       F +PS     G+  
Sbjct: 192 SALVLGAGPIGLAMILVLKAQGASKIIVSEPATMRRELADRMHVETF-DPS---THGDKS 247

Query: 258 VSKLIELT-DG-GLDFTFDCTGNTKVMRDALEACH 290
           V+ L   T DG G DF FDC+G        L+A H
Sbjct: 248 VAMLRSKTFDGKGFDFAFDCSGVPATFNTGLQAAH 282

>Skud_1.2 Chr1 (9513..10766) [1254 bp, 417 aa] {ON} YAL061W (REAL)
          Length = 417

 Score = 67.4 bits (163), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 72/277 (25%), Positives = 103/277 (37%), Gaps = 50/277 (18%)

Query: 37  EVRIRITYTAVCHTDAYTLSG---VDPE---------GAFPSILGHEGAGVVESVGKGVT 84
           E+ I I +  +C TD +  +      PE            P  +GHE AG V  VG GV 
Sbjct: 28  ELVIDIAWCGICGTDLHEYTDGPIFFPEDGHTHEISHNPLPQAMGHEMAGTVLEVGPGVA 87

Query: 85  NVKPGDHVVALYTAECQK--------------CKFCTSGKTNLCGSVRATQGKGVMPDGT 130
           ++K GD VV   T  C+               C  C  G  N+C S     G GV   G 
Sbjct: 88  HLKVGDKVVVEPTGTCRDRYRWPNSPNVSKEWCAACKKGYYNIC-SYLGLCGAGVQSGGF 146

Query: 131 SRFRTKNGESILHFMGCSTFSQYTXXXXXXXXXXXXQAPLDRICLLGCGVTTGYGAAIKT 190
           +  R    ES      C     +               PLD   L+       +  AI  
Sbjct: 147 AE-RVVMNES-----HCYKVPDFV--------------PLDVAALIQPLAVCWH--AISV 184

Query: 191 ANVQKGDTVAVFGAGTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFGATDFVNPSKD 250
              + G T  + GAG +GL  +    A G   I+V +    +++ A   GA  +      
Sbjct: 185 CEFKAGSTALIIGAGPIGLGTILALDAAGCKDIVVSEPAKLRRELAEKMGARVYDPTEHA 244

Query: 251 LKEGETIVSKLIELTDGGLDFTFDCTGNTKVMRDALE 287
            KE    +  + E  D G D+TFDC+G    +  A++
Sbjct: 245 AKESIDYLRSIAEGGD-GFDYTFDCSGLEITLNAAIQ 280

>KLLA0F00528g Chr6 complement(40081..41226) [1146 bp, 381 aa] {ON}
           similar to uniprot|P39713 Saccharomyces cerevisiae
           YAL061W putative polyol dehydrogenase
          Length = 381

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 79/294 (26%), Positives = 115/294 (39%), Gaps = 55/294 (18%)

Query: 12  LAAVAYEAGKPLTVEEIIVEP--PKAHEVRIRITYTAVCHTDAYTLSGVDPEGAFP---- 65
           + A+AY   + +     + EP   K  +V I I +  +C TD + L  +D    FP    
Sbjct: 1   MRALAYFGTRDIRFTTDLPEPVIEKPDDVLIDIVWCGICGTDLHEL--LDGPNFFPKDGE 58

Query: 66  ----------SILGHEGAGVVESVGKGVTNVKPGDHVVALYTAECQK----------CKF 105
                       +GHE AGVV  VG  VT  +PGDHVV   T  CQ           CK 
Sbjct: 59  THEISGRGLPQAMGHEMAGVVSQVGSSVTKFQPGDHVVVEPTGTCQDRERYNTKGETCKA 118

Query: 106 CTSGKTNLCGSVRATQGKGVMPDGTSRFRTKNGESILHFMGCSTFSQYTXXXXXXXXXXX 165
           C  G  N+C  +    G GV   G                    F++             
Sbjct: 119 CKRGMHNVCVHL-GLCGCGVQSGG--------------------FAEKVVIGEKHCFKVP 157

Query: 166 XQAPLDRICLLGCGVTTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKARGASRIIV 225
              PLD   L+       +  A+K   V++G +  + G G +GL ++   +  G + I+V
Sbjct: 158 SWIPLDVAALIQPLAVCWH--AVKLGAVKEGQSALILGGGPIGLGIIMALQHFGCTDIVV 215

Query: 226 VDINDQKKQWASDFGATDFVNPSKDLKEGETIVSKLIELTDG--GLDFTFDCTG 277
            +    ++  A   GA   V+   D K  E  +  L  L+    G DFTFDC+G
Sbjct: 216 SEPAKIRRDLAEKMGA--IVSNPMDFKTNEENIKNLCSLSPNGEGYDFTFDCSG 267

>Smik_1.5 Chr1 (16385..17638) [1254 bp, 417 aa] {ON} YAL061W (REAL)
          Length = 417

 Score = 66.2 bits (160), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 71/277 (25%), Positives = 103/277 (37%), Gaps = 50/277 (18%)

Query: 37  EVRIRITYTAVCHTDAYTLSG---VDPE---------GAFPSILGHEGAGVVESVGKGVT 84
           E+ I I +  +C TD +  +      PE            P  +GHE AG V  VG GV 
Sbjct: 28  ELVIDIAWCGICGTDLHEYTDGPIFFPEDGHTHEISHNPLPQAMGHEMAGTVLEVGPGVA 87

Query: 85  NVKPGDHVVALYTAECQK--------------CKFCTSGKTNLCGSVRATQGKGVMPDGT 130
           ++K GD VV   T  C+               C  C  G  N+C S     G GV   G 
Sbjct: 88  HLKVGDKVVVEPTGTCRDRYRWPESPNVDKEWCAACKKGYYNIC-SYLGLCGAGVQSGGF 146

Query: 131 SRFRTKNGESILHFMGCSTFSQYTXXXXXXXXXXXXQAPLDRICLLGCGVTTGYGAAIKT 190
           +  R    ES      C     +               PLD   L+       +  AI  
Sbjct: 147 AE-RVVMNES-----HCYKVPDFV--------------PLDVAALIQPLAVCWH--AISV 184

Query: 191 ANVQKGDTVAVFGAGTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFGATDFVNPSKD 250
              + G T  + GAG +GL  +    A G   I+V +    +++ A   GA  +      
Sbjct: 185 CEFKAGSTALIIGAGPIGLGTILALNAAGCRDIVVSEPAKLRRELAEKMGARVYDPTEHA 244

Query: 251 LKEGETIVSKLIELTDGGLDFTFDCTGNTKVMRDALE 287
            +E    +  + E  D G D+TFDC+G    +  A++
Sbjct: 245 ARESIDYLRSVAEGGD-GFDYTFDCSGLEVTLNAAIQ 280

>Suva_1.6 Chr1 (10591..11844) [1254 bp, 417 aa] {ON} YAL061W (REAL)
          Length = 417

 Score = 65.5 bits (158), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 71/278 (25%), Positives = 104/278 (37%), Gaps = 53/278 (19%)

Query: 26  EEIIVEPPKAHEVRIRITYTAVCHTDAYTLSG---VDPE---------GAFPSILGHEGA 73
           E  IV P    E+ + I +  +C TD +  +      PE            P  +GHE A
Sbjct: 20  EPRIVAP---DELVLDIAWCGICGTDLHEYTDGPIFFPEDGHTNEISHNPLPQAMGHEMA 76

Query: 74  GVVESVGKGVTNVKPGDHVVALYTAECQK--------------CKFCTSGKTNLCGSVRA 119
           G V  VG GVT  K GD VV   T  C+               C  C  G  N+C S   
Sbjct: 77  GTVAKVGPGVTQFKVGDKVVVEPTGTCRDRYRWPTSPNVDKEWCAACKRGLYNIC-SYLG 135

Query: 120 TQGKGVMPDGTSRFRTKNGESILHFMGCSTFSQYTXXXXXXXXXXXXQAPLDRICLLGCG 179
             G GV   G +         +++   C    ++               PLD   L+   
Sbjct: 136 LCGAGVQSGGFAE------RVVINESHCYKVPEFV--------------PLDVAALIQPL 175

Query: 180 VTTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKARGASRIIVVDINDQKKQWASDF 239
               +  AI   + + G T  + GAG +GL  +    A G S I V +    +++ A   
Sbjct: 176 AVCWH--AISVCDFKAGSTALIIGAGPIGLGTILALNAAGCSDIAVSEPAKVRRELAEKM 233

Query: 240 GATDFVNPSKDLKEGETIVSKLIELTDGGLDFTFDCTG 277
           GA  F +P+    +      + +     G D+TFDC+G
Sbjct: 234 GARVF-DPTAHAAKDSIDYLRSVAPGGDGYDYTFDCSG 270

>Smik_2.170 Chr2 complement(312211..313215) [1005 bp, 334 aa] {ON}
           YBR046C (REAL)
          Length = 334

 Score = 64.7 bits (156), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 67/247 (27%), Positives = 102/247 (41%), Gaps = 63/247 (25%)

Query: 37  EVRIRITYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGVVESVGKGVTNVKPGDHVVALY 96
           ++ I+  YT V + ++Y   G+ P    P ILG E AG + + GK VTN + GD V    
Sbjct: 37  DLLIKNKYTGVNYIESYFRKGLYPCEK-PYILGREAAGTIVAKGKDVTNFEIGDKVA--- 92

Query: 97  TAECQKCKFCTSGKTNLCGSVRATQGKGVMPDGTSRFRTKNGESILHFMGCSTFSQYTXX 156
                                                          ++  STF+QYT  
Sbjct: 93  -----------------------------------------------YISNSTFAQYTKF 105

Query: 157 XXXXXXXXXXQAPLDR-ICLLGCGVTTGYGAAIKT---ANVQKGDTVAVFGA-GTVGLSV 211
                     +   D  + L   G+     A   T    +V+KGD + +F A G VGL +
Sbjct: 106 PSEGTVMKLSKETNDEELKLYAAGLLQALTALSFTNEAYHVRKGDYILLFAAAGGVGLIL 165

Query: 212 VQGAKARGASRIIVVDINDQKKQWASDFGATDFVNPSKDLKEGETIVSKLIELTDG-GLD 270
            Q  + +GA  I V    D+K + A ++GA   +N SK     E I+ K++E+T+G G+D
Sbjct: 166 NQLLRMKGAHAIAVAS-TDEKLEIAKEYGAEYLINSSK-----EDILKKVLEITNGEGVD 219

Query: 271 FTFDCTG 277
            +FD  G
Sbjct: 220 ASFDSVG 226

>TDEL0D03720 Chr4 (683833..684840) [1008 bp, 335 aa] {ON} Anc_3.253
           YBR046C
          Length = 335

 Score = 64.3 bits (155), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 65/249 (26%), Positives = 97/249 (38%), Gaps = 63/249 (25%)

Query: 36  HEVRIRITYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGVVESVGKGVTNVKPGDHVVAL 95
           +E+ I+  Y  +   +AY   G+ P    P ILG E  GVV + G+ V N   GD V   
Sbjct: 37  NELLIKNKYAGINFIEAYFRKGIYPV-QLPQILGREATGVVVAKGQSVKNFDIGDKVA-- 93

Query: 96  YTAECQKCKFCTSGKTNLCGSVRATQGKGVMPDGTSRFRTKNGESILHFMGCSTFSQYTX 155
                                                           +M  STF+QYT 
Sbjct: 94  ------------------------------------------------YMSSSTFAQYTK 105

Query: 156 XXXX-XXXXXXXQAPLDRICLLGCGVTTGYGAAI---KTANVQKGDTVAVFGA-GTVGLS 210
                       +   D++ +    +  G  A     +   V++GD + ++ A G VGL 
Sbjct: 106 YSSSGLISKLPSETTDDQLKVYAAALIQGLTALTFLDEAYKVKEGDYILLYAAAGGVGLL 165

Query: 211 VVQGAKARGASRIIVVDINDQKKQWASDFGATDFVNPSKDLKEGETIVSKLIELT-DGGL 269
           + Q  K RGA  I VV   ++K++ A  FGA   +N SK     E I+ + +E+T D G+
Sbjct: 166 MDQLLKERGAHAIAVVS-TEEKEELAKKFGAEYVINSSK-----EDILKRALEITNDKGV 219

Query: 270 DFTFDCTGN 278
           D  FD  G 
Sbjct: 220 DAVFDSVGK 228

>KAFR0I00170 Chr9 (34519..35664) [1146 bp, 381 aa] {ON} Anc_7.3
           YAL060W
          Length = 381

 Score = 64.3 bits (155), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 86/319 (26%), Positives = 130/319 (40%), Gaps = 57/319 (17%)

Query: 37  EVRIRITYTAVCHTDAYT-LSGV-----DPEG------AFPSILGHEGAGVVESVGKGVT 84
           E+ I ++Y  +C +D +  L G      D E       + P  +GHE +G+V  VGK VT
Sbjct: 28  EIIIDVSYCGICGSDLHEYLEGPIFMPKDNETNEISNLSLPLAMGHEMSGIVREVGKNVT 87

Query: 85  NVKPGDHVVALYTAEC--------------QKCKFCTSGKTNLCGSVRATQGKGVMPDGT 130
            VK GD VV   ++ C              +KC  C  G  N C                
Sbjct: 88  KVKKGDKVVVEASSACSDVHRFATGKHYGEEKCPNCARGYDNCCAYA------------- 134

Query: 131 SRFRTKNGESILHFMGCSTFSQYTXXXXXXXXXXXXQAPLDRICLLGCGVTTGYGAAIKT 190
                  G + L F+G   F++              + PLD   L+     T + A  K 
Sbjct: 135 -------GFTGLGFIG-GGFAEQILVGEQHIVRIPDEIPLDVAALVEPLSVTWHAA--KV 184

Query: 191 ANVQKGDTVAVFGAGTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFGATDFVNPSKD 250
               KG T  + G+G +GL+++   KA GAS+I+V ++   +++ A       F +PS  
Sbjct: 185 GKFVKGSTALILGSGPIGLAMILVLKALGASKIVVSEVAQVRRKLAEKMKVEVF-DPSVH 243

Query: 251 LKEGETIVSKLIELTDGGLDFTFDCTGNTKVMRDALEACHKGWGQSIIIGVAAAGQEIST 310
            K     +  L E  D G DF FDC+G    M  A+   H    +  I+ VA  G   ST
Sbjct: 244 GKNTSNELRLLTENKD-GFDFAFDCSGLEVTMNTAI---HATKCRGTIVNVAVWG---ST 296

Query: 311 RPFQLVTGRVWKGSAFGGI 329
             F ++   + + +  G I
Sbjct: 297 MEFNMMDITLQEKTLIGSI 315

>NCAS0A07660 Chr1 complement(1525755..1526915) [1161 bp, 386 aa]
           {ON} 
          Length = 386

 Score = 64.3 bits (155), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 74/284 (26%), Positives = 115/284 (40%), Gaps = 59/284 (20%)

Query: 37  EVRIRITYTAVCHTDAYT-LSG---VDPEGA--------FPSILGHEGAGVVESVGKGVT 84
           E+ I + +  +C +D +  L G   +  +G+         P  +GHE  G V+++G  VT
Sbjct: 28  EILIDVAWCGICGSDLHEYLDGPIFMPQDGSTHPLSNQPLPQPMGHEFCGFVKAIGNKVT 87

Query: 85  NVKPGDHVVALYTAEC--------------QKCKFCTSGKTNLCGSVRATQGKGVMPDGT 130
            V  GD VV      C              ++C  C  G  N C                
Sbjct: 88  KVAVGDKVVVEAGCGCKDVHRWPQSHVYGKEQCTACRKGFDNCC---------------- 131

Query: 131 SRFRTKNGESILHFMGCSTFSQYTXXXXXXXXXXXXQAPLDRICLLGCGVTTGYGAAIKT 190
               T  G + L  +G   F++              + P D   L+       +  A+K 
Sbjct: 132 ----THAGFTGLGVVG-GAFAEQVVVGERHVVKLPEEVPTDVGALVEPLSVAWH--AVKV 184

Query: 191 ANVQKGD--TVAVFGAGTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFGATDFVNPS 248
           A  +KG      V GAG +GL+ +   KA GAS+I+V ++   +++ A   G   F +PS
Sbjct: 185 AGFEKGSGKNALVLGAGPIGLATILALKAHGASKIVVSELAAIRRELALKMGVEVF-DPS 243

Query: 249 K--DLKEGETIVSKLIELTD--GGLDFTFDCTGNTKVMRDALEA 288
           K  D K+G   + KL E+ +   G DF FDC+G       AL +
Sbjct: 244 KHGDEKQG---IKKLREIPEDHDGFDFAFDCSGVETTFNTALHS 284

>Kwal_56.22985 s56 complement(357501..358541) [1041 bp, 346 aa] {ON}
           YBR046C (ZTA1) - 1:1 [contig 184] FULL
          Length = 346

 Score = 63.9 bits (154), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 83/345 (24%), Positives = 129/345 (37%), Gaps = 70/345 (20%)

Query: 36  HEVRIRITYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGVVESVGKGVTNVKPGDHVVAL 95
           +E+ I+  YT +   ++Y   G+ P    P +LG E +G V + GK V+     D V   
Sbjct: 47  NEILIKNKYTGINFIESYFRKGIYPSQK-PYVLGREASGTVVAKGKAVSKFNLADKVA-- 103

Query: 96  YTAECQKCKFCTSGKTNLCGSVRATQGKGVMPDGTSRFRTKNGESILHFMGCSTFSQYTX 155
                                                           ++   TF+QYT 
Sbjct: 104 ------------------------------------------------YLSAGTFAQYTK 115

Query: 156 XXXXXXXXXXXQAPLDRICLLGCG----VTTGYGAAIKTANVQKGDTVAVFGA-GTVGLS 210
                      +   D+   L       V T    A +   V+KGD V ++ A G VGL+
Sbjct: 116 IAETGHISKLPENTTDKQLELYAASLVQVLTALTFAKEAYTVKKGDFVLLYAAAGGVGLA 175

Query: 211 VVQGAKARGASRIIVVDINDQKKQWASDFGATDFVNPSKDLKEGETIVSKLIELTDG-GL 269
             Q  K  GA  I V    D+K Q A +FGA   VN SK     E ++++++E+T G G+
Sbjct: 176 FNQILKRLGAHTIAVAS-TDEKLQLAKEFGAEYLVNSSK-----EDVLARVLEITQGQGV 229

Query: 270 DFTFDCTGNTKVMRDALEACHKGWGQSIIIGVAAAG-QEISTRPFQLVTGRVWKGSAFGG 328
           D  +D  G        L A  +  G  +  G A+     I+         ++ + + FG 
Sbjct: 230 DVAYDSIGK-DTFETTLSALRRK-GTFVSFGNASGPVPPIAISRLSPKNIKILRPTLFGY 287

Query: 329 IKGRSEMGGLVSDYMDGQLKVDEF---ITHRRPFTEINAAFDDLH 370
           I  + E     S+ +   L  +EF   IT   P  E   A ++L 
Sbjct: 288 IASQEEW-AYYSEELIKLLHSEEFKVLITKIYPLEEYRKATEELE 331

>TPHA0H03100 Chr8 complement(736924..738102) [1179 bp, 392 aa] {ON}
           Anc_7.3 YAL060W
          Length = 392

 Score = 63.2 bits (152), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 72/279 (25%), Positives = 111/279 (39%), Gaps = 50/279 (17%)

Query: 37  EVRIRITYTAVCHTD--AYTLSGV--DPEGA--------FPSILGHEGAGVVESVGKGVT 84
           E+ I ++Y  +C TD   YT   +   P+G          P  +GHE +GVVE VGKG  
Sbjct: 28  ELIIAVSYCGICGTDLKEYTEGAIFFPPDGGHNEISGNGLPQAMGHEISGVVEKVGKGCK 87

Query: 85  NVKPGDHVVALYTAECQK--------------CKFCTSGKTNLCGSVRATQGKGVMPDGT 130
             K GDHVV   T  C+               C  C+ G TN+C  + A  G G+   G 
Sbjct: 88  TFKVGDHVVVEPTGTCKDRYRWPESQNANKPMCSACSIGMTNICAHL-ALCGAGLESGG- 145

Query: 131 SRFRTKNGESILHFMGCSTFSQYTXXXXXXXXXXXXQAPLDRICLLGCGVTTGYGAAIKT 190
                              F++                PLD   L+       +  A+K 
Sbjct: 146 -------------------FAERLVINEAHVHKIPDHMPLDIGALIQPISVCWH--AVKV 184

Query: 191 ANVQKGDTVAVFGAGTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFGATDFVNPSKD 250
           A+ +KG +  + G G +GL  +   K  G   I++ +    ++++A   GA  +      
Sbjct: 185 AHYKKGGSALIIGGGPIGLGTILALKGFGCEYIVLSEPATIRREYAGKMGAKVYDPTGVP 244

Query: 251 LKEGETIVSKLIELTDGGLDFTFDCTGNTKVMRDALEAC 289
             E    + ++    D G D+TFDC+G    +  A+E C
Sbjct: 245 FDESVKTLREMGPNGD-GFDYTFDCSGLPITLNAAIECC 282

>Skud_2.162 Chr2 complement(299642..300646) [1005 bp, 334 aa] {ON}
           YBR046C (REAL)
          Length = 334

 Score = 62.0 bits (149), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 66/245 (26%), Positives = 107/245 (43%), Gaps = 59/245 (24%)

Query: 37  EVRIRITYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGVVESVGKGVTNVKPGDHVVALY 96
           ++ I+  YT V + ++Y   G+ P    P +LG E  GV+ + GK VTN + GD V  + 
Sbjct: 37  DILIKNKYTGVNYIESYFRKGLYPCEK-PYVLGREATGVIVAKGKDVTNFETGDQVAYIS 95

Query: 97  TAE-CQKCKFCTSGKTNLCGSVRATQGKGVMPDGTSRFRTK-NGESILHFMGCSTFSQYT 154
            +   Q  KF + G          T  K  +P GTS  + K     +L  +   +F+   
Sbjct: 96  NSTFAQYTKFPSEG----------TIMK--LPSGTSDEKMKLYAAGLLQALTALSFTN-- 141

Query: 155 XXXXXXXXXXXXQAPLDRICLLGCGVTTGYGAAIKTANVQKGDTVAVF-GAGTVGLSVVQ 213
                                             +  +V+KGD + V+  AG VGL + Q
Sbjct: 142 ----------------------------------EAYHVKKGDYILVYAAAGGVGLILNQ 167

Query: 214 GAKARGASRIIVVDINDQKKQWASDFGATDFVNPSKDLKEGETIVSKLIELTDG-GLDFT 272
             + + A  I V     +K + A D+GA   ++ SK     E I+++++E+TDG G+D +
Sbjct: 168 LLRMKDAHAIAVASTY-EKLETAKDYGAEFLIDSSK-----EDILTRVLEITDGKGVDAS 221

Query: 273 FDCTG 277
           FD  G
Sbjct: 222 FDSVG 226

>KAFR0C00580 Chr3 (113544..114548) [1005 bp, 334 aa] {ON} Anc_3.253
           YBR046C
          Length = 334

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 72/275 (26%), Positives = 110/275 (40%), Gaps = 69/275 (25%)

Query: 37  EVRIRITYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGVVESVGKGVTNVKPGDHVVALY 96
           EV I+  YT V + ++Y   G+ P    P +LG E  G V ++GK V ++K GD V   Y
Sbjct: 37  EVIIKNRYTGVNYIESYFRKGIYP-AELPYVLGREAVGTVVAIGKSVRDLKVGDKVS--Y 93

Query: 97  TAECQKCKFCTSGKTNLCGSVRATQGKGVMPDGTSRFRTKNGESILHFMGCSTFSQYTXX 156
            A     +F                    +P+ T  F+  +  S                
Sbjct: 94  IAGATFAQFTK------------------VPNSTHVFKLPDTTST--------------- 120

Query: 157 XXXXXXXXXXQAPLDRICLLGCGVTTGYGAAI---KTANVQKGDTVAVFGA-GTVGLSVV 212
                         +++ L   G+  G  A     +  +V+KGD V ++ A G VGL   
Sbjct: 121 --------------EQLKLYAAGMIQGLTALTFVNEAYDVKKGDYVLLYAAAGGVGLIFN 166

Query: 213 QGAKARGASRIIVVDINDQKKQWASDFGATDFVNPSKDLKEGETIVSKLIELTDG-GLDF 271
           Q  + RGA  I V   N +K   A + GA   +N  +D      I+ K+ ++T G G+D 
Sbjct: 167 QLLRMRGAHTIAVASTN-EKLSLAKENGAEFLINSKED-----NILEKVQQITKGNGVDV 220

Query: 272 TFDCTGNTKVMRDALE---ACHKGWGQSIIIGVAA 303
            FD  G     +D  E   +C K  G  +  G A+
Sbjct: 221 AFDSVG-----KDTFETTLSCLKRKGTFVSYGNAS 250

>KNAG0D00110 Chr4 (3538..4626) [1089 bp, 362 aa] {ON} 
          Length = 362

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 81/342 (23%), Positives = 134/342 (39%), Gaps = 37/342 (10%)

Query: 37  EVRIRITYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGVVESVGKGVTN-VKPGDHV-VA 94
           ++ ++I    VC +D +  SG   + A P I+GHE  G V  VG   T+ VK GD V + 
Sbjct: 35  DIDVKIECCGVCGSDVHCASGHWGDIAKPLIVGHEIVGHVVKVGPNCTSGVKVGDRVGLG 94

Query: 95  LYTAECQKCKFCTSGKTNLCGSVRATQGKGVMPDGTSRFRTKNGESILHFMGCSTFSQYT 154
                C KCK C +G  + C            P+    + T   +    ++    ++ Y 
Sbjct: 95  AQALSCMKCKRCLNGNESYC------------PNAIQTYSTPYEDG---YVSKGGYADYV 139

Query: 155 XXXXXXXXXXXXQAPLDRICLLGCGVTTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQG 214
                         P      L CG  T +   ++      G  VA+ G G +G   V  
Sbjct: 140 RVHEQFTVPIPENIPSHLAAPLMCGGLTVFSPLLRNG-CGPGKKVAILGIGGIGHMGVLL 198

Query: 215 AKARGASRIIVVDINDQKKQWASDFGATDFVNPSKDLKEGETIVSKLIELTDGGLDFTFD 274
           AKA GA  +  +     KK+ A   GA  F+   ++    E    +        LD    
Sbjct: 199 AKAMGA-EVYAISRTSSKKEDAMKLGADHFIATKEEPDWHEKYFDE--------LDLVVV 249

Query: 275 CTGN-TKVMRDALEACHKGWGQSIIIGVAAAGQEISTRPFQLVTGRVWKGSAFGGIKGRS 333
           C G+ T +  + L       G+ + I +    + +  +PF LV G     S  G ++   
Sbjct: 250 CAGSVTDIDFNTLPKIIAVGGRIVSIAIPEMSEVLELKPFGLV-GVSIANSLLGSMEELK 308

Query: 334 EMGGLVSDYMDGQLKVDEFITHRRPFTE--INAAFDDLHHGD 373
           ++  LVS+  D ++ V+       P +E  ++  F+ +  GD
Sbjct: 309 QLLKLVSE-KDIKIWVETV-----PISEKGVHEVFERMDKGD 344

>NDAI0A06320 Chr1 (1438393..1439442) [1050 bp, 349 aa] {ON}
           Anc_3.253
          Length = 349

 Score = 59.7 bits (143), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 65/244 (26%), Positives = 98/244 (40%), Gaps = 56/244 (22%)

Query: 36  HEVRIRITYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGVVESVGKGVTNVKPGDHVVAL 95
           +++ I+  Y  V + ++Y   G+ P  A P+ILG E +GVV   G  + N + GD V   
Sbjct: 52  NDIIIKNKYAGVNYIESYFRKGIYP-CALPAILGREASGVVVDKGTNIKNFEIGDKVA-- 108

Query: 96  YTAECQKCKFCTSGKTNLCGSVRATQGKGVMPDGTSRFRTKNGESILHFMGCSTFSQYTX 155
           Y   C   +F     + +           +  D T+         IL  +   +F     
Sbjct: 109 YIGNCSMAQFTKIDNSMIM---------KLSSDSTNEDLKLYAAGILQGLTALSF----- 154

Query: 156 XXXXXXXXXXXQAPLDRICLLGCGVTTGYGAAIKTANVQKGDTVAVF-GAGTVGLSVVQG 214
                                   VT  Y        V+KGD + V+  AG  GL   Q 
Sbjct: 155 ------------------------VTEAY-------EVKKGDYILVYAAAGGAGLIFDQL 183

Query: 215 AKARGASRIIVVDINDQKKQWASDFGATDFVNPSKDLKEGETIVSKLIELTDG-GLDFTF 273
            KARGA  +I V  +D+K Q A + GA   +N   D      I++K++E+TD  G+   F
Sbjct: 184 IKARGA-HVIAVCSSDEKLQLAKENGAEYLINSKTD-----DILTKVMEITDNKGVQAAF 237

Query: 274 DCTG 277
           D  G
Sbjct: 238 DSVG 241

>KLTH0C07854g Chr3 (673945..675021) [1077 bp, 358 aa] {ON} similar
           to uniprot|P38230 Saccharomyces cerevisiae YBR046C ZTA1
           Zeta-crystallin homolog
          Length = 358

 Score = 58.9 bits (141), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 75/362 (20%), Positives = 131/362 (36%), Gaps = 77/362 (21%)

Query: 36  HEVRIRITYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGVVESVGKGVTNVKPGDHVVAL 95
           +E+ I+  Y  + + ++Y   G+ P    P +LG E +GVV + G  VT     D V   
Sbjct: 59  NEILIKNKYAGINYIESYFRKGIYPSKK-PYVLGREASGVVVAKGDAVTKFDVNDKVA-- 115

Query: 96  YTAECQKCKFCTSGKTNLCGSVRATQGKGVMPDGTSRFRTKNGESILHFMGCSTFSQYTX 155
                                                           ++  +TF+QYT 
Sbjct: 116 ------------------------------------------------YLSSNTFAQYTK 127

Query: 156 XXXXXXXXXXXQAPLDRICLLGCG----VTTGYGAAIKTANVQKGDTVAVFGAGTVGLSV 211
                      Q   D    L  G      T      +   V+KGD + ++ A       
Sbjct: 128 ISEAGTVSKVPQDSTDEQLKLYAGSLVQALTSLAFVREAYPVKKGDYILLYAAAGGAGLA 187

Query: 212 VQGAKARGASRIIVVDINDQKKQWASDFGATDFVNPSKDLKEGETIVSKLIELTDG-GLD 270
                 +  +  I V   D+K Q A ++GA   +N SKD      ++++++E+T+G G++
Sbjct: 188 FNQFLKKAGAHTIAVASTDEKLQLAKEYGAEFLINSSKD-----DVLARVLEITNGQGVE 242

Query: 271 FTFDCTGNTKVMRDALEACHKGWGQS-IIIGVAAAGQEISTRPFQLVTG---RVWKGSAF 326
             FD  G     +D  E   K   +   ++    A   +      ++T    ++ + S F
Sbjct: 243 AAFDSVG-----KDTFETSLKALKRKGTLVSFGNASGPVPPVAINILTPKNIKLLRPSLF 297

Query: 327 GGIKGRSEMGGLVSDYMD----GQLKVDEFITHRRPFTEINAAFDDLHHGDCL-RTVLDL 381
           G I    E     S+  D    G LK+   I+   P  E N A + L     + + +L++
Sbjct: 298 GYIATHEEWESYSSELFDLLHSGALKI--LISKTYPLEEYNQAAEQLESRKTVGKLMLEI 355

Query: 382 SK 383
           S+
Sbjct: 356 SQ 357

>KNAG0E04200 Chr5 complement(837232..838389) [1158 bp, 385 aa] {ON} 
          Length = 385

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 79/344 (22%), Positives = 135/344 (39%), Gaps = 58/344 (16%)

Query: 12  LAAVAYEAGKPLTVEEIIVEPPKA--HEVRIRITYTAVCHTDAYTLSG------VDPE-- 61
           + A+ Y +   +   + + EP  +   E+ + I Y  +C TD + L+       +D E  
Sbjct: 1   MRALVYFSKGDIRFTDTLAEPEISTGDELLVDIVYCGICGTDLHELTDGPIFFPLDNERN 60

Query: 62  ----GAFPSILGHEGAGVVESVGKGVTNVKPGDHVVALYTAECQK--------------C 103
                  P  +GHE AG+V +VG GV   + GDHV    T  C+               C
Sbjct: 61  EISGNGLPQAMGHEMAGIVTAVGSGVKKFQVGDHVAIEPTGTCRDRYRWPDAPDAKKPVC 120

Query: 104 KFCTSGKTNLCGSVRATQGKGVMPDGTSRFRTKNGESILHFMGCSTFSQYTXXXXXXXXX 163
             C  G  N C  +    G GV   G +  R    ES  H   C                
Sbjct: 121 TSCQRGMYNCCDYL-GLIGNGVQSGGFAE-RIVVNES--HCYKCPD-------------- 162

Query: 164 XXXQAPLDRICLLGCGVTTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKARGASRI 223
                P +   L+       +  AI  A  + G +V + G G +GL  +      G + I
Sbjct: 163 ---NLPWEVAALIQPIAVCWH--AINIAQFKPGSSVLILGGGPIGLGTILALNGHGCTEI 217

Query: 224 IVVDINDQKKQWASDFGATDFVNPSKDLKEGETIVSKLIELTDG--GLDFTFDCTGNTKV 281
           IV +    ++ +A   GA  + +P +     E  +  L ++  G  G D+ FDC+G    
Sbjct: 218 IVSEPVKLRRDYAEKMGAVVY-DPLQ--CSHEQSIPNLRKMAPGADGFDYCFDCSGTPAT 274

Query: 282 MRDALEACHKGWGQSIIIGVAAAGQEISTRPFQLVTG-RVWKGS 324
           ++ ++E C    G ++ + + A  + ++  P  +    +++ GS
Sbjct: 275 LKASIE-CLTFRGTAVNVAMWATNKAVNFYPMDITKQEKIYTGS 317

>Kwal_47.17532 s47 (444594..445715) [1122 bp, 373 aa] {ON} YMR318C
           (ADH6) - NADPH-dependent alcohol dehydrogenase [contig
           207] FULL
          Length = 373

 Score = 56.6 bits (135), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 81/345 (23%), Positives = 130/345 (37%), Gaps = 53/345 (15%)

Query: 33  PKA---HEVRIRITYTAVCHTDAYTLS---GVDPEGAFPS-------ILGHEGAGVVESV 79
           PKA   H+V I +    +C ++ + L    G  P     S       ++GHE  G V +V
Sbjct: 28  PKAFGPHDVDIEVECCGICASELFALKNEWGHAPLACLSSKYGPKTQVVGHEVVGKVVAV 87

Query: 80  GKGVTNVKPGDHV-VALYTAECQKCKFCTSGKTNLCGSVRATQGKGVMPDGTSRFRTKNG 138
           G  V+    GD V +    + C +C  C SG    C +  +T  K   PDG   + ++ G
Sbjct: 88  GPQVSLCNVGDRVGLGAQASACMQCSRCNSGNEQYCPNAISTYCK-PYPDG---YVSQGG 143

Query: 139 ESILHFMGCSTFSQYTXXXXXXXXXXXXQAPLDRICLLGCGVTTGYGAAIKTANVQKGDT 198
                      ++ +             + P + +  L CG  T +    +    +    
Sbjct: 144 -----------YASHVRAHEQFCFPIPPEIPSELVAPLQCGGLTVFSPIKRNLQGKHDPK 192

Query: 199 VAVFGAGTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFGATDFVNP-SKDLKEGETI 257
           VAV G G +G   +  A+A GA  +        K+  A   GA  FV     D   G   
Sbjct: 193 VAVIGIGGLGHMAIMIARALGA-EVYAFSRGHSKRDDALKMGAHHFVATGDADWNAG--- 248

Query: 258 VSKLIELTDGGLDFTFDCTGNTKVMR-DALEACHKGWGQSIIIGVAAAGQEISTRPFQLV 316
                   D   D   +C  +T  +  +A+  C K     + +G+    +E+S +PF   
Sbjct: 249 -------LDDTFDLILNCASSTSSLDLNAMLPCLKVNCNFVSVGLPHIDEELSVKPFSFF 301

Query: 317 TGRVWKGSAFGGIKGRSEMGGLVSDYMDGQLKVDEFITHRRPFTE 361
                 GS+   +  RSE   L+      QL V+    + RP+ E
Sbjct: 302 KNGCNIGSS--KLGSRSEAIELM------QLAVEH---NFRPWVE 335

>KLLA0A10549g Chr1 (921022..922083) [1062 bp, 353 aa] {ON} highly
           similar to uniprot|P38230 Saccharomyces cerevisiae
           YBR046C
          Length = 353

 Score = 55.5 bits (132), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 40/89 (44%), Positives = 50/89 (56%), Gaps = 8/89 (8%)

Query: 192 NVQKGDTVAVFGA-GTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFGATDFVNPSKD 250
           NVQKGD + V+ A G VGL   Q  KARGA R I V   D+K Q A ++GA   +N +KD
Sbjct: 164 NVQKGDFILVYAAAGGVGLIFDQLLKARGA-RTIAVASTDEKLQLAKEYGAEFLINSTKD 222

Query: 251 LKEGETIVSKLIELTDG-GLDFTFDCTGN 278
                 IV K+ E T+G G+   FD  G 
Sbjct: 223 -----DIVEKVKEFTNGEGVAAAFDSIGK 246

>SAKL0D03872g Chr4 (316127..317173) [1047 bp, 348 aa] {ON} highly
           similar to uniprot|P38230 Saccharomyces cerevisiae
           YBR046C
          Length = 348

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 86/360 (23%), Positives = 131/360 (36%), Gaps = 80/360 (22%)

Query: 26  EEIIVEPPKAHEVRIRITYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGVVESVGKGVTN 85
           E+  V    A EV I+  ++ +   ++Y   G+ P    P +LG E AG V + G  V+ 
Sbjct: 40  EDFPVPNINADEVLIKNKFSGINFIESYFRKGLYPSQK-PYVLGREAAGTVVAKGDAVSK 98

Query: 86  VKPGDHVVALYTAECQKCKFCTSGKTNLCGSVRATQGKGVMPDGTSRFRTKNGESILHFM 145
              GD V                                                   ++
Sbjct: 99  FNIGDKVA--------------------------------------------------YL 108

Query: 146 GCSTFSQYTXXXXXXXXXXXXQAPLDRICLLGCGVTTGYGAAIKTAN----VQKGDTVAV 201
              TF+QYT            +   D       G       A+   N    V+KGD + +
Sbjct: 109 SPGTFAQYTKYPENGKILKLPKETTDEQLKFYAGSLVQGLTALTFVNDAYDVKKGDYILL 168

Query: 202 FGA-GTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFGATDFVNPSKDLKEGETIVSK 260
           + A G  GL   Q  K +GA  I V    D+K + A ++GA   +N SKD       +SK
Sbjct: 169 YAAAGGAGLIFNQLLKLKGAHTIAVAS-TDEKLKLAREYGAEYVINSSKD-----DTLSK 222

Query: 261 LIELTDG-GLDFTFDCTGNTKVMRDALEACHKGWGQSIIIGVAAAGQEISTRPFQL---- 315
           ++E+T+G G+   FD  G       +L+A  +  G  +  G A+        PF +    
Sbjct: 223 VLEITNGEGVAAAFDSIGK-DTFEISLQAIKRK-GTLVSFGNASG----PVPPFSINRLS 276

Query: 316 -VTGRVWKGSAFGGIKGRSEMGGLVSDYMD----GQLKVDEFITHRRPFTEINAAFDDLH 370
               +V +   FG I    E     S  ++    G LKV  FI+   P +E  AA + L 
Sbjct: 277 SKNLKVLRPQVFGYITTSEEWNHYASKLIELLSSGDLKV--FISGTYPLSEYRAATEALE 334

>NDAI0H02950 Chr8 complement(718762..719853) [1092 bp, 363 aa] {ON} 
          Length = 363

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 76/307 (24%), Positives = 117/307 (38%), Gaps = 28/307 (9%)

Query: 36  HEVRIRITYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGVVESVGKGVTNVKPGDHV-VA 94
           ++V ++I    VC +D +T SG   E   P ++GHE  G V  +G     +K GD V + 
Sbjct: 38  YDVEVKIECCGVCGSDIHTASGHWGETKKPLVVGHEIIGTVTQIGSQCNELKVGDRVGIG 97

Query: 95  LYTAECQKCKFCTSGKTNLCGSVRATQGKGVMPDGTSRFRTKNGESILHFMGCSTFSQYT 154
                C +C  C S     C     T  K    D T  + +K G           ++ Y 
Sbjct: 98  AQVFSCLECDRCKSDNEPYCPKTVNTYRK----DYTDGYNSKGG-----------YADYI 142

Query: 155 XXXXXXXXXXXXQAPLDRICLLGCGVTTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQG 214
                         P      L CG  T +   ++      G  V + G G +G   +  
Sbjct: 143 RLHEHFAVPIPENIPSHLAAPLMCGGVTAFSPLLRNG-CGPGKKVGIMGIGGIGHMGLIF 201

Query: 215 AKARGASRIIVVDINDQKKQWASDFGATDFVNPSKDLKEGETIVSKLIELTDGGLDFTFD 274
           AKA GA     +  +  KK+ A   GA  F+      KE     +K  +      D    
Sbjct: 202 AKAMGA-ETFAISRSSAKKEDAIKMGADHFIA----TKEEPDWATKYFDT----FDLIVV 252

Query: 275 CTGN-TKVMRDALEACHKGWGQSIIIGVAAAGQEISTRPFQLVTGRVWKGSAFGGIKGRS 333
           C+ + T +  + +    K  G+ + I V    + ++ +PF L+ G     SA GGI    
Sbjct: 253 CSNSLTDIDFNVVPRTMKVGGKIVSICVPEQHEVMNLKPFGLI-GVSISNSALGGINEIK 311

Query: 334 EMGGLVS 340
           +M  LVS
Sbjct: 312 QMLDLVS 318

>Suva_4.279 Chr4 complement(495380..496384) [1005 bp, 334 aa] {ON}
           YBR046C (REAL)
          Length = 334

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 62/248 (25%), Positives = 97/248 (39%), Gaps = 63/248 (25%)

Query: 36  HEVRIRITYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGVVESVGKGVTNVKPGDHVVAL 95
            ++ I+  Y  V + ++Y   G+ P    P +LG E  G V + GK V N + GD V   
Sbjct: 36  EDLLIKNKYAGVNYIESYFRKGLYP-CEKPYVLGREATGTVVAKGKDVNNFQIGDQVA-- 92

Query: 96  YTAECQKCKFCTSGKTNLCGSVRATQGKGVMPDGTSRFRTKNGESILHFMGCSTFSQYTX 155
                                                           ++  STF+QYT 
Sbjct: 93  ------------------------------------------------YISHSTFAQYTK 104

Query: 156 XXXXXXXXXXXQAPLD-RICLLGCGVT---TGYGAAIKTANVQKGDTVAVFGA-GTVGLS 210
                      +   D ++ L   G+    T      +  +V+KGD + V+ A G VGL 
Sbjct: 105 FSSKGNVMRLPKCTSDEKMKLYAAGLLQALTALSFTNEAYHVKKGDYILVYAAAGGVGLI 164

Query: 211 VVQGAKARGASRIIVVDINDQKKQWASDFGATDFVNPSKDLKEGETIVSKLIELTDG-GL 269
           + Q  K +GA  I V    D+K   A   GA   +N SK     E ++ +++E+T+G G+
Sbjct: 165 LNQLLKMKGAHAIAVAS-TDEKLDIAKKNGAEYLINSSK-----EDVLERVLEITNGEGV 218

Query: 270 DFTFDCTG 277
           D +FD  G
Sbjct: 219 DSSFDSIG 226

>SAKL0H22088g Chr8 (1934171..1935301) [1131 bp, 376 aa] {ON} similar
           to uniprot|Q04894 Saccharomyces cerevisiae YMR318C ADH6
           NADPH-dependent cinnamyl alcohol dehydrogenase family
           member with broad substrate specificity may be involved
           in fusel alcohol synthesis or in aldehyde tolerance
          Length = 376

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 70/308 (22%), Positives = 112/308 (36%), Gaps = 45/308 (14%)

Query: 34  KAHEVRIRITYTAVCHTDAYTLSGV---DPEGAFPS-------ILGHEGAGVVESVGKGV 83
           +AH+V I +    +C ++ ++L      +P     S       ++GHE  G V +VG  V
Sbjct: 34  EAHDVDIEVECCGICASELFSLKNEWKHEPLACLSSSYGPKSQVVGHEVVGKVVAVGSNV 93

Query: 84  TNVKPGDHV-VALYTAECQKCKFCTSGKTNLCGSVRATQGKGVMPDGTSRFRTKNGESIL 142
           T    GD V +      C KC  C SG    C            P     + ++  +  +
Sbjct: 94  TLCNIGDRVGLGAQAFSCMKCSRCNSGNEQYC------------PQAVGTYCSRYADGYI 141

Query: 143 HFMGCSTFSQYTXXXXXXXXXXXXQAPLDRICLLGCGVTTGYGAAIKTANVQKGDTVAVF 202
              G   ++ +               P + +  L CG  T Y    +     K   VA+ 
Sbjct: 142 SQGG---YASHVRAHEQFCFPIPDDIPSELVAPLQCGGLTVYSPIKRNIEGVKDPKVAII 198

Query: 203 GAGTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFGATDFVNPSKDLKEGETIVSKLI 262
           G G +G   +  +KA GA  +        KK+ A   GA  F+        GE       
Sbjct: 199 GIGGLGHMAIMISKALGA-EVTAFSRGYSKKEDALKMGAHHFI------ATGE------- 244

Query: 263 ELTDGGLDFTFDCTGN-----TKVMRDALEACHKGWGQSIIIGVAAAGQEISTRPFQLVT 317
           E  + GL+ TFD   N     T +  + L  C K     I +G+    ++   +PF   +
Sbjct: 245 EGWESGLNDTFDLILNCASSTTSLDLNKLLPCLKINRNFISVGLPHVDEDFKVKPFSFFS 304

Query: 318 GRVWKGSA 325
                GS+
Sbjct: 305 NGCCIGSS 312

>SAKL0D14938g Chr4 complement(1235542..1236678) [1137 bp, 378 aa]
           {ON} similar to uniprot|Q04894 Saccharomyces cerevisiae
           YMR318C ADH6 NADPH-dependent cinnamyl alcohol
           dehydrogenase family member with broad substrate
           specificity may be involved in fusel alcohol synthesis
           or in aldehyde tolerance
          Length = 378

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 84/322 (26%), Positives = 122/322 (37%), Gaps = 53/322 (16%)

Query: 62  GAFPSILGHEGAGVVESVGKGVTNVKPGDHV-VALYTAECQKCKFCTSGKTNLCGSVRAT 120
           G    ++GHE  G V +VG  VT    G+ V +      C KC  C +G    C     T
Sbjct: 74  GPKSQVVGHEIVGHVVNVGNKVTKFHKGERVAMGAQCGSCMKCNRCINGYEQFCTGCIET 133

Query: 121 QGKGVMPDGTSRFRTKNGESILHFMGCSTFSQYTXXXXXXXXXXXXQAPLDRICLLGCGV 180
                 PDG   + ++ G           ++ +             Q     +  L CG 
Sbjct: 134 YCSE-YPDG---YVSQGG-----------YASHVRAHEHYIVHVPPQLDSKHVAPLQCGG 178

Query: 181 TTGYGAAIKTA---NVQKGDTVAVFGAGTVGLSVVQGAKARGASRIIVVDINDQKKQWAS 237
            T Y + IK A      K   VA+ G G +G   +  +KA     +  +  +D KK+ A 
Sbjct: 179 LTVY-SPIKRALKDVTDKKPRVAIIGIGGLGHMAIMISKALDC-EVWALSTSDSKKEDAK 236

Query: 238 DFGATDFVNPS-KDLKEGETIVSKLIELTDGGLDFTF----DCT-GNTKVMRDALEACHK 291
             GA  FVN + KD+               GGL  TF     CT   TK+  ++L     
Sbjct: 237 KMGADHFVNTTEKDVW--------------GGLQDTFHLILSCTISYTKLPFESLLGTLV 282

Query: 292 GWGQSIIIGVAAAGQEISTRPFQLVT-GRVWKGSAFGGIKGRSEMGGLVSDYMDGQLKVD 350
             G+ I +G+ +  Q +   P QL   G  +  S  G IK   E+  L   + D +  V+
Sbjct: 283 ATGKFISVGLPSKDQPLEIHPMQLAAHGVSFSASHLGSIKELEELLALSVKH-DIKPWVE 341

Query: 351 EFITHRRPFTEINAAFDDLHHG 372
           E      P +E     D LH G
Sbjct: 342 EL-----PISE-----DSLHEG 353

>NDAI0H02060 Chr8 complement(502872..504071) [1200 bp, 399 aa] {ON} 
          Length = 399

 Score = 52.8 bits (125), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 65/304 (21%), Positives = 117/304 (38%), Gaps = 52/304 (17%)

Query: 12  LAAVAYEAGKPLTVEEIIVEPP--KAHEVRIRITYTAVCHTDAYTLSG---VDPEGA--- 63
           + A+AY     +     + EP      E+ I I++  +C TD +         PE     
Sbjct: 1   MRALAYFGKNDIKFTNDLPEPKITAPDELIIDISWCGICGTDLHEFQDGPIFFPENGCCH 60

Query: 64  ------FPSILGHEGAGVVESVGKGVTNVKPGDHVVALYTAEC--------------QKC 103
                  P  +GHE AG+V  +G  V   + GD VV   T  C              ++C
Sbjct: 61  EISGEGLPQAMGHEIAGIVSEIGPKVKKFQVGDRVVVEPTGTCKDRYRWPDAPNANQEEC 120

Query: 104 KFCTSGKTNLCGSVRATQGKGVMPDGTSRFRTKNGESILHFMGCSTFSQYTXXXXXXXXX 163
             C  G  N+C ++    G GV   G +         +++   C    ++          
Sbjct: 121 AACKKGLYNICSNL-GLVGCGVQSGGFAE------RMVMNEAKCYKIPEHLT-------- 165

Query: 164 XXXQAPLDRICLLGCGVTTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKARGASRI 223
                 +D   L+     + +  A++ +  + G +V + G G +GL  +      G + +
Sbjct: 166 ------MDVAALIQPIAVSWH--AVRVSKFKPGSSVLIIGGGPIGLGTILALNGHGVTEV 217

Query: 224 IVVDINDQKKQWASDFGATDFVNPSKDLKEGETIVSKLIELTDGGLDFTFDCTGNTKVMR 283
           +V +    ++  A   GA  +   ++D  E    +  +    D G D+TFDC+GN   ++
Sbjct: 218 VVSEPAKIRRDLAEKMGAVVYDPMTRDHDESIKYLRSIAPGGD-GFDYTFDCSGNPATLK 276

Query: 284 DALE 287
            A+E
Sbjct: 277 AAIE 280

>TPHA0J00170 Chr10 (40911..41996) [1086 bp, 361 aa] {ON} 
          Length = 361

 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 81/343 (23%), Positives = 134/343 (39%), Gaps = 36/343 (10%)

Query: 36  HEVRIRITYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGVVESVG-KGVTNVKPGDHV-V 93
            +V I++    VC +D +  +G         ++GHE  G V  VG K    VK GD V V
Sbjct: 34  RDVDIKVIACGVCGSDVHCAAGRHLPLFEDCVVGHEIIGEVVKVGPKCTAGVKVGDRVGV 93

Query: 94  ALYTAECQKCKFCTSGKTNLCGSVRATQGKGVMPDGTSRFRTKNGESILHFMGCSTFSQY 153
              +  C +C+ C +G    C          + PDG+   + + G     F       +Y
Sbjct: 94  GAQSLSCLECESCIAGNEQYCKKNTVYTIASIYPDGS---KAQGG-----FGSHVRTHEY 145

Query: 154 TXXXXXXXXXXXXQAPLDRICLLGCGVTTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQ 213
                         APL       CG  T +   ++   V  G TV + G G +G   + 
Sbjct: 146 FVHPIPKELDTVNAAPLL------CGGITAFSPLLR-GQVGPGKTVGIVGIGGIGHIAIL 198

Query: 214 GAKARGASRIIVVDINDQKKQWASDFGATDFVNPSKDLKEGETIVSKLIELTDGGLDFTF 273
            AKA GA ++I +  +  KK+     GA +++  +    EG+    K      G +DF  
Sbjct: 199 FAKAMGA-KVIAISRSASKKEDCLKLGADEYIASA----EGDDWKQKFA----GSIDFML 249

Query: 274 DCTGN-TKVMRDALEACHKGWGQSIIIGVAAAGQEISTRPFQLVTGRVWKGSAFGGIKGR 332
            C  + +K   D+L +  K  G+   IG+      +S  P  L+  +      F  +  R
Sbjct: 250 LCNSSFSKSNFDSLFSLIKLGGEVCSIGIPDMSYRLSISPLSLLGIKF----GFSALGSR 305

Query: 333 SEMGGLVSDYMDGQLKVDEFITHRRPFTE--INAAFDDLHHGD 373
           +E   +        +K+        P  E  ++ AF+ + +GD
Sbjct: 306 NEFQKMFELVKKNNIKL---WVETLPIGEKGLHEAFERVENGD 345

>ZYRO0A03366g Chr1 (271779..272828) [1050 bp, 349 aa] {ON} highly
           similar to uniprot|P38230 Saccharomyces cerevisiae
           YBR046C ZTA1 Zeta-crystallin homolog
          Length = 349

 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 79/343 (23%), Positives = 127/343 (37%), Gaps = 77/343 (22%)

Query: 36  HEVRIRITYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGVVESVGKGVTNVKPGDHVVAL 95
           +E+ ++  Y+ +   ++Y   G+ P    P ILG E +G V + G  V +   GD V   
Sbjct: 52  NELLVKNKYSGINFIESYFRKGIYPSEK-PLILGRESSGTVVAKGNSVKDFDIGDKVA-- 108

Query: 96  YTAECQKCKFCTSGKTNLCGSVRATQGKGVMPDGTSRFRTKNGESILHFMGCSTFSQYTX 155
                                                           ++  S F+QYT 
Sbjct: 109 ------------------------------------------------YLSGSAFAQYTK 120

Query: 156 XXXXXXXXXXXQAPLDR-ICLLGCGVTTGYGAAI---KTANVQKGDTVAVFGA-GTVGLS 210
                      +   D  + L   G+     A     +  NV+KGD +  + A G VGL 
Sbjct: 121 VDAAGKVVKLPKDANDETLKLYAAGLLQSLTALTFIDEAYNVKKGDFILNYAAAGGVGLI 180

Query: 211 VVQGAKARGASRIIVVDINDQKKQWASDFGATDFVNPSKDLKEGETIVSKLIELTDG-GL 269
           + Q  K RGA  I VV   ++K + A   GA   +  SK     E IV+++ E+T+  G+
Sbjct: 181 LDQLLKERGAHTIAVVS-TEEKLELAKKHGAEYGIISSK-----EDIVTRVKEITNNQGV 234

Query: 270 DFTFDCTGNTKVMRDALEACHKGWGQS-IIIGVAAAGQEISTRPFQLVTG--RVWKGSAF 326
           D  FD  G     +D  E       +    +    A   +S  P   +TG  ++ + S F
Sbjct: 235 DAAFDSIG-----KDTFETTISALKRKGTFVSYGNASGPVSPFPLTKLTGNIKILRPSLF 289

Query: 327 GGIKGRSEMGGLVSDYM----DGQLKVDEFITHRRPFTEINAA 365
             I    E      +++     G+LK++  I H  P +E   A
Sbjct: 290 SYIATSEEWKHYSREFVSLVSSGKLKIN--IGHVFPLSEYPKA 330

>ABL090W Chr2 (230699..231703) [1005 bp, 334 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBR046C (ZTA1)
          Length = 334

 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 68/255 (26%), Positives = 102/255 (40%), Gaps = 55/255 (21%)

Query: 26  EEIIVEPPKAHEVRIRITYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGVVESVGKGVTN 85
           E+  V   +  ++ I+  Y  V   + Y  +G+ P    P +LG E  GVV ++G  V  
Sbjct: 26  EDYPVPEVRGSDILIKNRYAGVNFIETYFRTGLYP-CEKPYVLGREAVGVVAAIGADVRR 84

Query: 86  VKPGDHVVALYTAECQKCKFCTSGKTNLCGSVRATQGKGVMPDGTSRFRTKNGESILHFM 145
            K GD V  L +    +     S K+N+            +PD       ++GE  L  +
Sbjct: 85  FKVGDRVACLSSGTFAQYT-AVSEKSNVLK----------LPDDI-----QDGE--LQAV 126

Query: 146 GCSTFSQYTXXXXXXXXXXXXQAPLDRICLLGCGVTTGYGAAIKTANVQKGDTVAVFGA- 204
             S  +                         G    T    A K    Q G+ V V+ A 
Sbjct: 127 AGSLVN-------------------------GLTALTLVDEAYKP---QVGEIVLVYAAA 158

Query: 205 GTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFGATDFVNPSKDLKEGETIVSKLIEL 264
           G VG  ++Q   AR   R+I V   D+K Q A   GA   +N S+     E IV+K++E 
Sbjct: 159 GGVGQLLIQLLHARSV-RVIAVASTDEKLQIAKSRGAEFLINSSR-----EDIVAKVLEF 212

Query: 265 TDG-GLDFTFDCTGN 278
           TDG G+  ++D  G 
Sbjct: 213 TDGEGVGASYDSVGK 227

>KLTH0E07964g Chr5 (735214..736338) [1125 bp, 374 aa] {ON} similar
           to uniprot|P25377 Saccharomyces cerevisiae YCR105W ADH7
           NADPH-dependent cinnamyl alcohol dehydrogenase family
           member with broad substrate specificity may be involved
           in fusel alcohol synthesis
          Length = 374

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 65/295 (22%), Positives = 109/295 (36%), Gaps = 45/295 (15%)

Query: 37  EVRIRITYTAVCHTDAYTLSG---VDPEGAFPS-------ILGHEGAGVVESVGKGVTNV 86
           +V I +    +C ++ + L      +P     S       ++GHE  G V +VG  V+  
Sbjct: 35  DVDIEVECCGICASELFALKNDWTHEPLACLSSKYGPKTQVVGHEVVGKVVAVGPEVSLC 94

Query: 87  KPGDHV-VALYTAECQKCKFCTSGKTNLCGSVRATQGKGVMPDGTSRFRTKNGESILHFM 145
           K GD V +    + C +C  C S     C     T      PDG   + ++ G       
Sbjct: 95  KVGDRVGLGAQASACMQCSRCQSSNEQYCAQSIGTYCNP-YPDG---YVSQGG------- 143

Query: 146 GCSTFSQYTXXXXXXXXXXXXQAPLDRICLLGCGVTTGYGAAIKTANVQKGDTVAVFGAG 205
               ++ +             + P + +  L CG  T +    +    +K   VA+ G G
Sbjct: 144 ----YASHVRAHEQFCFPIPPEIPSELVAPLQCGGLTVFSPIKRNIQGKKNPRVAIIGIG 199

Query: 206 TVGLSVVQGAKARGASRIIVVDINDQKKQWASDFGATDFVNPSKDLKEGETIVSKLIELT 265
            +G   +  +KA GA  +  V     K+  A   GA  F+  S+                
Sbjct: 200 GLGHMAIMISKALGA-EVSAVSRGYSKRDDALKMGADHFIATSE-------------PNW 245

Query: 266 DGGLDFTFD----CTGNTKVMR-DALEACHKGWGQSIIIGVAAAGQEISTRPFQL 315
           + GLD TFD    C  +T  +  +AL  C K     + +G+    ++   +PF  
Sbjct: 246 NAGLDDTFDLILNCASSTSSLDLNALLPCLKVNCNFVSVGLPHIDEDFKVKPFSF 300

>KLTH0B04972g Chr2 (408153..409235) [1083 bp, 360 aa] {ON} highly
           similar to uniprot|Q04894 Saccharomyces cerevisiae
           YMR318C ADH6 NADPH-dependent cinnamyl alcohol
           dehydrogenase family member with broad substrate
           specificity may be involved in fusel alcohol synthesis
           or in aldehyde tolerance
          Length = 360

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 90/361 (24%), Positives = 137/361 (37%), Gaps = 51/361 (14%)

Query: 26  EEIIVEPPK--AHEVRIRITYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGVVESVG-KG 82
           ++I  EP K   ++V + I    +C +D +  SG     + P ++GHE  G V  VG K 
Sbjct: 22  KKISYEPKKFDDYDVDVEIEACGICGSDTHCASGNWGPKSLPLVVGHEVIGRVVRVGPKC 81

Query: 83  VTNVKPGDHV-VALYTAECQKCKFCTSGKTNLCGSVRATQGKGVMPDGTSRFRTKNGESI 141
            T VK GD V V    + C  C  C S     C     T  +   PDG            
Sbjct: 82  HTGVKVGDRVGVGAQVSSCLDCDRCNSDFEPYCAEFITTYSQP-YPDG------------ 128

Query: 142 LHFMGCSTFSQYTXXXXXXXXXXXXQAPLDRICLLGCGVTTGYGAAIKT--ANVQKGDTV 199
             ++    ++ +             + P      L CG  T +   I       +K   V
Sbjct: 129 --YVSQGGYASHIRAHEHFVIPIPEKIPTHLAAPLLCGGITVFSPLINNDCGPNKKVGIV 186

Query: 200 AVFGAGTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFGATDFV----NPSKDLKEGE 255
            + G G +GL     AKA GA  +  +  +  KK+ A   GA  F+     P  + K   
Sbjct: 187 GIGGIGHMGLIF---AKALGA-EVYAISRSSAKKEDAMKLGADHFIATKEEPDWEKKYAS 242

Query: 256 TIVSKLIELTDGGLDFTFDCTGN-TKVMRDALEACHKGWGQSIIIGVAAAGQEISTRPFQ 314
           T            LD    C  + T++  + L    +  G+ I I V    +E++ +PFQ
Sbjct: 243 T------------LDLVIVCASSLTEINLEQLIKTMRIKGRIISICVPKETEELNLKPFQ 290

Query: 315 LVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGQLKVDEFITHRRPFTE--INAAFDDLHHG 372
           L +G     S  G    R E+  L+    D  LK+        P +E  ++ AF  +  G
Sbjct: 291 L-SGITIGNSQLG---SRKELIQLLQLVADKDLKI---WVETLPISEESVHDAFVRMEKG 343

Query: 373 D 373
           D
Sbjct: 344 D 344

>NCAS0C03020 Chr3 complement(593785..594873) [1089 bp, 362 aa] {ON} 
          Length = 362

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 87/348 (25%), Positives = 130/348 (37%), Gaps = 45/348 (12%)

Query: 36  HEVRIRITYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGVVESVGKGVTN-VKPGDHV-V 93
           H++ I++    VC +D +  SG   +   P ++GHE  G V  +G+   + +K GD V V
Sbjct: 36  HDIEIKVECCGVCGSDIHAASGNWGDLTKPLVVGHEIIGTVVRLGENCNSGLKLGDRVGV 95

Query: 94  ALYTAECQKCKFCTSGKTNLCGSVRATQGKGVMPDGTSRFRTKNGESILHFMGCSTFSQY 153
                 C  C+ C +     C     T G+   PDG   + +K G           ++ Y
Sbjct: 96  GAQVFSCLDCERCKNDNEPYCEGFVTTYGQD-YPDG---YSSKGG-----------YADY 140

Query: 154 TXXXXXXXXXXXXQAPLDRICLLGCGVTTGYGAAIKT--ANVQKGDTVAVFGAGTVGLSV 211
                          P      L CG  T Y   ++      +K   V + G G  GL  
Sbjct: 141 FRVHEHFAVPIPENIPSHLAAPLMCGGLTVYSPLVRNGCGPNKKVGIVGIGGIGHQGLLF 200

Query: 212 VQGAKARGASRIIVVDINDQKKQWASDFGATDFVNPSKDLKEGETIVS--KLIELTDGGL 269
              AKA GA  +  +     KK+ A   GA  F+   ++   G        LI +    L
Sbjct: 201 ---AKAMGA-EVYAISRTSAKKEDAMKLGADHFIATKEEPDWGTKYFDTFDLIVVCASSL 256

Query: 270 -DFTFDCTGNTKVMRDALEACHKGWGQSIIIGVAAAGQEISTRPFQLVTGRVWKGSAFGG 328
            D  F+   NT           K  G  + I V    + +S +PF L  G     SA G 
Sbjct: 257 TDVDFNTVPNTM----------KIGGSIVSISVPEQNETLSLKPFGL-KGVSISNSALGS 305

Query: 329 IKGRSEMGGLVSDYMDGQLKVDEFITHRRPFTE--INAAFDDLHHGDC 374
           I   SEM  L+    +  +K+        P  E  +  AF+ +  GDC
Sbjct: 306 I---SEMRDLLKLVSENNIKL---WVETIPIGEKGVKEAFERMDKGDC 347

>KAFR0A08730 Chr1 complement(1747657..1748739) [1083 bp, 360 aa]
           {ON} 
          Length = 360

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 75/309 (24%), Positives = 116/309 (37%), Gaps = 29/309 (9%)

Query: 36  HEVRIRITYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGVVESVGKGVTN-VKPGDHV-V 93
           +++ I+I    VC +D +  SG   +   P ++GHE  G V  VG   T+ +K GD V V
Sbjct: 34  NDIDIKIEACGVCGSDVHMASGNWGDVKKPLVVGHEIVGTVVKVGSKCTSGMKVGDRVGV 93

Query: 94  ALYTAECQKCKFCTSGKTNLCGSVRATQGKGVMPDGTSRFRTKNGESILHFMGCSTFSQY 153
                 C  C  C +     C +V  T G    PDG              + G   ++ Y
Sbjct: 94  GAQVHSCLTCDRCNNDNEQYCPNVVFTYGFD-YPDG--------------YNGKGGYANY 138

Query: 154 TXXXXXXXXXXXXQAPLDRICLLGCGVTTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQ 213
                          P      L CG  T Y   ++      G  V + G G +G   + 
Sbjct: 139 IRVHEHFAVPIPENIPTHLAAPLLCGGITVYSPLLRNG-CGPGKKVGILGIGGIGHMGII 197

Query: 214 GAKARGASRIIVVDINDQKKQWASDFGATDFVNPSKDLKEGETIVSKLIELTDGGLDFTF 273
            AK+ GA  +  +  +D KK+ A   GA  F+    +   G+             LD   
Sbjct: 198 FAKSMGA-EVYAISRSDAKKEDAFKLGADHFIATKDEPDWGKKYFDT--------LDLIV 248

Query: 274 DCTGNTK-VMRDALEACHKGWGQSIIIGVAAAGQEISTRPFQLVTGRVWKGSAFGGIKGR 332
            C G+ K V  D L       G+ + I +  A +++    F L  G     S+ G +   
Sbjct: 249 ICAGSLKDVDFDNLPKAMTVGGKVVSISIPEASEKLEFSAFGL-AGISIGNSSLGSMVEL 307

Query: 333 SEMGGLVSD 341
            ++  LVS+
Sbjct: 308 KQLLKLVSE 316

>NDAI0G04880 Chr7 complement(1175518..1176603) [1086 bp, 361 aa]
           {ON} 
          Length = 361

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 80/320 (25%), Positives = 123/320 (38%), Gaps = 31/320 (9%)

Query: 26  EEIIVEPPK--AHEVRIRITYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGVVESVGKGV 83
           +++  EP K   H++ I+I    VC +D +T SG   +   P ++GHE  G V  +G   
Sbjct: 23  KKVEYEPKKFLDHDIDIKIECCGVCGSDIHTASGHWGDITKPLVVGHEIIGTVVRLGDKC 82

Query: 84  TN-VKPGDHV-VALYTAECQKCKFCTSGKTNLCGSVRATQGKGVMPDGTSRFRTKNGESI 141
           T+ +K GD V V      C +C  C S     C     T       DG   + +K G   
Sbjct: 83  TSGLKLGDRVGVGAQAFSCLECGRCKSDNEPYCTKSVWTYSTN-YEDG---YNSKGG--- 135

Query: 142 LHFMGCSTFSQYTXXXXXXXXXXXXQAPLDRICLLGCGVTTGYGAAIKTANVQKGDTVAV 201
                   ++ Y               P      L CG  T +   ++     +G  V +
Sbjct: 136 --------YADYIRLHEHFAIPIPENIPSHLAAPLMCGGITAFSPLLRNG-CGRGKKVGI 186

Query: 202 FGAGTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFGATDFVNPSKDLKEGETIVSKL 261
            G G +G   +  AKA GA  +  +     KK  +   GA  F+      KE     +K 
Sbjct: 187 MGIGGIGHMALIFAKAMGA-EVYAISRTSAKKDDSIKMGADHFIA----TKEEPDWATKY 241

Query: 262 IELTDGGLDFTFDCTGN-TKVMRDALEACHKGWGQSIIIGVAAAGQEISTRPFQLVTGRV 320
            +      D    C+ + T +  D +    K  G+ + I      + I+ +PF L+ G  
Sbjct: 242 FDT----FDLIVVCSNSLTDINFDVVPRTMKVGGKIVSICAPEQNEVINLKPFGLL-GVS 296

Query: 321 WKGSAFGGIKGRSEMGGLVS 340
              SA GGI    +M  LVS
Sbjct: 297 ISNSALGGINEIKQMLDLVS 316

>CAGL0H06853g Chr8 complement(680184..681266) [1083 bp, 360 aa] {ON}
           highly similar to uniprot|Q04894 Saccharomyces
           cerevisiae YMR318c
          Length = 360

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 71/318 (22%), Positives = 117/318 (36%), Gaps = 29/318 (9%)

Query: 27  EIIVEPPKAHEVRIRITYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGVVESVG-KGVTN 85
           E   +P   H++ I+I    VC +D +  +G   +   P ++GHE  G V  +G K  T 
Sbjct: 25  EFPAKPFYDHDIDIKIDACGVCGSDIHCAAGNWGKKQTPLVVGHEIIGKVVKIGPKCNTG 84

Query: 86  VKPGDHV-VALYTAECQKCKFCTSGKTNLCGSVRATQGKGVMPDGTSRFRTKNGESILHF 144
           +K GD V V      C +C  C +     C     T  +    DG              +
Sbjct: 85  LKVGDRVGVGAQVFSCLECDRCKNDNEPYCPKFVTTYSQP-YEDG--------------Y 129

Query: 145 MGCSTFSQYTXXXXXXXXXXXXQAPLDRICLLGCGVTTGYGAAIKTANVQKGDTVAVFGA 204
           +    ++ Y               P      L CG  T Y   ++           V   
Sbjct: 130 VSQGGYANYVRVHEHFAVKIPENIPDHLAAPLLCGGITVYSPLLRNGCGPGKKVGIVGIG 189

Query: 205 GTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFGATDFVNPSKDLKEGETIVSKLIEL 264
           G   + ++  AKA GA  +  +  ++ KK+ +   GA  ++   ++   GE         
Sbjct: 190 GIGHMGLL-FAKAMGA-EVYAISRSNAKKEDSLKLGADHYIATKEEPNWGEKYFDT---- 243

Query: 265 TDGGLDFTFDCTGN-TKVMRDALEACHKGWGQSIIIGVAAAGQEISTRPFQLVTGRVWKG 323
                D    C  + T V  D +    K  G+ + I +    Q ++ +PF L+ G     
Sbjct: 244 ----FDLIVVCASSLTDVDFDVMPKAMKVGGRIVSISIPDEDQTLTMKPFGLL-GVSIAN 298

Query: 324 SAFGGIKGRSEMGGLVSD 341
           SA G IK   ++  LVS+
Sbjct: 299 SALGSIKEIEQLLKLVSE 316

>TPHA0M00930 Chr13 complement(180084..181115) [1032 bp, 343 aa] {ON}
           Anc_3.253 YBR046C
          Length = 343

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 66/262 (25%), Positives = 100/262 (38%), Gaps = 58/262 (22%)

Query: 34  KAHEVRIRITYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGVVESVGKGVT-NVKPGDHV 92
           K  E+ ++  Y+ V   +AY   G+ P    P ILG E  G V  VG+ +  + K GD V
Sbjct: 37  KDDEILVKNKYSGVNFIEAYFRKGIYP-CEHPYILGREAVGTVVYVGRRMAHDYKVGDSV 95

Query: 93  VALYTAECQKCKFC-TSGKTNLCGSVRATQGKGVMPDGTSRFRTKNGESILHFMGCSTFS 151
              Y       +F   S K+ +    +      +  + T     K   S+++ +   TF 
Sbjct: 96  A--YIGNSSMAQFTKVSAKSPIINMSKFY----IEEELTDELFQKYCASLINVLTVMTFI 149

Query: 152 QYTXXXXXXXXXXXXQAPLDRICLLGCGVTTGYGAAIKTANVQKGDTVAVF-GAGTVGLS 210
           +                                    ++  V+K D + V+  AG VGL 
Sbjct: 150 R------------------------------------ESYKVKKNDNILVYAAAGGVGLI 173

Query: 211 VVQGAKARGASRIIVVDINDQKKQWASDFGATDFVNPSKDLKEGETIVSKLIELTDG-GL 269
             Q     GA+ +I V  +D K Q A   GA   +N S D      IV K+ E T+G G+
Sbjct: 174 FDQLITKIGAT-VIAVASSDDKLQLAKLHGAKHLINSSTD-----DIVEKVNEYTNGKGV 227

Query: 270 DFTFDCTGNTKVMRDALEACHK 291
           +  FD  G     +D  E   K
Sbjct: 228 EAVFDSIG-----KDTFETSMK 244

>NDAI0A08470 Chr1 (1954035..1955126) [1092 bp, 363 aa] {ON} 
          Length = 363

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 81/352 (23%), Positives = 129/352 (36%), Gaps = 37/352 (10%)

Query: 27  EIIVEPPKAHEVRIRITYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGVVESVGKGVTN- 85
           E   +P   +++ I+I    VC +D +  +G   +   P ++GHE  G V  +G+   + 
Sbjct: 28  EFEPKPFYPNDIDIKIECCGVCGSDIHAAAGHWGDLEKPLVVGHEVIGTVVRLGENCNSG 87

Query: 86  VKPGDHV-VALYTAECQKCKFCTSGKTNLCGSVRATQGKGVMPDGTSRFRTKNGESILHF 144
           +K GD V V      C  C+ C S     C S   T G+    DG   + +K G      
Sbjct: 88  LKLGDRVGVGAQVFSCLDCERCKSNNEPYCPSFVTTYGQSYK-DG---YSSKGG------ 137

Query: 145 MGCSTFSQYTXXXXXXXXXXXXQAPLDRICLLGCGVTTGYGAAIKTANVQKGDTVAVFGA 204
                ++ Y               P      L CG  T +   ++           V   
Sbjct: 138 -----YADYIRVHEHFAVPIPENIPSHLAAPLMCGGITVFSPLLRNGCGPGKKVGIVGIG 192

Query: 205 GTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFGATDFVNPSKDLKEGETIVSKLIEL 264
           G   + ++  AKA GA  +  +     KK+ A   GA  F+   ++   G          
Sbjct: 193 GIGHMGLIF-AKAMGA-EVYAISRTSAKKEDAMKLGADHFIATKEEPDWGTKYFDT---- 246

Query: 265 TDGGLDFTFDCTGN-TKVMRDALEACHKGWGQSIIIGVAAAGQEISTRPFQLVTGRVWKG 323
                D    C  + T V  + +    K  G  + I V    + ++ +PF L+ G     
Sbjct: 247 ----FDLIVVCANSLTDVDFNVVPKAMKVGGNIVSICVPEQNEVLNLKPFGLL-GVSISN 301

Query: 324 SAFGGIKGRSEMGGLVSDYMDGQLKVDEFITHRRPFTE--INAAFDDLHHGD 373
           SA GG+K   E+  LVS      LK+        P  E  +  AF+ +  GD
Sbjct: 302 SALGGVKEIKELLDLVS---KNNLKI---WVETLPIGEEGVKQAFERMDKGD 347

>NCAS0D01220 Chr4 (223821..224909) [1089 bp, 362 aa] {ON} 
          Length = 362

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 45/96 (46%), Gaps = 3/96 (3%)

Query: 36  HEVRIRITYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGVVESVGKGVTN-VKPGDHV-V 93
           H+++I++    VC +D +  SG       P ++GHE  G V  VG    N +K GD V V
Sbjct: 34  HDIQIKVECCGVCGSDIHAASGHWGNIPTPLVVGHEIVGRVVKVGDRCDNGLKVGDRVGV 93

Query: 94  ALYTAECQKCKFCTSGKTNLCGSVRATQGKGVMPDG 129
                 C +C  C +   + C    AT G G  PDG
Sbjct: 94  GAQVFSCLECNRCKTDNESYCPKWVATYG-GEYPDG 128

>NCAS0I01730 Chr9 (319449..320498) [1050 bp, 349 aa] {ON} Anc_3.253
          Length = 349

 Score = 43.1 bits (100), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 30/91 (32%), Positives = 47/91 (51%), Gaps = 6/91 (6%)

Query: 17  YEAGKPLTVEEIIVEPPKAHEVRIRITYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGVV 76
           Y+  K  T++   VE   ++E+ I+ +Y+ +   +AY   G+ P    P + G E +G+V
Sbjct: 36  YDVIKYKTIQTPTVE--NSNEMVIKNSYSGINFIEAYFRKGIYP-CELPYLPGREASGIV 92

Query: 77  ESVGKGVTNVKPGDHVVALY---TAECQKCK 104
             VGK V N + GD V  L+    AE  K K
Sbjct: 93  AEVGKDVKNFQIGDKVAYLHGETMAEFTKIK 123

>CAGL0H09944g Chr8 complement(971519..972520) [1002 bp, 333 aa] {ON}
           similar to uniprot|P38230 Saccharomyces cerevisiae
           YBR046c ZTA1
          Length = 333

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 79/339 (23%), Positives = 125/339 (36%), Gaps = 78/339 (23%)

Query: 37  EVRIRITYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGVVESVGKGVTNVKPGDHVVALY 96
           +V ++  Y  V   +AY   G  P    P +LG E +G V  VG  V + K GD V    
Sbjct: 36  DVLVKNKYAGVNFIEAYFRKGYYP-CELPYVLGREASGEVVQVGSEVKDFKIGDKVA--- 91

Query: 97  TAECQKCKFCTSGKTNLCGSVRATQGKGVMPDGTSRFRTKNGESILHFMGCSTFSQYTXX 156
                                                          ++G STF+QYT  
Sbjct: 92  -----------------------------------------------YLGGSTFAQYTKK 104

Query: 157 XXXXXXXXXXQA-PLDRICLLGCGVT---TGYGAAIKTANVQKGDTVAVFGA-GTVGLSV 211
                     Q+ P + + L G  +    T      +   V +GD + V+ A G VG  +
Sbjct: 105 STENHIMNLGQSCPDEDLKLYGSSLVQCLTAISFIDEAYKVMEGDYILVYAASGGVGSIL 164

Query: 212 VQGAKARGASRIIVVDINDQKKQWASDFGATDFVNPSKDLKEGETIVSKLIELTDG-GLD 270
            Q    R A  +I V  + +K   A + GA   +N ++D      I+ K+++ T+G G+ 
Sbjct: 165 CQLISQRKA-HVIAVASSAEKLAMAKENGAEFLINYAED-----DILEKVMQYTNGKGVH 218

Query: 271 FTFDCTGNTKVMRDALEACHKG----WGQSIIIGVAAAGQEISTRPFQLVTGRVWKGSAF 326
             FD  G      D      KG    +G +  +    A  ++S +  +L+  +V+     
Sbjct: 219 AAFDSIGKDTFETDLAALRRKGTLVSFGNASGMVPPFAINKLSPKNLKLLRPQVY----- 273

Query: 327 GGIKGRSEMGGLVSDY----MDGQLKVDEFITHRRPFTE 361
           G +  RSE     S +        LKVD  I+   P +E
Sbjct: 274 GYLGTRSEWDHYCSIFKHFVQSKSLKVD--ISGIYPLSE 310

>CAGL0M14047g Chr13 complement(1386775..1387854) [1080 bp, 359 aa]
           {ON} highly similar to uniprot|Q04894 Saccharomyces
           cerevisiae YMR318c or uniprot|P25377 Saccharomyces
           cerevisiae YCR105w
          Length = 359

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 75/334 (22%), Positives = 126/334 (37%), Gaps = 31/334 (9%)

Query: 12  LAAVAYEAGKPLTVEEIIVEPPKAHEVRIRITYTAVCHTDAYTLSGVDPEGAFPSILGHE 71
           +A V ++  K     E   +P   ++V I+I    VC +D +  +G   +   P ++GHE
Sbjct: 9   IAVVDHKDWKNPKKVEFPAKPFYDNDVDIKIEACGVCGSDIHCAAGNWGQKQTPLVVGHE 68

Query: 72  GAGVVESVG-KGVTNVKPGDHV-VALYTAECQKCKFCTSGKTNLCGSVRATQGKGVMPDG 129
             G V  VG K  T +K GD V V      C +C+ C +     C               
Sbjct: 69  IIGKVVKVGPKCKTGLKIGDRVGVGAQVFSCLECERCKNDNEPYC--------------- 113

Query: 130 TSRFRTKNGESILH-FMGCSTFSQYTXXXXXXXXXXXXQAPLDRICLLGCGVTTGYGAAI 188
            +RF T   +     ++    ++ Y               P +    L CG  T Y   +
Sbjct: 114 -ARFVTTYSQPYEDGYVSQGGYANYVRVHEHFAVPIPENIPSEYAAPLLCGGLTVYSPLL 172

Query: 189 KTANVQKGDTVAVFGAGTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFGATDFVNPS 248
           +      G  V + G G +G   +  AKA GA  +  +  ++ KK+ +   GA  ++   
Sbjct: 173 RNG-CGPGKKVGILGIGGIGHMGILFAKAMGA-EVYAISRSNAKKEDSLKLGADHYIATK 230

Query: 249 KDLKEGETIVSKLIELTDGGLDFTFDCTGN-TKVMRDALEACHKGWGQSIIIGVAAAGQE 307
           ++   G               D    C  + T V  D +    K  G+ + I V    + 
Sbjct: 231 EEPDWGTKYFDT--------FDLIVVCASSLTDVDFDVMPKAMKVGGRIVSISVPEQDEV 282

Query: 308 ISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSD 341
           ++ +PF L+ G     S  G I    ++  LVS+
Sbjct: 283 LTMKPFGLI-GVSIANSILGSIAEMKQLLKLVSE 315

>NDAI0H02940 Chr8 complement(717073..718158) [1086 bp, 361 aa] {ON} 
          Length = 361

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 34/105 (32%), Positives = 46/105 (43%), Gaps = 6/105 (5%)

Query: 32  PPKA---HEVRIRITYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGVVESVGKGVTN-VK 87
           PPK     +V I+I    VC +D +  SG   +   P I+GHE  G V  +G    N +K
Sbjct: 28  PPKPFHDRDVDIKIECCGVCGSDIHAASGHWGDIEKPLIVGHEIIGTVVKLGSKCENGLK 87

Query: 88  PGDHV-VALYTAECQKCKFCTSGKTNLCGSVRATQGKGVMPDGTS 131
            GD V +      C KC  C +   + C     T G    PDG +
Sbjct: 88  LGDRVGMGAQCYSCLKCDRCLNNNESYCQHFVTTYGMN-YPDGYA 131

>Suva_13.513 Chr13 complement(894394..895476) [1083 bp, 360 aa] {ON}
           YMR318C (REAL)
          Length = 360

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 69/316 (21%), Positives = 119/316 (37%), Gaps = 33/316 (10%)

Query: 31  EPPKAHEVRIRITYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGVVESVG-KGVTNVKPG 89
           +P   H+V I+I    VC +D +  +G   +   P ++GHE  G V  +G K  + ++ G
Sbjct: 29  KPFYDHDVDIKIEACGVCGSDIHCAAGNWGKKKMPLVVGHEIVGTVVKLGSKSNSGLQVG 88

Query: 90  DHV-VALYTAECQKCKFCTSGKTNLCGSVRATQGKGVMPDGTSRFRTKNGESILHFMGCS 148
             V +      C +C  C S     C     T G+    DG              ++   
Sbjct: 89  QRVGMGAQVFSCLECDRCKSDNEPYCTKFVTTYGQP-YEDG--------------YVSQG 133

Query: 149 TFSQYTXXXXXXXXXXXXQAPLDRICLLGCGVTTGYGAAIKT--ANVQKGDTVAVFGAGT 206
            ++ Y               P      L CG  T Y   ++      +K   V   G G+
Sbjct: 134 GYADYVRVHEHFVVPIPENIPSHLAAPLLCGGLTAYSPLVRNGCGPGKKVGIVGFGGIGS 193

Query: 207 VGLSVVQGAKARGASRIIVVDINDQKKQWASDFGATDFVNPSKDLKEGETIVSKLIELTD 266
           +G  +   AKA GA    V+  + +K++ A   GA  ++   ++   GE           
Sbjct: 194 MGTLI---AKAMGA-ETYVISRSSKKREDAMKMGADHYIATLEEENWGEKYFDT------ 243

Query: 267 GGLDFTFDCTGN-TKVMRDALEACHKGWGQSIIIGVAAAGQEISTRPFQLVTGRVWKGSA 325
              D    C  + T +  D +    K  G+ + I +    + ++ +P+ L    +   SA
Sbjct: 244 --FDLIVVCASSLTGIDFDVMPKAMKVGGRIVSISIPEQHEVLTLKPYGLKAVSI-SYSA 300

Query: 326 FGGIKGRSEMGGLVSD 341
            G IK   ++  LVS+
Sbjct: 301 LGSIKELKQLLKLVSE 316

>Skud_86.1 Chr86 complement(469..738) [270 bp, 89 aa] {ON} YJR159W
           (REAL)
          Length = 89

 Score = 37.7 bits (86), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 24/59 (40%), Positives = 33/59 (55%), Gaps = 2/59 (3%)

Query: 221 SRIIVVDINDQKKQWASDFGATDFVNPSK-DLKEGETIVSKLIELTDG-GLDFTFDCTG 277
           S +I VD+ D K Q A DFGAT   N SK  + E + +  +L +L  G   D  F+C+G
Sbjct: 1   SDVIFVDVFDNKLQRAKDFGATGTFNSSKFSVDEAQQLADELEKLLGGHQADVVFECSG 59

>KNAG0B06990 Chr2 (1393058..1394134) [1077 bp, 358 aa] {ON} 
          Length = 358

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 73/308 (23%), Positives = 110/308 (35%), Gaps = 29/308 (9%)

Query: 36  HEVRIRITYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGVVESVG-KGVTNVKPGDHV-V 93
           H++ IR+    VC +D +  SG   E   P ++GHE  G+V   G +  + +K  D V V
Sbjct: 34  HDIDIRVLACGVCGSDIHCASGHWGEIPKPLVVGHEIIGIVVKTGPRCDSGLKVEDRVGV 93

Query: 94  ALYTAECQKCKFCTSGKTNLCGSVRATQGKGVMPDGTSRFRTKNGESILHFMGCSTFSQY 153
                 C  C  CT      C +  +T  K    DG              ++    ++ Y
Sbjct: 94  GAQALSCLDCDRCTHDNEPYCPNRVSTYAKSYR-DG--------------YVSQGGYADY 138

Query: 154 TXXXXXXXXXXXXQAPLDRICLLGCGVTTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQ 213
                          P      L CG  T +   ++      G  V + G G +G   V 
Sbjct: 139 VRVHEHFAVLIPESIPSHLAAPLMCGGLTVFSPLLRNG-CGPGKKVGILGIGGIGHMGVL 197

Query: 214 GAKARGASRIIVVDINDQKKQWASDFGATDFVNPSKDLKEGETIVSKLIELTDGGLDFTF 273
            AKA GA  +  +     KK  A   G   F+   ++    E             LD   
Sbjct: 198 LAKAMGA-EVYAISRTSSKKADAVKLGTDHFIATKEEPDWHEKYFDT--------LDLLV 248

Query: 274 DCTGN-TKVMRDALEACHKGWGQSIIIGVAAAGQEISTRPFQLVTGRVWKGSAFGGIKGR 332
            C G+ T V  D L       G+ + I +    + +  +PF LV G     S  G +K  
Sbjct: 249 ICAGSLTDVDFDTLPKIMTVGGRVVSIAIPEQHEILKLKPFGLV-GVSIANSLLGSMKEL 307

Query: 333 SEMGGLVS 340
            E+  LV+
Sbjct: 308 KELLELVA 315

>KLTH0B00506g Chr2 complement(53662..54858) [1197 bp, 398 aa] {ON}
           weakly similar to uniprot|P53912 Saccharomyces
           cerevisiae YNL134C
          Length = 398

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 72/321 (22%), Positives = 129/321 (40%), Gaps = 58/321 (18%)

Query: 8   PITCLAAVAYEAGKPLTVEEIIVEPPKA--HEVRIRITYTAVCHTDAYTLSGVDPEGAFP 65
           P+   AAV     + + V + I  P +   HE+ IR  YT + H D  +        +FP
Sbjct: 42  PLFQQAAVVKSFEEEIIVSDQIPVPQRLEDHEILIRNKYTGLNHVDWKSKKYRFNIHSFP 101

Query: 66  SILGHEGAGVVESVGKGVTNVK-PGDHVVALYTAECQKCKFCTSGKTNLCGSVRATQ-GK 123
            I G E +G+V   G  V   + P    V L +   ++ K  T  +  +  S    +  +
Sbjct: 102 WINGRESSGIVVRRGAKVDRDRFPIGAEVFLASTCYRELKTSTFQEFTVFDSRLVWRLPR 161

Query: 124 GVMPDGTSRFRTKNGESILHFMGCSTFSQYTXXXXXXXXXXXXQAPLDRICLLGCGVTTG 183
            ++PDGT+R R                                   LD    +G  + T 
Sbjct: 162 EILPDGTTRKRFG---------------------------------LDFAAGVGVPLVTA 188

Query: 184 YGAAIKT-------ANVQKGDTVAVF-GAGTVGLSVVQGAKARGASRIIVVDINDQKKQW 235
            G+A+ +           +G ++ V+ G+ +VG+  +Q A+  G  + I+   + + + +
Sbjct: 189 -GSALSSFVDFNEIGKADQGRSLVVWGGSSSVGIFTIQLARNLGIFKNIIAVSSLRYEDY 247

Query: 236 ASDFGATDFVN---PSKDLKEGETIVSKLIELTDGGLDFTFDCTGNTKVMRDALEACHKG 292
             + GAT  ++   PS++L      V K  EL   G+D+  D   + K     LE    G
Sbjct: 248 LKELGATAVIDRTLPSEEL------VQKFQELCPTGVDYGVDVI-SKKTAELVLEILKDG 300

Query: 293 WG--QSIIIGVAAAGQEISTR 311
            G  +S++    A G+++  +
Sbjct: 301 KGTKKSLVCLSGAPGEDVRAK 321

>Skud_13.494 Chr13 complement(884038..885120) [1083 bp, 360 aa] {ON}
           YMR318C (REAL)
          Length = 360

 Score = 39.3 bits (90), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 71/316 (22%), Positives = 117/316 (37%), Gaps = 33/316 (10%)

Query: 31  EPPKAHEVRIRITYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGVVESVG-KGVTNVKPG 89
           +P   H+V I+I    VC +D +  +G       P ++GHE  G V  +G K  + +K G
Sbjct: 29  KPFYDHDVDIKIEACGVCGSDVHCAAGHWGNKQLPLVVGHEIVGKVVKLGPKSNSGLKIG 88

Query: 90  DHV-VALYTAECQKCKFCTSGKTNLCGSVRATQGKGVMPDGTSRFRTKNGESILHFMGCS 148
             V V      C +C  C S     C     T  +    DG              ++   
Sbjct: 89  QRVGVGAQVFSCLECNRCKSDNEPYCTKFVTTYSQP-YEDG--------------YVSQG 133

Query: 149 TFSQYTXXXXXXXXXXXXQAPLDRICLLGCGVTTGYGAAIKT--ANVQKGDTVAVFGAGT 206
            ++ Y               P      L CG  T Y   I+      +K   V   G G+
Sbjct: 134 GYANYVRVHEHFVVPVPKNIPSHLAAPLLCGGLTVYSPLIRNGCGPGKKVGIVGFGGIGS 193

Query: 207 VGLSVVQGAKARGASRIIVVDINDQKKQWASDFGATDFVNPSKDLKEGETIVSKLIELTD 266
           +G  +   AKA GA    V+  + +KK+ A   GA  ++   ++   GE           
Sbjct: 194 MGSLI---AKAMGA-ETYVISRSSKKKEDAMKMGADHYIATLEEEDWGEKYFDT------ 243

Query: 267 GGLDFTFDCTGN-TKVMRDALEACHKGWGQSIIIGVAAAGQEISTRPFQLVTGRVWKGSA 325
              D    C  + T +  + +    K  G+ + I +    + ++ +P+ L    +   SA
Sbjct: 244 --FDLIVVCASSLTGIDFNVMPKAMKVGGRIVSISIPEQHEMLTLKPYGLKAVSI-SYSA 300

Query: 326 FGGIKGRSEMGGLVSD 341
            G IK   ++  LVS+
Sbjct: 301 LGSIKELKQLLKLVSE 316

>KLLA0E19889g Chr5 (1770061..1771161) [1101 bp, 366 aa] {ON} similar
           to uniprot|Q04894 Saccharomyces cerevisiae YMR318C ADH6
           NADPH-dependent cinnamyl alcohol dehydrogenase family
           member with broad substrate specificity may be involved
           in fusel alcohol synthesis or in aldehyde tolerance
          Length = 366

 Score = 39.3 bits (90), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 33/108 (30%), Positives = 44/108 (40%), Gaps = 5/108 (4%)

Query: 27  EIIVEPPK---AHEVRIRITYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGVVESVG-KG 82
           E +V P K     +V I I    VC +D +   G   E   P ++GHE  G V  +G K 
Sbjct: 23  EKVVYPAKQFNPRDVDIEIEACGVCGSDVHCAKGNWGEMKLPLVVGHEIIGKVVRLGDKC 82

Query: 83  VTNVKPGDHV-VALYTAECQKCKFCTSGKTNLCGSVRATQGKGVMPDG 129
            T +K GD V V    + C  C  C +     C     T  +    DG
Sbjct: 83  DTGLKVGDRVGVGAQVSACLDCNRCNNDNEQYCPKFVTTYSQPYFEDG 130

>KNAG0K02680 Chr11 complement(531173..532252) [1080 bp, 359 aa] {ON}
           
          Length = 359

 Score = 37.7 bits (86), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 62/284 (21%), Positives = 102/284 (35%), Gaps = 28/284 (9%)

Query: 36  HEVRIRITYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGVVESVG-KGVTNVKPGDHV-V 93
           H++ I+I    VC +D +  SG   +   P ++GHE  G +  +G K  +  K GD V +
Sbjct: 34  HDIDIKIEACGVCGSDVHCASGNWGDTPKPLVVGHEIIGTIVKMGPKCNSGYKIGDRVGM 93

Query: 94  ALYTAECQKCKFCTSGKTNLCGSVRATQGKGVMPDGTSRFRTKNGESILHFMGCSTFSQY 153
                 C +C  C +     C  V  T         +SR                 ++ Y
Sbjct: 94  GAQAMSCLECDRCINDNEPYCAKVVCTYANPYEDGYSSR---------------GGYANY 138

Query: 154 TXXXXXXXXXXXXQAPLDRICLLGCGVTTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQ 213
                          P      L CG  T + + +K      G  V + G G +G   + 
Sbjct: 139 VRVHEHFAVPIPESIPSHLAAPLMCGGLTVF-SPLKRNGCGPGKKVGIIGIGGIGHMGII 197

Query: 214 GAKARGASRIIVVDINDQKKQWASDFGATDFVNPSKDLKEGETIVSKLIELTDGGLDFTF 273
            AKA GA  +  +    +K+  A   GA  F+   ++    +    K        LD   
Sbjct: 198 LAKAMGA-EVYAISRTSKKRDDAMKLGADHFIAIKEEPDWHKEYFDK--------LDLVV 248

Query: 274 DCTGN-TKVMRDALEACHKGWGQSIIIGVAAAGQEISTRPFQLV 316
            C G+ T +  + L       G+ + I +    + +  +PF LV
Sbjct: 249 ICAGSLTDIDFNTLPNILTVGGRIVSIAIPEQHEVLKMKPFGLV 292

>Smik_13.535 Chr13 complement(893727..894809) [1083 bp, 360 aa] {ON}
           YMR318C (REAL)
          Length = 360

 Score = 37.4 bits (85), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 69/316 (21%), Positives = 118/316 (37%), Gaps = 33/316 (10%)

Query: 31  EPPKAHEVRIRITYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGVVESVG-KGVTNVKPG 89
           +P   H+V I+I    VC +D +  +G       P ++GHE  G V  +G K  + +K G
Sbjct: 29  KPFYDHDVDIKIEACGVCGSDVHCAAGHWGNMKMPLVVGHEIVGKVVRLGDKSNSGLKVG 88

Query: 90  DHV-VALYTAECQKCKFCTSGKTNLCGSVRATQGKGVMPDGTSRFRTKNGESILHFMGCS 148
             V V      C +C  C S     C     T  +    DG              ++   
Sbjct: 89  QRVGVGAQVFSCLECDRCKSDNEPYCTKFVTTYSQP-YEDG--------------YISQG 133

Query: 149 TFSQYTXXXXXXXXXXXXQAPLDRICLLGCGVTTGYGAAIKT--ANVQKGDTVAVFGAGT 206
            ++ Y               P      L CG  T Y   ++      +K   V + G G+
Sbjct: 134 GYANYVRVHEHFIVPIPENVPSHLAAPLLCGGLTVYSPLVRNGCGPGKKVGIVGLGGIGS 193

Query: 207 VGLSVVQGAKARGASRIIVVDINDQKKQWASDFGATDFVNPSKDLKEGETIVSKLIELTD 266
           +G  +   +KA GA    V+  + +KK+ A   GA  ++   ++   GE           
Sbjct: 194 MGTLI---SKAMGA-ETYVISRSSKKKEDAIKMGADHYIATLEEGDWGEKYFDT------ 243

Query: 267 GGLDFTFDCTGN-TKVMRDALEACHKGWGQSIIIGVAAAGQEISTRPFQLVTGRVWKGSA 325
              D    C  + T +  + +    K  G+ + I +    + ++ +P+ L    +   SA
Sbjct: 244 --FDLIVVCASSLTDIDFNIMPKAMKVGGRIVSISIPEQHEMLTLKPYGLKAVSI-SYSA 300

Query: 326 FGGIKGRSEMGGLVSD 341
            G IK   ++  LVS+
Sbjct: 301 LGSIKELKQLLALVSE 316

>SAKL0H00374g Chr8 (45725..47011) [1287 bp, 428 aa] {ON} weakly
           similar to uniprot|P07246 Saccharomyces cerevisiae
           YMR083W ADH3 Alcohol dehydrogenase isoenzyme III, shows
           a high affinity for alcohols with a double bond
           conjugated to the alcohol group
          Length = 428

 Score = 37.4 bits (85), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 74/316 (23%), Positives = 112/316 (35%), Gaps = 54/316 (17%)

Query: 18  EAGKPLTVEEIIVEPPKAHEVRIRITYTAVCHTDAYTLSGVDPEGAFPS----ILGHEGA 73
           E  K   +E   V+  K H+  ++I    +CH+D   L     +G FP+     +GHE  
Sbjct: 93  ENNKLEYLENYRVQSLKPHQGLLKIKAVGLCHSDLTIL-----KGGFPASQRYAMGHEIC 147

Query: 74  GVVESVGKGVTNVKPGDHVVALYTAECQKCKFCTSGKTNLCGSVRATQGKGVMPDGTSRF 133
           G +            G+    +  A C  C  C  G  + C                   
Sbjct: 148 GELVQTYADEPKYAVGELYTVVGNAPCGGCDSCKKGWESCC------------------- 188

Query: 134 RTKNGESILHFMGCS------TFSQYTXXXXXXXXXXXXQ-APLDRICLLGC-GVTTGYG 185
            T NGE       C        +++Y             +      IC +    V T Y 
Sbjct: 189 -TANGEKACGLGQCYGIGRDGGYAEYIAIDLRHLVKVPKELVNKPEICAVATDAVLTPYH 247

Query: 186 AAIKTANVQKGD--TVAVFGAGTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFGATD 243
           A        K       V G G +GL+ +Q A A G SR+I VD  D + Q A++ GA  
Sbjct: 248 AIKNIPGFAKTPDYCTLVIGLGGLGLNGMQVANALG-SRVICVDFKDSQLQKATEMGA-- 304

Query: 244 FVNPSKDLKEGETIVSKLIELTDGGLDFTFDCTGNTKVMRDALEACHKGWGQSIIIGVAA 303
                      E +  +L      G+D   D  G+T  +  A+    K  G   ++G++A
Sbjct: 305 -----------EQVFKQLPTDASLGVDAVVDFVGHTSTIASAMFHL-KPHGFLALVGISA 352

Query: 304 AGQEISTRPFQLVTGR 319
           AG EI       + G+
Sbjct: 353 AGYEIRFPALSYMLGK 368

>SAKL0C00264g Chr3 complement(17429..18508) [1080 bp, 359 aa] {ON}
           highly similar to uniprot|Q04894 Saccharomyces
           cerevisiae YMR318C ADH6 NADPH-dependent cinnamyl alcohol
           dehydrogenase family member with broad substrate
           specificity may be involved in fusel alcohol synthesis
           or in aldehyde tolerance
          Length = 359

 Score = 37.4 bits (85), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 80/348 (22%), Positives = 123/348 (35%), Gaps = 37/348 (10%)

Query: 31  EPPKAHEVRIRITYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGVVESVG-KGVTNVKPG 89
           +P   ++V I I    VC +D +  +G   +   P ++GHE  G V  VG K  T VK G
Sbjct: 29  KPFYDNDVDIEIDACGVCGSDVHCAAGHWGDTQKPLVVGHEVIGRVVRVGPKCHTGVKIG 88

Query: 90  DHV-VALYTAECQKCKFCTSGKTNLCGSVRATQGKGVMPDGTSRFRTKNGESILHFMGCS 148
           D V V      C KC  C S     C     T  +    DG              ++   
Sbjct: 89  DRVGVGAQVYSCLKCDRCKSDNEPYCPKFVTTYSQP-YEDG--------------YVSQG 133

Query: 149 TFSQYTXXXXXXXXXXXXQAPLDRICLLGCGVTTGYGAAIKTANVQKGDTVAVFGAGTVG 208
            ++ +               P      L CG  T Y    +           V   G   
Sbjct: 134 GYASHIRCHEHFVIPIPENIPTHLAAPLLCGGITVYSPLSRNGCGPGKKVGIVGIGGIGH 193

Query: 209 LSVVQGAKARGASRIIVVDINDQKKQWASDFGATDFVNPSKDLKEGETIVSKLIELTDGG 268
           + ++  AKA GA  +  +  +  KK+ AS  GA  F+      KE E    K  +     
Sbjct: 194 MGLI-FAKAMGA-EVYAISRSSAKKEDASKLGADHFIA----TKEEENWSQKYFDT---- 243

Query: 269 LDFTFDCTGN-TKVMRDALEACHKGWGQSIIIGVAAAGQEISTRPFQLVTGRVWKGSAFG 327
            D    C  + T V  D +    K  G+ + I V    + +  +P  L+   +    +  
Sbjct: 244 FDLVVVCASSLTDVDFDKMSRVMKIGGKIVSISVPEQSERLVLKPLGLLGVSI----SNS 299

Query: 328 GIKGRSEMGGLVSDYMDGQLKVDEFITHRRPFTE--INAAFDDLHHGD 373
           G+  R E+  L+    +  LK+        P  E  +  AF+ +  GD
Sbjct: 300 GLGSRKEIIQLLQLVSEKNLKI---WVETLPVGEKGVREAFERMDKGD 344

>Kpol_257.4 s257 complement(12348..13430) [1083 bp, 360 aa] {ON}
           complement(12348..13430) [1083 nt, 361 aa]
          Length = 360

 Score = 37.0 bits (84), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 33/108 (30%), Positives = 46/108 (42%), Gaps = 5/108 (4%)

Query: 26  EEIIVEPPK--AHEVRIRITYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGVVESVG-KG 82
           + +  EP K    +V ++I    VC +D +  +          ++GHE  G V  VG K 
Sbjct: 22  KRVTYEPKKFDDQDVDVKIEACGVCGSDIHCAASHWGPVVKNQVVGHEIVGRVVKVGPKC 81

Query: 83  VTNVKPGDHV-VALYTAECQKCKFCTSGKTNLCGSVRATQGKGVMPDG 129
            T +K GD V V    A C  C  C +     C  V  T G+   PDG
Sbjct: 82  TTGIKIGDRVGVGAQVASCLDCSRCQNDNEPYCPRVVTTYGQA-YPDG 128

>KLLA0F00638g Chr6 (51849..52997) [1149 bp, 382 aa] {ON} weakly
           similar to uniprot|P53912 Saccharomyces cerevisiae or
           YLR460C uniprot|P54007 Saccharomyces cerevisiae YLR460C
           Hypothetical ORFs
          Length = 382

 Score = 36.6 bits (83), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 52/247 (21%), Positives = 98/247 (39%), Gaps = 50/247 (20%)

Query: 34  KAHEVRIRITYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGVVESVGKGVTNVKPGDHVV 93
           K +E+ I+  Y  + H D  +        +FP + G E +G+V         V+ G+ V 
Sbjct: 72  KPYEILIKNKYIGLNHVDWKSKKYRFSIYSFPWVNGRESSGIV---------VRRGEKV- 121

Query: 94  ALYTAECQKCKFCTSGKTNLCGSVRATQGKGVMPDGTSRFRTKNGESILHFMGCSTFSQY 153
                   + KF   G+  +  +                +R          +  STF +Y
Sbjct: 122 -------DEEKFPLGGEVFIASTT---------------YRD---------LRTSTFQEY 150

Query: 154 TXXXXXXXXXXXXQAPLDRICLLGCGVTTGYGAAIKTANV----QKGDTVAVFGAGT-VG 208
           T            +  LD    +G  + T   A     NV    ++  ++ ++G  T VG
Sbjct: 151 TVFDSRLVWRVPERIGLDFASGIGVSLVTAGAALASKRNVKVQPEEKKSIVIWGGSTGVG 210

Query: 209 LSVVQGAKARGASRIIVVDINDQKKQWASDFGATDFVNPSKDLKEGETIVSKLIELTDGG 268
           + VVQ AK+ G ++II +  + + +Q+    GAT  ++     ++ E IV+++ ++   G
Sbjct: 211 IFVVQLAKSLGFTKIITIT-SKKHEQYLLSLGATHIIHRE---EKTEDIVNEIKKICPNG 266

Query: 269 LDFTFDC 275
           +    D 
Sbjct: 267 VSHGVDL 273

>YMR318C Chr13 complement(911061..912143) [1083 bp, 360 aa] {ON}
           ADH6NADPH-dependent medium chain alcohol dehydrogenase
           with broad substrate specificity; member of the cinnamyl
           family of alcohol dehydrogenases; may be involved in
           fusel alcohol synthesis or in aldehyde tolerance
          Length = 360

 Score = 36.6 bits (83), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 75/350 (21%), Positives = 134/350 (38%), Gaps = 41/350 (11%)

Query: 31  EPPKAHEVRIRITYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGVVESVG-KGVTNVKPG 89
           +P   H++ I+I    VC +D +  +G       P ++GHE  G V  +G K  + +K G
Sbjct: 29  KPFYDHDIDIKIEACGVCGSDIHCAAGHWGNMKMPLVVGHEIVGKVVKLGPKSNSGLKVG 88

Query: 90  DHV-VALYTAECQKCKFCTSGKTNLCGSVRATQGKGVMPDGTSRFRTKNGESILHFMGCS 148
             V V      C +C  C +     C     T  +    DG              ++   
Sbjct: 89  QRVGVGAQVFSCLECDRCKNDNEPYCTKFVTTYSQP-YEDG--------------YVSQG 133

Query: 149 TFSQYTXXXXXXXXXXXXQAPLDRICLLGCGVTTGYGAAIKT--ANVQKGDTVAVFGAGT 206
            ++ Y               P      L CG  T Y   ++      +K   V + G G+
Sbjct: 134 GYANYVRVHEHFVVPIPENIPSHLAAPLLCGGLTVYSPLVRNGCGPGKKVGIVGLGGIGS 193

Query: 207 VGLSVVQGAKARGASRIIVVDINDQKKQWASDFGATDFVNPSKDLKEGETIVSKLIELTD 266
           +G  +   +KA GA    V+  + +K++ A   GA  ++   ++   GE           
Sbjct: 194 MGTLI---SKAMGA-ETYVISRSSRKREDAMKMGADHYIATLEEGDWGEKYFDT------ 243

Query: 267 GGLDFTFDCTGN-TKVMRDALEACHKGWGQSIIIGVAAAGQEISTRPFQLVTGRVWKGSA 325
              D    C  + T +  + +    K  G+ + I +    + +S +P+ L    +   SA
Sbjct: 244 --FDLIVVCASSLTDIDFNIMPKAMKVGGRIVSISIPEQHEMLSLKPYGLKAVSI-SYSA 300

Query: 326 FGGIKGRSEMGGLVSDYMDGQLKVDEFITHRRPFTE--INAAFDDLHHGD 373
            G IK  +++  LVS+  D ++ V+       P  E  ++ AF+ +  GD
Sbjct: 301 LGSIKELNQLLKLVSE-KDIKIWVETL-----PVGEAGVHEAFERMEKGD 344

>Smik_26.3 Chr26 (2136..2513) [378 bp, 125 aa] {ON} YMR318C (REAL)
          Length = 125

 Score = 33.9 bits (76), Expect = 0.21,   Method: Composition-based stats.
 Identities = 25/93 (26%), Positives = 41/93 (44%), Gaps = 4/93 (4%)

Query: 26  EEIIVEPPKAH--EVRIRITYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGVVESVGKGV 83
           ++I  EP   +  +V I++    VC +D +  +G       P + GHE  G +  +G   
Sbjct: 22  KKISYEPKSFYPEDVEIKVEACGVCGSDIHCAAGHWGPRNDPLVAGHEIVGRIVRMGSRC 81

Query: 84  TNVKPGDHVVAL--YTAECQKCKFCTSGKTNLC 114
           ++    D  V +   T  C KC  C  G+ N C
Sbjct: 82  SSQLKVDMRVGMGAITFSCLKCSGCKKGEENYC 114

>Kpol_529.30 s529 (89344..90426) [1083 bp, 360 aa] {ON}
           (89344..90426) [1083 nt, 361 aa]
          Length = 360

 Score = 35.0 bits (79), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 33/108 (30%), Positives = 47/108 (43%), Gaps = 5/108 (4%)

Query: 26  EEIIVEPPKAHE--VRIRITYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGVVESVG-KG 82
           +++  EP K  +  V I+I    VC +D +  +          ++GHE  G V  VG K 
Sbjct: 22  KKVTYEPKKFDDQDVDIKIEACGVCGSDIHCAASHWGPVVKNQVVGHEIVGRVVKVGPKC 81

Query: 83  VTNVKPGDHV-VALYTAECQKCKFCTSGKTNLCGSVRATQGKGVMPDG 129
            T +K GD V V    A C +C  C +     C     T G+   PDG
Sbjct: 82  TTGIKIGDRVGVGAQVASCLECSRCQNDNEPYCPRFVTTYGQP-YPDG 128

>Ecym_1093 Chr1 complement(195854..197005) [1152 bp, 383 aa] {ON}
           similar to Saccharomyces cerevisiae YMR318C ADH6 /
           YCR105W ADH7
          Length = 383

 Score = 35.0 bits (79), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 60/295 (20%), Positives = 106/295 (35%), Gaps = 50/295 (16%)

Query: 35  AHEVRIRITYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGVVESVGKGVTN-VKPGDHV- 92
           A ++ +++    VC +D +  +G       P ++GHE  G V  VG G    +K GD V 
Sbjct: 56  ARDIVLKVEACGVCGSDIHCAAGHWGPRNNPLVVGHEIIGRVIEVGSGCKEGLKVGDRVG 115

Query: 93  VALYTAECQKCKFCTSGKTNLCGSVRATQGKGVMPDGTSRFRTKNGESILHFMGCSTFSQ 152
           V      C +C  C S     C ++           GT  F   +G     ++    ++ 
Sbjct: 116 VGAQALSCLECSRCESENEQYCSNM----------TGTYNFPYPDG-----YISQGGYAS 160

Query: 153 YTXXXXXXXXXXXXQAPLDRICLLGCGVTTGYGAAIKTANVQKGDT-----------VAV 201
           +               P      L CG  T +   +++ NV  G +           +AV
Sbjct: 161 HVIVHEHFAIPIPDNIPSHLAAPLMCGGITAFSPLLRS-NVGPGTSVGVVGIGGIGHMAV 219

Query: 202 FGAGTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFGATDFVNPSKDLKEGETIVSKL 261
             A  +G +V   ++               KK  A   GA  ++   +D    +T  +  
Sbjct: 220 IFAKALGANVTAISR------------RSNKKDDALKLGADVYIAAVEDKDWHKTYANT- 266

Query: 262 IELTDGGLDFTFDCTGN-TKVMRDALEACHKGWGQSIIIGVAAAGQEISTRPFQL 315
                  LD    C+ + T++  D + +  K  G+ + I +  A + +  RP  L
Sbjct: 267 -------LDLIVVCSSSLTELDFDRIPSLLKVGGKVLSIAIPEASERLVLRPLLL 314

>Suva_6.13 Chr6 (21861..22031,22035..22067) [204 bp, 68 aa] {ON}
           YJR159W (REAL)
          Length = 68

 Score = 32.3 bits (72), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 30/59 (50%), Gaps = 1/59 (1%)

Query: 187 AIKTANVQKGDTVAVFGAGTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFGATDFV 245
           A++   V+ GD V V     +GL V    +  G  +++++   D KKQ +  FG T F+
Sbjct: 11  AVRLPQVKYGDCVVVISVRAIGLLVDAVFREFGVDKVVLMSTQDSKKQ-SEQFGGTGFI 68

>TDEL0F02300 Chr6 complement(421372..422511) [1140 bp, 379 aa] {ON} 
          Length = 379

 Score = 35.0 bits (79), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 64/300 (21%), Positives = 106/300 (35%), Gaps = 38/300 (12%)

Query: 31  EPPK--AHEVRIRITYTAVCHTDAYTLSG----------VDPEGAFPSILGHEGAGVVES 78
           EP K   H++ I +    +C ++ ++L                G    ++GHE  G V  
Sbjct: 31  EPKKFGEHDIDIEVECCGICASELFSLKNEWSNAPLACLSSSYGPKSQVVGHEVIGKVVK 90

Query: 79  VGKGVTNVKPGDHV-VALYTAECQKCKFCTSGKTNLCGSVRATQGKGVMPDGTSRFRTKN 137
           VG+ VT  K G  V +    + C +C  C+S     C     T      PDG        
Sbjct: 91  VGEKVTLAKLGQRVGLGAQASSCMQCGRCSSNNEQYCLKSVGTYCSR-YPDG-------- 141

Query: 138 GESILHFMGCSTFSQYTXXXXXXXXXXXXQAPLDRICLLGCGVTTGYGAAIKTANVQKGD 197
                 ++    ++ +               P   +  L CG  T Y    +     +  
Sbjct: 142 ------YVSQGGYASHVRAHEQFCFPIPDDVPSAFVAPLMCGGLTVYSPIKRNIEGVEKP 195

Query: 198 TVAVFGAGTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFGATDFVNPSKDLKEGETI 257
            V + G G +G   +  AKA GA  +     +++KK  A   GA  FV       E E  
Sbjct: 196 KVGIIGIGGLGHMAIMIAKALGA-EVTAFSRSNKKKDDAIKMGAQYFVATG----EEENW 250

Query: 258 VSKLIELTDGGLDFTFDCTGNTKVMR-DALEACHKGWGQSIIIGVAAAGQEISTRPFQLV 316
            S+L +          +C  +T  +  +A  +  K   Q + +G+   G+     PF  +
Sbjct: 251 SSRLAD----NFHLVLNCASSTTSLDLNAFVSILKVNCQLVSVGLPEKGETFDLSPFTFI 306

>TPHA0A00140 Chr1 (14857..15945) [1089 bp, 362 aa] {ON} 
          Length = 362

 Score = 35.0 bits (79), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 84/366 (22%), Positives = 143/366 (39%), Gaps = 37/366 (10%)

Query: 26  EEIIVEPPKAHE--VRIRITYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGVVESVG-KG 82
           ++I  +P K  +  V I+I    VC +D +  S          ++GHE  G V  +G K 
Sbjct: 22  KKISYDPKKFDDYDVDIKIEACGVCGSDVHRASSNWGPVKANQVVGHEIVGRVVKLGPKC 81

Query: 83  VTNVKPGDHV-VALYTAECQKCKFCTSGKTNLCGSVRATQGKGVMPDGTSRFRTKNGESI 141
              +K GD V V      C  CK C S     C S               R  T +G   
Sbjct: 82  KLGLKVGDRVGVGAQAKSCLNCKRCKSDNEPYCKS-------------KDRVGTYSGTYS 128

Query: 142 LHFMGCSTFSQYTXXXXXXXXXXXXQAPLDRICLLGCGVTTGYGAAIKTANVQKGDTVAV 201
             ++    ++ +               P +    L CG  T +   ++      G  V V
Sbjct: 129 DGYVSQGGYASHVRTHEHFVFKIPDNIPTELAAPLLCGGVTVFSPLLRNG-CGPGKKVGV 187

Query: 202 FGAGTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFGATDFVNPSKDLKEGETIVSKL 261
            G G +G   +  AKA GA  +  +  +  KK+ +   GA D+   +++ K+  T  +  
Sbjct: 188 VGIGGIGHMGILFAKAMGA-EVYAISRSSSKKEDSLKLGA-DYYIATQEEKDWATTYADT 245

Query: 262 IELTDGGLDFTFDCTGNTKVMRDALEACHKGWGQSIIIGVAAAGQEISTRPFQLVTGRVW 321
           ++L           +  + +  D L A     G+ + I +  A Q+++ +PF L+ G   
Sbjct: 246 LDL------IVLCASSLSDINIDDLVATMTIGGKIVSIAIPDASQQLTLKPFGLL-GVYI 298

Query: 322 KGSAFGGIKGRSEMGGLVSDYMDGQLKVDEFITHRRPFTE--INAAFDDLHHGDCLR--T 377
             SA G  K   ++  LVS     + K+  ++    P +E  +N  F+ +  GD     T
Sbjct: 299 SNSALGSRKEIIQLLDLVS-----EKKIKPWV-QTVPISEAGVNEVFERMEKGDVKYRFT 352

Query: 378 VLDLSK 383
           ++D  K
Sbjct: 353 LVDFDK 358

>ZYRO0G10318g Chr7 (831554..832684) [1131 bp, 376 aa] {ON} similar
           to uniprot|Q04894 Saccharomyces cerevisiae YMR318C ADH6
           NADPH-dependent cinnamyl alcohol dehydrogenase family
           member with broad substrate specificity may be involved
           in fusel alcohol synthesis or in aldehyde tolerance
          Length = 376

 Score = 34.7 bits (78), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 25/98 (25%), Positives = 39/98 (39%), Gaps = 13/98 (13%)

Query: 31  EPPK--AHEVRIRITYTAVCHTDAYTLSG----------VDPEGAFPSILGHEGAGVVES 78
           EP K  AH+V I +    +C ++ ++L                G    ++GHE  G V +
Sbjct: 29  EPKKFDAHDVDIEVECCGICASELFSLKNEWSSEPLTCMTSSYGPKSQVVGHEVVGKVVA 88

Query: 79  VGKGVTNVKPGDHV-VALYTAECQKCKFCTSGKTNLCG 115
           VG  V+  K GD + +    + C  C  C       C 
Sbjct: 89  VGDKVSLCKVGDRIGLGAQASSCMSCPRCHGNNEQYCA 126

>TDEL0A00140 Chr1 (23016..24233) [1218 bp, 405 aa] {ON} 
          Length = 405

 Score = 34.3 bits (77), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 63/275 (22%), Positives = 108/275 (39%), Gaps = 53/275 (19%)

Query: 34  KAHEVRIRITYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGVVESVGKGVTNVK-PGDHV 92
           K +E+ ++  Y  + H D  +        +FP I G E +G+V   G  V   K P    
Sbjct: 71  KEYEILVQNKYVGLNHVDWKSKKYRFNIYSFPWINGRESSGIVIRRGSKVDTQKFPISAE 130

Query: 93  VALYTAECQKCKFCTSGKTNLCGSVRATQGKGVMPDGTSRFRTKNGESILHFMGCSTFSQ 152
           V L +   +  +  T  +  +  S    +    +P    ++R  NG   LH         
Sbjct: 131 VFLASTSYRDLETSTFQEYTVFDSRLVWK----LP----QYRLPNGR--LH--------- 171

Query: 153 YTXXXXXXXXXXXXQAPLDRICLLGCGVTTGYGAAIKT---------ANVQK-GDTVAVF 202
                         +  L+    +G G+ T  G+AI +         A+ QK G+ V   
Sbjct: 172 -------------KRFDLEFAAGVGVGLVTA-GSAISSLVDLSLRDQADHQKLGNIVIWG 217

Query: 203 GAGTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFGATDFVNPSKDLKEGETIVSKLI 262
           G+ +VGL V+Q AKA      IVV    + K++  + GA+  ++  +     E I+  ++
Sbjct: 218 GSSSVGLYVIQLAKASKMFEKIVVVSASKHKEYLLELGASCIIDRHQS---EEEILDDIL 274

Query: 263 ELTDGGLDFTFDCTGN------TKVMRDALEACHK 291
                G+DF  D          TK++++  E   K
Sbjct: 275 SHCPEGIDFGIDVISKETATLLTKILQNNNENVKK 309

>Kpol_1057.24 s1057 (53467..54549) [1083 bp, 360 aa] {ON}
           (53467..54549) [1083 nt, 361 aa]
          Length = 360

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 43/93 (46%), Gaps = 4/93 (4%)

Query: 26  EEIIVEPPKAHE--VRIRITYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGVVESVG-KG 82
           +++  EP + ++  V I+I    VC +D +  +      A   ++GHE  G V  VG K 
Sbjct: 22  KKVTFEPKQFNDKDVDIKIEACGVCGSDVHCAASHWGPVAEKQVVGHEIIGRVLKVGPKC 81

Query: 83  VTNVKPGDHV-VALYTAECQKCKFCTSGKTNLC 114
            T +K GD V V      C +C  C S   + C
Sbjct: 82  TTGIKVGDRVGVGAQAWSCLECSRCKSDNESYC 114

>Smik_14.193 Chr14 complement(352041..353171) [1131 bp, 376 aa] {ON}
           YNL134C (REAL)
          Length = 376

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 33/126 (26%), Positives = 55/126 (43%), Gaps = 11/126 (8%)

Query: 177 GCGVTTGYGAAIK--TANVQKGDTVAVFGAGT-VGLSVVQGAKA-RGASRIIVVDINDQK 232
           G  +T  +G  +K      Q+   +  +G  T VG  ++Q AK   G S+IIVV     +
Sbjct: 154 GMVLTHSFGLDMKWEPPKAQRDHPILFWGGATGVGQMLIQLAKKLHGFSKIIVVASRKHE 213

Query: 233 KQWASDFGATDFVNPSKDLKEGETIVSKLIELTDGGLDFTFDCTGNTKVMRDALEACHKG 292
           KQ   D+GA +      D  + + I  + I+     L +  DC  NT+ ++   +     
Sbjct: 214 KQL-KDYGADELF----DYHDADVI--EQIKKKHNNLTYLVDCVSNTETIQQVYKCAADD 266

Query: 293 WGQSII 298
              +II
Sbjct: 267 LDATII 272

>Kpol_526.18 s526 (51360..52445) [1086 bp, 361 aa] {ON}
           (51360..52445) [1086 nt, 362 aa]
          Length = 361

 Score = 32.3 bits (72), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 31/98 (31%), Positives = 40/98 (40%), Gaps = 3/98 (3%)

Query: 34  KAHEVRIRITYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGVVESVGKGV-TNVKPGDHV 92
           K  +V I I    VC +D +  SG   E     ++GHE  G V  +G    T +K GD V
Sbjct: 32  KECDVDIEIEACGVCGSDIHCASGDWGERRDKLVVGHEVIGRVIKLGPECHTGLKIGDRV 91

Query: 93  -VALYTAECQKCKFCTSGKTNLCGSVRATQGKGVMPDG 129
            V    A C  C+ C       C     T  +   PDG
Sbjct: 92  GVGAQVASCLDCERCEHDNEPYCPKFVTTYNQA-YPDG 128

>KAFR0H03770 Chr8 complement(715399..716496) [1098 bp, 365 aa] {ON} 
          Length = 365

 Score = 32.0 bits (71), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 41/96 (42%), Gaps = 5/96 (5%)

Query: 33  PKA---HEVRIRITYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGVVESVGKGV-TNVKP 88
           PKA   H+V I I    VC +D +T +    E     ++GHE  G +  +G    + +K 
Sbjct: 34  PKAFGPHDVDIEIECCGVCGSDIHTAASHWRELRDKMVVGHEIVGRIVKLGPECDSGLKI 93

Query: 89  GDHV-VALYTAECQKCKFCTSGKTNLCGSVRATQGK 123
           GD V V   +  C +C  C       C    +T  +
Sbjct: 94  GDRVGVGAQSFSCLECDRCKENNEPYCPKFVSTYNR 129

>Ecym_5311 Chr5 complement(631236..632099) [864 bp, 287 aa] {ON}
           similar to Ashbya gossypii AER015C
          Length = 287

 Score = 31.6 bits (70), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 42/90 (46%), Gaps = 6/90 (6%)

Query: 222 RIIVVDINDQKKQWASDFGATDFVNPSKDLKEGETIVSKLIELTDGGLDFTFDCTGNTKV 281
           ++IV+D+ND      +D    +   P   L        ++ ++ DG  +  F  +G  K 
Sbjct: 155 KLIVIDVNDPLAPKLNDIEDVEKHLPG--LLRATNEWFRIYKIPDGKPENQFAFSGEAKN 212

Query: 282 MRDALEA---CHKGWGQSIIIGVAAAGQEI 308
            + ALE    CH+ W Q +I G AA  ++I
Sbjct: 213 RKYALEVVRECHEAWKQ-LICGKAADSKKI 241

>KAFR0C01550 Chr3 complement(318350..319429) [1080 bp, 359 aa] {ON} 
          Length = 359

 Score = 31.2 bits (69), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 38/95 (40%), Gaps = 2/95 (2%)

Query: 31  EPPKAHEVRIRITYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGVVESVGKGV-TNVKPG 89
           +P  +H+V I I    VC +D +  +    E     ++GHE  G V  VG    T +K G
Sbjct: 29  KPFDSHDVDIEIECCGVCGSDIHCAASHWSEVREDLVVGHEVIGRVVKVGPECNTGLKLG 88

Query: 90  DHV-VALYTAECQKCKFCTSGKTNLCGSVRATQGK 123
           D V V      C +C  C       C     T  +
Sbjct: 89  DRVGVGAQVFSCLECDRCKEDNEPYCQKFVTTYNQ 123

>Kwal_26.9050 s26 (1055019..1056113) [1095 bp, 364 aa] {ON} YCR105W
           - Hypothetical ORF [contig 68] FULL
          Length = 364

 Score = 31.2 bits (69), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 57/225 (25%), Positives = 89/225 (39%), Gaps = 21/225 (9%)

Query: 26  EEIIVEPPK--AHEVRIRITYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGVVESVGKGV 83
           E+    PP     ++ + I    VC +D + ++G       P  +GHE  G + ++G+ V
Sbjct: 22  EKFSYSPPLLGPEDIELEIEACGVCGSDIHAVAGDWGRLYKPFAVGHEIVGKISAMGEQV 81

Query: 84  TNVK--PGDHV-VALYTAECQKCKFCTSGKTNLCGSVRATQGKGVMPDGTSRFRTKNGES 140
              K   GD V V      C KC  C+ G+   C     T       D ++ F+T+ G  
Sbjct: 82  NKEKFHLGDRVGVGAQIDSCGKCTRCSRGRQQNCKKSVLTY---TSVDESNGFQTQGG-- 136

Query: 141 ILHFMGCSTFSQYTXXXXXXXXXXXXQAPLDRICLLGCGVTTGYGAAIKTANVQKGDTVA 200
              +      S                APL       CG  TG+   +    V++G  V 
Sbjct: 137 ---YASKIRASSEFVFKIPDGLDSAVAAPL------LCGGITGFRPLL-AGGVKEGSKVG 186

Query: 201 VFGAGTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFGATDFV 245
           V G G +G   +  AKA GA  +  +  +++K + A   GA  FV
Sbjct: 187 VVGIGGIGHMSILFAKALGA-EVTAISRSNRKLEDAKKLGADHFV 230

>Kwal_8.605 s8 (25017..26156) [1140 bp, 379 aa] {ON} YCR105W -
           Hypothetical ORF [contig 311] FULL
          Length = 379

 Score = 30.4 bits (67), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 59/230 (25%), Positives = 89/230 (38%), Gaps = 21/230 (9%)

Query: 26  EEIIVEPPK--AHEVRIRITYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGVVESVGKGV 83
           E+    PP     ++ + I    VC +D + +SG       P  +GHE  G + ++G  V
Sbjct: 37  EKFSYSPPLLGPEDIELEIEACGVCGSDIHAVSGDWGRLYKPFAVGHEIIGKISAMGAQV 96

Query: 84  TNVK--PGDHV-VALYTAECQKCKFCTSGKTNLCGSVRATQGKGVMPDGTSRFRTKNGES 140
              K   GD V V   T  C  C  C+  +   C     T       D  + F T+ G +
Sbjct: 97  NKEKFHLGDRVGVGAQTNSCGDCTRCSRDRQQNCKKSVLTY---TCVDERNGFETQGGYA 153

Query: 141 ILHFMGCSTFSQYTXXXXXXXXXXXXQAPLDRICLLGCGVTTGYGAAIKTANVQKGDTVA 200
             H    S F                 APL       CG  TG+   + T  V++G  + 
Sbjct: 154 S-HIRANSGF----VFKIPDALDSAVAAPL------LCGGITGFRPLL-TGGVKEGSKLG 201

Query: 201 VFGAGTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFGATDFVNPSKD 250
           V G G +G   +  AKA GA  +  +  +++K   A   GA  F+  S +
Sbjct: 202 VVGIGGIGHMSILFAKALGA-EVTAISRSNRKFDDAKKLGADHFLAMSDE 250

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.136    0.409 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 37,458,782
Number of extensions: 1481417
Number of successful extensions: 3629
Number of sequences better than 10.0: 196
Number of HSP's gapped: 3492
Number of HSP's successfully gapped: 249
Length of query: 383
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 272
Effective length of database: 40,753,473
Effective search space: 11084944656
Effective search space used: 11084944656
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 67 (30.4 bits)