Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0F11352g7.349ON58338219140.0
Kwal_56.246387.349ON52739012961e-173
ZYRO0F11682g7.349ON59737512841e-170
TDEL0C019907.349ON60637512571e-166
KLTH0H01276g7.349ON55741812431e-165
Suva_4.797.349ON70838712001e-156
Skud_4.907.349ON70739011861e-154
ACL149W7.349ON62836911751e-154
Smik_4.717.349ON75938911841e-153
YDL167C (NRP1)7.349ON71938611801e-153
NCAS0A141507.349ON57037611551e-151
KLLA0D12364g7.349ON63139810571e-136
TBLA0E020607.349ON56436610311e-133
KAFR0B008707.349ON54239110201e-131
Kpol_530.327.349ON68441610191e-129
TPHA0F029607.349ON6543959671e-122
KNAG0C037807.349ON5383769461e-120
NDAI0A019007.349ON5653628052e-99
CAGL0I03344g7.349ON6033956513e-76
KLLA0B08976g3.379ON305100723.5
Ecym_13021.408ON28828713.7
YHR015W (MIP6)1.357ON65927724.2
TDEL0A009402.52ON68232724.3
SAKL0H17952g8.229ON58948714.5
TBLA0B006002.52ON73432715.1
Kwal_23.45972.52ON66432715.9
KLTH0D01826g7.57ON132455716.2
KLTH0B07546g2.52ON63932706.9
KLTH0H03828g6.229ON148783707.6
NCAS0G025802.167ON22430687.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0F11352g
         (583 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0F11352g Chr6 (883590..885341) [1752 bp, 583 aa] {ON} some s...   741   0.0  
Kwal_56.24638 s56 (1083888..1085471) [1584 bp, 527 aa] {ON} YDL1...   503   e-173
ZYRO0F11682g Chr6 (956534..958327) [1794 bp, 597 aa] {ON} some s...   499   e-170
TDEL0C01990 Chr3 complement(345897..347717) [1821 bp, 606 aa] {O...   488   e-166
KLTH0H01276g Chr8 complement(122337..124010) [1674 bp, 557 aa] {...   483   e-165
Suva_4.79 Chr4 complement(148569..150695) [2127 bp, 708 aa] {ON}...   466   e-156
Skud_4.90 Chr4 complement(156704..158827) [2124 bp, 707 aa] {ON}...   461   e-154
ACL149W Chr3 (88715..90601) [1887 bp, 628 aa] {ON} Syntenic homo...   457   e-154
Smik_4.71 Chr4 complement(137635..139914) [2280 bp, 759 aa] {ON}...   460   e-153
YDL167C Chr4 complement(160995..163154) [2160 bp, 719 aa] {ON}  ...   459   e-153
NCAS0A14150 Chr1 (2780086..2781798) [1713 bp, 570 aa] {ON} Anc_7...   449   e-151
KLLA0D12364g Chr4 complement(1051765..1053660) [1896 bp, 631 aa]...   411   e-136
TBLA0E02060 Chr5 (502492..504186) [1695 bp, 564 aa] {ON} Anc_7.3...   401   e-133
KAFR0B00870 Chr2 (162698..164326) [1629 bp, 542 aa] {ON} Anc_7.3...   397   e-131
Kpol_530.32 s530 complement(78552..80606) [2055 bp, 684 aa] {ON}...   397   e-129
TPHA0F02960 Chr6 (651108..653072) [1965 bp, 654 aa] {ON} Anc_7.3...   377   e-122
KNAG0C03780 Chr3 (743477..745093) [1617 bp, 538 aa] {ON} Anc_7.3...   369   e-120
NDAI0A01900 Chr1 complement(426743..428440) [1698 bp, 565 aa] {O...   314   2e-99
CAGL0I03344g Chr9 complement(285637..287448) [1812 bp, 603 aa] {...   255   3e-76
KLLA0B08976g Chr2 complement(786122..787039) [918 bp, 305 aa] {O...    32   3.5  
Ecym_1302 Chr1 complement(613499..614365) [867 bp, 288 aa] {ON} ...    32   3.7  
YHR015W Chr8 (134554..136533) [1980 bp, 659 aa] {ON}  MIP6Putati...    32   4.2  
TDEL0A00940 Chr1 complement(156781..158829) [2049 bp, 682 aa] {O...    32   4.3  
SAKL0H17952g Chr8 complement(1599134..1600903) [1770 bp, 589 aa]...    32   4.5  
TBLA0B00600 Chr2 complement(123569..125773) [2205 bp, 734 aa] {O...    32   5.1  
Kwal_23.4597 s23 complement(781763..783757) [1995 bp, 664 aa] {O...    32   5.9  
KLTH0D01826g Chr4 complement(175846..179820) [3975 bp, 1324 aa] ...    32   6.2  
KLTH0B07546g Chr2 (609954..611873) [1920 bp, 639 aa] {ON} some s...    32   6.9  
KLTH0H03828g Chr8 complement(348388..352851) [4464 bp, 1487 aa] ...    32   7.6  
NCAS0G02580 Chr7 complement(461003..461677) [675 bp, 224 aa] {ON...    31   7.8  

>SAKL0F11352g Chr6 (883590..885341) [1752 bp, 583 aa] {ON} some
           similarities with uniprot|P32770 Saccharomyces
           cerevisiae YDL167C NRP1
          Length = 583

 Score =  741 bits (1914), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/382 (94%), Positives = 360/382 (94%)

Query: 1   MYYVVLEAETVHGEEKPKDHTRVSRICYQFIHSDTLQSVFEQPIIVEVGPGQLREQVAQL 60
           MYYVVLEAETVHGEEKPKDHTRVSRICYQFIHSDTLQSVFEQPIIVEVGPGQLREQVAQL
Sbjct: 1   MYYVVLEAETVHGEEKPKDHTRVSRICYQFIHSDTLQSVFEQPIIVEVGPGQLREQVAQL 60

Query: 61  DQLVTSKITSDNHEFALVSLSSTWHIRVTIPRQARDEGFILPPYLQHPKVFDLWKEYDRW 120
           DQLVTSKITSDNHEFALVSLSSTWHIRVTIPRQARDEGFILPPYLQHPKVFDLWKEYDRW
Sbjct: 61  DQLVTSKITSDNHEFALVSLSSTWHIRVTIPRQARDEGFILPPYLQHPKVFDLWKEYDRW 120

Query: 121 CVNHPETLPLRKNSNLGKKSRDLPELSRVLEAPLQTFPLDQTIGILSQLHKKCLLPEDQS 180
           CVNHPETLPLRKNSNLGKKSRDLPELSRVLEAPLQTFPLDQTIGILSQLHKKCLLPEDQS
Sbjct: 121 CVNHPETLPLRKNSNLGKKSRDLPELSRVLEAPLQTFPLDQTIGILSQLHKKCLLPEDQS 180

Query: 181 MVLTHPYDSYLDVRTFLQERSKVLYMNNLPPDTTQSELESWFTQFGARPVGFWXXXXXXX 240
           MVLTHPYDSYLDVRTFLQERSKVLYMNNLPPDTTQSELESWFTQFGARPVGFW       
Sbjct: 181 MVLTHPYDSYLDVRTFLQERSKVLYMNNLPPDTTQSELESWFTQFGARPVGFWTVKNVVE 240

Query: 241 XXXXXXXXXXXXXXXYVEEQDSISGFVVFQTHEEATEALSLNGRSILSNMANTKQPRVVE 300
                          YVEEQDSISGFVVFQTHEEATEALSLNGRSILSNMANTKQPRVVE
Sbjct: 241 ETSNVNNNWSCNNSSYVEEQDSISGFVVFQTHEEATEALSLNGRSILSNMANTKQPRVVE 300

Query: 301 HVVELQPSSTRVLDRAHELLSPFPQSKNKPRPGDWNCPSCGFSNFQRRTACFRCSFPATS 360
           HVVELQPSSTRVLDRAHELLSPFPQSKNKPRPGDWNCPSCGFSNFQRRTACFRCSFPATS
Sbjct: 301 HVVELQPSSTRVLDRAHELLSPFPQSKNKPRPGDWNCPSCGFSNFQRRTACFRCSFPATS 360

Query: 361 AVNVNKSTPASFIKQATQRSEL 382
           AVNVNKSTPASFIKQATQRSEL
Sbjct: 361 AVNVNKSTPASFIKQATQRSEL 382

 Score =  204 bits (519), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 97/113 (85%), Positives = 97/113 (85%)

Query: 471 RYNIVQRQPYXXXXXXXXXXXXXXXXVPFRAGDWKCVSCTYHNFAKNVVCLRCGGPKTVG 530
           RYNIVQRQPY                VPFRAGDWKCVSCTYHNFAKNVVCLRCGGPKTVG
Sbjct: 471 RYNIVQRQPYSNNGIGATTNNGGGSNVPFRAGDWKCVSCTYHNFAKNVVCLRCGGPKTVG 530

Query: 531 GAGVANQANLDVLLLDGSCQNGSASTISLSEMHNGGSSFGVSLETRSSSEPAW 583
           GAGVANQANLDVLLLDGSCQNGSASTISLSEMHNGGSSFGVSLETRSSSEPAW
Sbjct: 531 GAGVANQANLDVLLLDGSCQNGSASTISLSEMHNGGSSFGVSLETRSSSEPAW 583

 Score = 40.4 bits (93), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 16/29 (55%)

Query: 331 RPGDWNCPSCGFSNFQRRTACFRCSFPAT 359
           R GDW C SC + NF +   C RC  P T
Sbjct: 500 RAGDWKCVSCTYHNFAKNVVCLRCGGPKT 528

 Score = 40.4 bits (93), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 16/29 (55%)

Query: 500 RAGDWKCVSCTYHNFAKNVVCLRCGGPKT 528
           R GDW C SC + NF +   C RC  P T
Sbjct: 331 RPGDWNCPSCGFSNFQRRTACFRCSFPAT 359

>Kwal_56.24638 s56 (1083888..1085471) [1584 bp, 527 aa] {ON} YDL167C
           (NRP1) - Asparagine-rich protein [contig 161] FULL
          Length = 527

 Score =  503 bits (1296), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 248/390 (63%), Positives = 297/390 (76%), Gaps = 19/390 (4%)

Query: 1   MYYVVLEAETVHGEEKPKDHTRVSRICYQFIHSDTLQSVFEQP--IIVEVGPGQLREQVA 58
           M+YVVLE +  H E+ PKD ++++   YQF+ ++ L+SVF++   I++E G   L+E V+
Sbjct: 1   MHYVVLEVDLAHREDSPKDWSQIAAFHYQFLDTEELKSVFQENKHIVLENG-CSLQEAVS 59

Query: 59  QLDQLVTSKITSDNHEFALVSLSSTWHIRVTIPRQARDEGFILPPYLQHPKVFDLWKEYD 118
           QL++ +   +  D   F L SL+STWH RVTIPRQARDE FILPP+LQHP+VFDLWKEYD
Sbjct: 60  QLEKDIGEHLKDD---FVLCSLNSTWHFRVTIPRQARDEVFILPPHLQHPRVFDLWKEYD 116

Query: 119 RWCVNHPETLPLRKNSNLGKKSRDLPELSRVLE--------APLQTFP--LDQTIGILSQ 168
           RWCVNHPETL LR+++++GKK +D+ EL  VLE         P    P  L+QTI I+ Q
Sbjct: 117 RWCVNHPETLALRRSNSMGKKVKDVAELRSVLELDSATQDSTPGAAEPDALEQTIAIIRQ 176

Query: 169 LHKKCLLPEDQSMVLTHPYDSYLDVRTFLQERSKVLYMNNLPPDTTQSELESWFTQFGAR 228
           LHKKC+  ED+S+VLTHPYDSYLDVR FLQERSKVLYMNNLPPDTTQSELESWFTQFGAR
Sbjct: 177 LHKKCVTAEDKSLVLTHPYDSYLDVRNFLQERSKVLYMNNLPPDTTQSELESWFTQFGAR 236

Query: 229 PVGFWXXXXXXXXXXXXXXXXXXXXXXYVEEQDSISGFVVFQTHEEATEALSLNGRSILS 288
           PVGFW                      YVE QDSISGFVVFQ+HEEATEALSLNGRSILS
Sbjct: 237 PVGFWTVKNIVEETSNVNNNWSSNNSTYVEAQDSISGFVVFQSHEEATEALSLNGRSILS 296

Query: 289 NMANTKQPRVVEHVVELQPSSTRVLDRAHELLSPFPQSKNKPRPGDWNCPSCGFSNFQRR 348
           N+ANTKQPRV+EH+VE+QPSS RVLDRA E+LSPFPQSKNKPRPGDWNCPSCGFSNFQRR
Sbjct: 297 NIANTKQPRVIEHIVEVQPSSARVLDRAQEILSPFPQSKNKPRPGDWNCPSCGFSNFQRR 356

Query: 349 TACFRCSFPATSAVNVNKSTPASFIKQATQ 378
           T+CFRCSFP+T +  +N +    ++K   Q
Sbjct: 357 TSCFRCSFPSTGSAPMNNT---GYVKNTMQ 383

 Score = 95.5 bits (236), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 53/87 (60%), Gaps = 17/87 (19%)

Query: 497 VPFRAGDWKCVSCTYHNFAKNVVCLRCGGPKTVGGAGVANQANLDVLLLDGSCQNGSAST 556
           VPFRAGDWKC +CTYHNFAKNVVCLRCGGPK+                     Q GSA+ 
Sbjct: 452 VPFRAGDWKCATCTYHNFAKNVVCLRCGGPKSTEHQ-----------------QKGSAAV 494

Query: 557 ISLSEMHNGGSSFGVSLETRSSSEPAW 583
            S +E  + G+  G SL TRS SEPAW
Sbjct: 495 NSYAEGQDIGNGMGFSLNTRSFSEPAW 521

 Score = 40.0 bits (92), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 20/37 (54%), Gaps = 1/37 (2%)

Query: 500 RAGDWKCVSCTYHNFAKNVVCLRCGGPKTVGGAGVAN 536
           R GDW C SC + NF +   C RC  P T G A + N
Sbjct: 339 RPGDWNCPSCGFSNFQRRTSCFRCSFPST-GSAPMNN 374

 Score = 39.3 bits (90), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 17/30 (56%)

Query: 331 RPGDWNCPSCGFSNFQRRTACFRCSFPATS 360
           R GDW C +C + NF +   C RC  P ++
Sbjct: 455 RAGDWKCATCTYHNFAKNVVCLRCGGPKST 484

>ZYRO0F11682g Chr6 (956534..958327) [1794 bp, 597 aa] {ON} some
           similarities with uniprot|P32770 Saccharomyces
           cerevisiae YDL167C NRP1
          Length = 597

 Score =  499 bits (1284), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 244/375 (65%), Positives = 288/375 (76%), Gaps = 14/375 (3%)

Query: 1   MYYVVLEAETVHGEEKPKDHTRVSRICYQFIHSDTLQSVFEQP-----IIVEVGPGQLRE 55
           MYYVVLE ET H  E PKD  R+++I YQF++++TLQ  +++      II E     L E
Sbjct: 1   MYYVVLEVETAHLIEIPKDQCRIAKISYQFVNAETLQVHYQENQAPLHIISENDSTNLHE 60

Query: 56  QVAQLDQLVTSKITSDNHEFALVSLSSTWHIRVTIPRQARDEGFILPPYLQHPKVFDLWK 115
            VA L++ + ++I  D   F L SL+STWH+RVT+ RQARD+ F LP YLQHPK+FDLWK
Sbjct: 61  AVANLNEEI-NRIAGD-EPFVLCSLNSTWHLRVTLSRQARDQNFALPSYLQHPKIFDLWK 118

Query: 116 EYDRWCVNHPETLPLRKNSNLGKKSRDLPELSRVLEAPL-----QTFPLDQTIGILSQLH 170
           EY+RWCVNHPE +PLRKN   G++ +D+ EL+RVL+         +F L +++ IL +LH
Sbjct: 119 EYERWCVNHPEVMPLRKNG--GRRMKDVAELARVLDINGLNFNDSSFDLSRSVEILLRLH 176

Query: 171 KKCLLPEDQSMVLTHPYDSYLDVRTFLQERSKVLYMNNLPPDTTQSELESWFTQFGARPV 230
           ++C  PED +MVLTHPYDS++DVR FLQE SKVLY+NNLPPDTTQSELESWFTQFGARPV
Sbjct: 177 QRCSTPEDMAMVLTHPYDSHMDVRNFLQECSKVLYLNNLPPDTTQSELESWFTQFGARPV 236

Query: 231 GFWXXXXXXXXXXXXXXXXXXXXXXYVEEQDSISGFVVFQTHEEATEALSLNGRSILSNM 290
           GFW                      YVEEQDSISGFVVFQTHEEATE L+LNGRSILSNM
Sbjct: 237 GFWTVKNIVEETSNVNNNWSMNNSPYVEEQDSISGFVVFQTHEEATEVLTLNGRSILSNM 296

Query: 291 ANTKQPRVVEHVVELQPSSTRVLDRAHELLSPFPQSKNKPRPGDWNCPSCGFSNFQRRTA 350
           ANTKQPRVVEH+VE+QPSSTRVLDRA E+LSPFPQSKNKPRPGDWNCPSCGFSNFQRRTA
Sbjct: 297 ANTKQPRVVEHIVEIQPSSTRVLDRAQEILSPFPQSKNKPRPGDWNCPSCGFSNFQRRTA 356

Query: 351 CFRCSFPATSAVNVN 365
           CFRCSFPAT+AV VN
Sbjct: 357 CFRCSFPATTAVQVN 371

 Score = 87.0 bits (214), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 53/117 (45%), Positives = 64/117 (54%), Gaps = 34/117 (29%)

Query: 497 VPFRAGDWKCVSCTYHNFAKNVVCLRCGGPKTVGGAGVANQA------------------ 538
           VPFRAGDWKC SC YHNFAKNVVCLRCGGPK +    + N A                  
Sbjct: 485 VPFRAGDWKCPSCIYHNFAKNVVCLRCGGPK-ITAVDLENAATTSNNINNNNGVNQHDAK 543

Query: 539 ----NLDVLLLDGSCQNGSASTISLSE-MHNGGSS-------FGVSLETRSSSEPAW 583
               N  V LLD +      ST+SLS+ + NG ++       FGV+L++RS SEP W
Sbjct: 544 VVAKNNSVSLLDLTSM---GSTVSLSDKLPNGNATSSAAYDGFGVALDSRSVSEPKW 597

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 23/41 (56%)

Query: 331 RPGDWNCPSCGFSNFQRRTACFRCSFPATSAVNVNKSTPAS 371
           R GDW CPSC + NF +   C RC  P  +AV++  +   S
Sbjct: 488 RAGDWKCPSCIYHNFAKNVVCLRCGGPKITAVDLENAATTS 528

 Score = 40.8 bits (94), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 16/31 (51%)

Query: 500 RAGDWKCVSCTYHNFAKNVVCLRCGGPKTVG 530
           R GDW C SC + NF +   C RC  P T  
Sbjct: 337 RPGDWNCPSCGFSNFQRRTACFRCSFPATTA 367

>TDEL0C01990 Chr3 complement(345897..347717) [1821 bp, 606 aa] {ON}
           Anc_7.349 YDL167C
          Length = 606

 Score =  488 bits (1257), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 242/375 (64%), Positives = 279/375 (74%), Gaps = 12/375 (3%)

Query: 1   MYYVVLEAETVHGEEKPKDHTRVSRICYQFIHSDTLQSVFEQ---PIIV--EVGPGQLRE 55
           M+YVVLE E  H  E PKDH RV+++ YQFI ++++++ +     P+I   + G    +E
Sbjct: 1   MHYVVLEVEATHRIEAPKDHGRVNKLSYQFIDAESMKAYYADDQIPLISLDQQGSISFQE 60

Query: 56  QVAQLDQLVTSKITSDNHEFALVSLSSTWHIRVTIPRQARDEGFILPPYLQHPKVFDLWK 115
            +A+ D+ V S +  D  EF L SL STWHIRVTIPRQARDEGF+LP YLQHP+VFDLWK
Sbjct: 61  SIAKFDRDVMSIVGED--EFVLCSLYSTWHIRVTIPRQARDEGFLLPSYLQHPRVFDLWK 118

Query: 116 EYDRWCVNHPETLPLRKNSNLG-KKSRDLPELSRVLEAPLQTFP----LDQTIGILSQLH 170
           EYDRWC NHPE L LRK+   G K+ +D  E+ +VLE   +       L  T+ IL QL 
Sbjct: 119 EYDRWCANHPEVLTLRKSCRTGIKRVKDQTEILKVLEMSTEEITEKPVLGYTVDILLQLC 178

Query: 171 KKCLLPEDQSMVLTHPYDSYLDVRTFLQERSKVLYMNNLPPDTTQSELESWFTQFGARPV 230
           ++C   ED S VL+ PYDS+LD+R FLQE+SKVLY+NNLPPDTTQSELESWFTQFGARPV
Sbjct: 179 ERCTTKEDISDVLSRPYDSHLDIRNFLQEQSKVLYLNNLPPDTTQSELESWFTQFGARPV 238

Query: 231 GFWXXXXXXXXXXXXXXXXXXXXXXYVEEQDSISGFVVFQTHEEATEALSLNGRSILSNM 290
           GFW                      YVEEQDSISGFVVFQTHEEATE L LNGRSILSNM
Sbjct: 239 GFWTVKNIVEETANINNKWSMNNSPYVEEQDSISGFVVFQTHEEATEVLVLNGRSILSNM 298

Query: 291 ANTKQPRVVEHVVELQPSSTRVLDRAHELLSPFPQSKNKPRPGDWNCPSCGFSNFQRRTA 350
           ANTKQPRVVEH+VE+QPSSTRVLDRA E+LSPFPQSKNKPRPGDWNCPSCGFSNFQRRTA
Sbjct: 299 ANTKQPRVVEHIVEIQPSSTRVLDRAQEILSPFPQSKNKPRPGDWNCPSCGFSNFQRRTA 358

Query: 351 CFRCSFPATSAVNVN 365
           CFRCSFPA SAV VN
Sbjct: 359 CFRCSFPAASAVQVN 373

 Score = 66.2 bits (160), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 25/30 (83%), Positives = 27/30 (90%)

Query: 498 PFRAGDWKCVSCTYHNFAKNVVCLRCGGPK 527
           PFRAGDWKC +CTYHNFAKN+VCLRCG  K
Sbjct: 476 PFRAGDWKCPTCTYHNFAKNLVCLRCGAAK 505

 Score = 40.4 bits (93), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 18/35 (51%)

Query: 331 RPGDWNCPSCGFSNFQRRTACFRCSFPATSAVNVN 365
           R GDW CP+C + NF +   C RC     S  + N
Sbjct: 478 RAGDWKCPTCTYHNFAKNLVCLRCGAAKVSISDSN 512

 Score = 38.5 bits (88), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 15/27 (55%)

Query: 500 RAGDWKCVSCTYHNFAKNVVCLRCGGP 526
           R GDW C SC + NF +   C RC  P
Sbjct: 339 RPGDWNCPSCGFSNFQRRTACFRCSFP 365

>KLTH0H01276g Chr8 complement(122337..124010) [1674 bp, 557 aa] {ON}
           some similarities with uniprot|P32770 Saccharomyces
           cerevisiae YDL167C NRP1
          Length = 557

 Score =  483 bits (1243), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 244/418 (58%), Positives = 290/418 (69%), Gaps = 55/418 (13%)

Query: 1   MYYVVLEAETVHGEEKPKDHTRVSRICYQFIHSDTLQSVFEQPIIVEVGPG-QLREQVAQ 59
           M+YVVLE E  H E+ PKD +++++  YQF+ ++TL+ VFE+   VE+G G  L++ VAQ
Sbjct: 1   MHYVVLEVELAHREDSPKDWSQIAKFNYQFLDTETLEPVFEENKHVELGNGCTLQDAVAQ 60

Query: 60  LDQLVTSKITSDNHEFALVSLSSTWHIRVTIPRQARDEGFILPPYLQHPKVFDLWKEYDR 119
           L++ ++     D   F L SL+STWH RVTIPRQARDE FILPP+LQHPKVFDLWKEYDR
Sbjct: 61  LEKDISEHAKDD---FVLCSLNSTWHFRVTIPRQARDEVFILPPHLQHPKVFDLWKEYDR 117

Query: 120 WCVNHPETLPLRKNSNLGKKSRDLPE---------------------------------- 145
           WC+NHPET  +R+N  LGK+++DL E                                  
Sbjct: 118 WCMNHPETSAMRQNP-LGKRTKDLAEMRSVLGLDGTEEGAHPDANQNGGEQSKAEQSGAE 176

Query: 146 ---------------LSRVLEAPL-QTFPLDQTIGILSQLHKKCLLPEDQSMVLTHPYDS 189
                          LS   ++P  Q   + Q + I++QLHKKC+  +D+S+VLTHPYDS
Sbjct: 177 QLVAGQPDTKQPSTELSSSEQSPAEQPDTITQAVVIITQLHKKCVTADDKSLVLTHPYDS 236

Query: 190 YLDVRTFLQERSKVLYMNNLPPDTTQSELESWFTQFGARPVGFWXXXXXXXXXXXXXXXX 249
           YLDVR FLQERSKVLYMNNLPPDTTQSELESWFTQFGARPVGFW                
Sbjct: 237 YLDVRNFLQERSKVLYMNNLPPDTTQSELESWFTQFGARPVGFWTVKNIVEETSNVNNNW 296

Query: 250 XXXXXXYVEEQDSISGFVVFQTHEEATEALSLNGRSILSNMANTKQPRVVEHVVELQPSS 309
                 YVE QDSISGFVVFQ+HEEATEALSLNGRSILSN+ANTKQPRV+EH+VE+QPSS
Sbjct: 297 SSNNSTYVEAQDSISGFVVFQSHEEATEALSLNGRSILSNIANTKQPRVIEHIVEIQPSS 356

Query: 310 TRVLDRAHELLSPFPQSKNKPRPGDWNCPSCGFSNFQRRTACFRCSFPATSAVNVNKS 367
            RVLDRA E+LSPFPQSKNKPRPGDWNCPSCGFSNFQRRT+CFRCSFPA S   +N +
Sbjct: 357 ARVLDRAQEILSPFPQSKNKPRPGDWNCPSCGFSNFQRRTSCFRCSFPAASGAGMNNN 414

 Score = 90.1 bits (222), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 43/87 (49%), Positives = 52/87 (59%), Gaps = 17/87 (19%)

Query: 497 VPFRAGDWKCVSCTYHNFAKNVVCLRCGGPKTVGGAGVANQANLDVLLLDGSCQNGSAST 556
           VPFRAGDWKC +CTYHNFAKNVVCLRCGGPK+                     Q    + 
Sbjct: 488 VPFRAGDWKCATCTYHNFAKNVVCLRCGGPKSTEHQ-----------------QKELGTV 530

Query: 557 ISLSEMHNGGSSFGVSLETRSSSEPAW 583
            S +++ + G+  G+SL TRS SEPAW
Sbjct: 531 NSYTDIQDIGNGMGISLNTRSFSEPAW 557

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 21/41 (51%), Gaps = 1/41 (2%)

Query: 500 RAGDWKCVSCTYHNFAKNVVCLRCGGPKTVGGAGVANQANL 540
           R GDW C SC + NF +   C RC  P    GAG+ N   +
Sbjct: 378 RPGDWNCPSCGFSNFQRRTSCFRCSFP-AASGAGMNNNGYM 417

 Score = 39.3 bits (90), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 17/30 (56%)

Query: 331 RPGDWNCPSCGFSNFQRRTACFRCSFPATS 360
           R GDW C +C + NF +   C RC  P ++
Sbjct: 491 RAGDWKCATCTYHNFAKNVVCLRCGGPKST 520

>Suva_4.79 Chr4 complement(148569..150695) [2127 bp, 708 aa] {ON}
           YDL167C (REAL)
          Length = 708

 Score =  466 bits (1200), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 234/387 (60%), Positives = 273/387 (70%), Gaps = 29/387 (7%)

Query: 1   MYYVVLEAETVHGEEKPKDHTRVSRICYQFIHSDTLQSVFEQ----PIIVEVGPGQLREQ 56
           M+YVVLE +  H  + PKD  R+  + YQ + ++TL S +E      I V+     L   
Sbjct: 1   MHYVVLELQVAHLPDSPKDQCRIVNMAYQIVDAETLASHYENGSSPSIDVDGEKKSLESA 60

Query: 57  VAQLDQLVTSKITSDNHEFALVSLSSTWHIRVTIPRQARDEGFILPPYLQHPKVFDLWKE 116
           + QLD+ +   I +D  +F LVSL STWHIRVT+PRQARD+GFIL  YLQHP++FDLWKE
Sbjct: 61  MGQLDKDIQHIIGND--DFVLVSLCSTWHIRVTLPRQARDDGFILTSYLQHPRLFDLWKE 118

Query: 117 YDRWCVNHPETLPLRKN-------------SNLGKKSRDLPELSRVLEAP----LQTFPL 159
           ++RWC+NHPE + LRKN               L K ++DL E+ R+LE P       F L
Sbjct: 119 FERWCINHPEIMGLRKNILNNNSNTKSSSIGTLIKNTKDLNEMMRILEIPNTVEEDDFAL 178

Query: 160 D------QTIGILSQLHKKCLLPEDQSMVLTHPYDSYLDVRTFLQERSKVLYMNNLPPDT 213
           D      +TI +L QLHKKC   ED   VLT PYDS+ D+R+FLQERSKVLYMNNLPPDT
Sbjct: 179 DNHSLLQRTIDVLLQLHKKCSSAEDMKSVLTQPYDSHTDIRSFLQERSKVLYMNNLPPDT 238

Query: 214 TQSELESWFTQFGARPVGFWXXXXXXXXXXXXXXXXXXXXXXYVEEQDSISGFVVFQTHE 273
           TQSELESWFTQ+GARPVGFW                      YVE+QDSISGFVVFQTHE
Sbjct: 239 TQSELESWFTQYGARPVGFWTVKNIVEDTSNVNNNWSLNNSPYVEDQDSISGFVVFQTHE 298

Query: 274 EATEALSLNGRSILSNMANTKQPRVVEHVVELQPSSTRVLDRAHELLSPFPQSKNKPRPG 333
           EATE L+LNGRSILSN+ANTKQPRVVEHV+ELQPSST VLD+A E+LSPFPQSKNKPRPG
Sbjct: 299 EATEVLALNGRSILSNLANTKQPRVVEHVLELQPSSTGVLDKAQEILSPFPQSKNKPRPG 358

Query: 334 DWNCPSCGFSNFQRRTACFRCSFPATS 360
           DWNCPSCGFSNFQRRTACFRCSFPA S
Sbjct: 359 DWNCPSCGFSNFQRRTACFRCSFPAPS 385

 Score = 76.6 bits (187), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 29/35 (82%), Positives = 32/35 (91%)

Query: 497 VPFRAGDWKCVSCTYHNFAKNVVCLRCGGPKTVGG 531
           +PFRAGDWKC +CTYHNFAKNVVCLRCGGPK+V  
Sbjct: 560 IPFRAGDWKCSTCTYHNFAKNVVCLRCGGPKSVNA 594

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 24/47 (51%), Gaps = 2/47 (4%)

Query: 331 RPGDWNCPSCGFSNFQRRTACFRCSFPATSAVNVNKSTPASFIKQAT 377
           R GDW C +C + NF +   C RC  P   +VN + S    +I  +T
Sbjct: 563 RAGDWKCSTCTYHNFAKNVVCLRCGGP--KSVNADVSETNHYIDTST 607

 Score = 38.9 bits (89), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 15/27 (55%)

Query: 500 RAGDWKCVSCTYHNFAKNVVCLRCGGP 526
           R GDW C SC + NF +   C RC  P
Sbjct: 356 RPGDWNCPSCGFSNFQRRTACFRCSFP 382

>Skud_4.90 Chr4 complement(156704..158827) [2124 bp, 707 aa] {ON}
           YDL167C (REAL)
          Length = 707

 Score =  461 bits (1186), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 236/390 (60%), Positives = 270/390 (69%), Gaps = 30/390 (7%)

Query: 1   MYYVVLEAETVHGEEKPKDHTRVSRICYQFIHSDTLQSVFE----QPIIVEVGPGQLREQ 56
           M+YVVLE +  +  + PKD  R+  I YQ + ++TL   ++      I V+     L   
Sbjct: 1   MHYVVLELQVAYLPDSPKDQCRIGSIAYQIVDAETLICHYDIDSLPKIEVDGEAKSLESA 60

Query: 57  VAQLDQLVTSKITSDNHEFALVSLSSTWHIRVTIPRQARDEGFILPPYLQHPKVFDLWKE 116
           + QLD+ +   I +D  EF LVSL STWHIRVT+ RQARD+GFIL  YLQHP++FDLWKE
Sbjct: 61  MIQLDKDIHDVIGND--EFVLVSLCSTWHIRVTLSRQARDDGFILTSYLQHPRLFDLWKE 118

Query: 117 YDRWCVNHPETLPLRK-----NSN---------LGKKSRDLPELSRVLEA---------- 152
           +DRWCVNHPE L  RK     NSN         L K ++D  E+ R+LE           
Sbjct: 119 FDRWCVNHPELLEQRKATSNNNSNTKAGGSNGALAKNTKDFNEMIRILEVSTPSEGADFI 178

Query: 153 PLQTFPLDQTIGILSQLHKKCLLPEDQSMVLTHPYDSYLDVRTFLQERSKVLYMNNLPPD 212
           P +   L +T  IL QLHKKC  PED   VLT PYDSY D+RTFLQERSKVLYMNNLPPD
Sbjct: 179 PEEQSLLRRTTDILLQLHKKCSSPEDMKSVLTQPYDSYTDIRTFLQERSKVLYMNNLPPD 238

Query: 213 TTQSELESWFTQFGARPVGFWXXXXXXXXXXXXXXXXXXXXXXYVEEQDSISGFVVFQTH 272
           TTQSELESWFTQ+G RPVGFW                      YVEEQDSISGFVVFQTH
Sbjct: 239 TTQSELESWFTQYGVRPVGFWTVKNIVEDTSNVNNNWSLNNSPYVEEQDSISGFVVFQTH 298

Query: 273 EEATEALSLNGRSILSNMANTKQPRVVEHVVELQPSSTRVLDRAHELLSPFPQSKNKPRP 332
           EEATE L+LNGRSILSN+ANTKQPRVVEHV+ELQPSST VLD+A E+LSPFPQSKNKPRP
Sbjct: 299 EEATEVLALNGRSILSNLANTKQPRVVEHVLELQPSSTGVLDKAQEILSPFPQSKNKPRP 358

Query: 333 GDWNCPSCGFSNFQRRTACFRCSFPATSAV 362
           GDWNCPSCGFSNFQRRTACFRCSFPA S +
Sbjct: 359 GDWNCPSCGFSNFQRRTACFRCSFPAPSNI 388

 Score = 77.4 bits (189), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 36/43 (83%), Gaps = 2/43 (4%)

Query: 497 VPFRAGDWKCVSCTYHNFAKNVVCLRCGGPKTVGGAGVANQAN 539
           +PFRAGDWKC +CTYHNFAKNVVCLRCGGPK+V     AN+ N
Sbjct: 580 IPFRAGDWKCSTCTYHNFAKNVVCLRCGGPKSVNAD--ANETN 620

 Score = 40.8 bits (94), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 13/37 (35%), Positives = 20/37 (54%)

Query: 331 RPGDWNCPSCGFSNFQRRTACFRCSFPATSAVNVNKS 367
           R GDW C +C + NF +   C RC  P +   + N++
Sbjct: 583 RAGDWKCSTCTYHNFAKNVVCLRCGGPKSVNADANET 619

 Score = 38.5 bits (88), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 15/27 (55%)

Query: 500 RAGDWKCVSCTYHNFAKNVVCLRCGGP 526
           R GDW C SC + NF +   C RC  P
Sbjct: 357 RPGDWNCPSCGFSNFQRRTACFRCSFP 383

>ACL149W Chr3 (88715..90601) [1887 bp, 628 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YDL167C (NRP1)
          Length = 628

 Score =  457 bits (1175), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 228/369 (61%), Positives = 261/369 (70%), Gaps = 10/369 (2%)

Query: 1   MYYVVLEAETVHGEEKPKDHTRVSRICYQFIHSDTLQSVFEQPIIVEVGPGQLREQVAQL 60
           MYYV+ E +  H E+ PKDH RVS+I YQ IH   L  ++     +EVG G ++    QL
Sbjct: 1   MYYVLFECDVAHKEDTPKDHARVSKIYYQLIHEPELLPLYADAREIEVGGGGVQMATGQL 60

Query: 61  DQLVTSKITSDNHEFALVSLSSTWHIRVTIPRQARDEGFILPPYLQHPKVFDLWKEYDRW 120
           +  +     S+   F L SL STWH+RVT+PRQA DEG +LP +L H KVFDLWKE DRW
Sbjct: 61  EAALQEATASE--PFVLCSLHSTWHLRVTLPRQAHDEGSMLPMFLAHAKVFDLWKECDRW 118

Query: 121 CVNHPETLPLRKNSNLGKKSRDLPELSRVLEAPLQTFP---LDQTIGILSQLHKKCLLPE 177
           C NH       +  N G K  D+ EL RVL+   Q      + Q   +L QLH KC   E
Sbjct: 119 CANHVS----ERACNAGAKG-DVAELFRVLDLDEQLVSHAYIQQATRVLLQLHNKCTTAE 173

Query: 178 DQSMVLTHPYDSYLDVRTFLQERSKVLYMNNLPPDTTQSELESWFTQFGARPVGFWXXXX 237
           DQS+VLTHPYDSY D+ +F+QERS+VLYMNNLPPDTTQSELESWFTQFGARPVGFW    
Sbjct: 174 DQSLVLTHPYDSYADMTSFIQERSEVLYMNNLPPDTTQSELESWFTQFGARPVGFWTVKN 233

Query: 238 XXXXXXXXXXXXXXXXXXYVEEQDSISGFVVFQTHEEATEALSLNGRSILSNMANTKQPR 297
                             YVEE DSISGFVVFQ+HE A+EAL+LNGRSILSNMANTKQPR
Sbjct: 234 VVEDTSNVNNNWSSNNSRYVEEHDSISGFVVFQSHEAASEALNLNGRSILSNMANTKQPR 293

Query: 298 VVEHVVELQPSSTRVLDRAHELLSPFPQSKNKPRPGDWNCPSCGFSNFQRRTACFRCSFP 357
           VVEHVVEL+PSS+RVLD A E+LSPFPQSKNKPRPGDWNCPSCGFSNFQRR ACFRCSFP
Sbjct: 294 VVEHVVELKPSSSRVLDCAQEILSPFPQSKNKPRPGDWNCPSCGFSNFQRRIACFRCSFP 353

Query: 358 ATSAVNVNK 366
           ATSAV V+K
Sbjct: 354 ATSAVTVSK 362

 Score = 74.3 bits (181), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 40/84 (47%), Positives = 51/84 (60%), Gaps = 11/84 (13%)

Query: 497 VPFRAGDWKCVSCTYHNFAKNVVCLRCGGPKTVGGAGVANQANLDVLLLDGSCQNGSAST 556
           VPFRAGDWKC++C+YHNFAKN+VCLRCG PKT         AN D      S Q   +S+
Sbjct: 501 VPFRAGDWKCLNCSYHNFAKNIVCLRCGNPKT---------ANEDE--TQASLQGLHSSS 549

Query: 557 ISLSEMHNGGSSFGVSLETRSSSE 580
             +    +  SS  VS++ RS +E
Sbjct: 550 GPVGAQDSAISSVTVSIDRRSKNE 573

 Score = 40.8 bits (94), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 17/29 (58%)

Query: 500 RAGDWKCVSCTYHNFAKNVVCLRCGGPKT 528
           R GDW C SC + NF + + C RC  P T
Sbjct: 327 RPGDWNCPSCGFSNFQRRIACFRCSFPAT 355

 Score = 40.4 bits (93), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 20/36 (55%), Gaps = 1/36 (2%)

Query: 326 SKNKP-RPGDWNCPSCGFSNFQRRTACFRCSFPATS 360
           S N P R GDW C +C + NF +   C RC  P T+
Sbjct: 498 SSNVPFRAGDWKCLNCSYHNFAKNIVCLRCGNPKTA 533

>Smik_4.71 Chr4 complement(137635..139914) [2280 bp, 759 aa] {ON}
           YDL167C (REAL)
          Length = 759

 Score =  460 bits (1184), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 234/389 (60%), Positives = 269/389 (69%), Gaps = 29/389 (7%)

Query: 1   MYYVVLEAETVHGEEKPKDHTRVSRICYQFIHSDTLQSVFEQP----IIVEVGPGQLREQ 56
           M+YVVLE +  H    PKD  R+  I YQF+ ++TL   +E      I V+     L   
Sbjct: 1   MHYVVLELQVAHLPNSPKDQCRIVNIAYQFVDAETLACHYENNSLPNIEVDRETRSLETA 60

Query: 57  VAQLDQLVTSKITSDNHEFALVSLSSTWHIRVTIPRQARDEGFILPPYLQHPKVFDLWKE 116
           + QLD+ +   + +D  EF LVSL STWHIRVT+PRQARD+GFIL  YLQHPK+FDLWKE
Sbjct: 61  MIQLDKAIQDILGND--EFVLVSLYSTWHIRVTLPRQARDDGFILTSYLQHPKLFDLWKE 118

Query: 117 YDRWCVNHPETLPLRK----NSN---------LGKKSRDLPELSRVLE----------AP 153
           +DRWCVNHPE L   K    N+N         L K ++DL E+ R+LE           P
Sbjct: 119 FDRWCVNHPEILEQMKTASNNNNSGTKGNSGGLAKNAKDLDEMIRILEISSSTEEAVSVP 178

Query: 154 LQTFPLDQTIGILSQLHKKCLLPEDQSMVLTHPYDSYLDVRTFLQERSKVLYMNNLPPDT 213
            +   L +T  IL  LH+KC   ED   VLT PYDS+ D+RTFLQERSKVLYMNNLPPDT
Sbjct: 179 EEYSLLRRTTDILIHLHRKCCSSEDMKFVLTQPYDSHTDIRTFLQERSKVLYMNNLPPDT 238

Query: 214 TQSELESWFTQFGARPVGFWXXXXXXXXXXXXXXXXXXXXXXYVEEQDSISGFVVFQTHE 273
           TQSELESWFTQ+G RPVGFW                      YVE+QDSISGFVVFQTHE
Sbjct: 239 TQSELESWFTQYGVRPVGFWTVKNIVEDTSNINNNWSLNNSPYVEDQDSISGFVVFQTHE 298

Query: 274 EATEALSLNGRSILSNMANTKQPRVVEHVVELQPSSTRVLDRAHELLSPFPQSKNKPRPG 333
           EATE L+LNGRSILSN+ANTKQPRVVEHV+ELQPSST VLD+A E+LSPFPQSKNKPRPG
Sbjct: 299 EATEVLALNGRSILSNLANTKQPRVVEHVLELQPSSTGVLDKAQEILSPFPQSKNKPRPG 358

Query: 334 DWNCPSCGFSNFQRRTACFRCSFPATSAV 362
           DWNCPSCGFSNFQRRTACFRCSFPA S +
Sbjct: 359 DWNCPSCGFSNFQRRTACFRCSFPAPSNI 387

 Score = 76.6 bits (187), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 37/43 (86%), Gaps = 2/43 (4%)

Query: 497 VPFRAGDWKCVSCTYHNFAKNVVCLRCGGPKTVGGAGVANQAN 539
           +PFRAGDWKC +CTYHNFAKNVVCLRCGGPK+V  +  AN+ N
Sbjct: 618 IPFRAGDWKCSTCTYHNFAKNVVCLRCGGPKSV--STDANETN 658

 Score = 42.0 bits (97), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 13/37 (35%), Positives = 21/37 (56%)

Query: 331 RPGDWNCPSCGFSNFQRRTACFRCSFPATSAVNVNKS 367
           R GDW C +C + NF +   C RC  P + + + N++
Sbjct: 621 RAGDWKCSTCTYHNFAKNVVCLRCGGPKSVSTDANET 657

 Score = 38.5 bits (88), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 15/27 (55%)

Query: 500 RAGDWKCVSCTYHNFAKNVVCLRCGGP 526
           R GDW C SC + NF +   C RC  P
Sbjct: 356 RPGDWNCPSCGFSNFQRRTACFRCSFP 382

>YDL167C Chr4 complement(160995..163154) [2160 bp, 719 aa] {ON}
           NRP1Putative RNA binding protein of unknown function;
           localizes to stress granules induced by glucose
           deprivation; predicted to be involved in ribosome
           biogenesis
          Length = 719

 Score =  459 bits (1180), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 231/386 (59%), Positives = 269/386 (69%), Gaps = 28/386 (7%)

Query: 1   MYYVVLEAETVHGEEKPKDHTRVSRICYQFIHSDTLQSVFEQ----PIIVEVGPGQLREQ 56
           M+YVVLE +  H  + PKD  R++ I +Q ++++TL   +       I V      L   
Sbjct: 1   MHYVVLELQVAHLPDTPKDQCRIANIAFQIVNAETLVCHYGTNSLPSIEVNGTTKSLESA 60

Query: 57  VAQLDQLVTSKITSDNHEFALVSLSSTWHIRVTIPRQARDEGFILPPYLQHPKVFDLWKE 116
           + QLD+ +   I +D  +F LVSL STWHIRVT+PRQARD+GFIL  YLQHPKVFDLWKE
Sbjct: 61  MVQLDKDIHDVIGND--DFVLVSLYSTWHIRVTLPRQARDDGFILTSYLQHPKVFDLWKE 118

Query: 117 YDRWCVNHPETLPLRK------------NSNLGKKSRDLPELSRVLEAPLQT-----FP- 158
           +DRWCVNHPE L  +K            + N  K ++DL E+ R+LE  + T      P 
Sbjct: 119 FDRWCVNHPEILGQKKAISNNNCNTKSISINAAKNTKDLDEIVRILEVSIPTEEAGSVPE 178

Query: 159 ----LDQTIGILSQLHKKCLLPEDQSMVLTHPYDSYLDVRTFLQERSKVLYMNNLPPDTT 214
               L +T  IL QLHKKC  PED   VLT PYDS+ D+R FLQE+SK+LYMNNLPPDTT
Sbjct: 179 IYSLLKRTTDILIQLHKKCTSPEDMESVLTKPYDSHTDIRAFLQEKSKILYMNNLPPDTT 238

Query: 215 QSELESWFTQFGARPVGFWXXXXXXXXXXXXXXXXXXXXXXYVEEQDSISGFVVFQTHEE 274
           QSELESWFTQ+G RPVGFW                      YVE+QDSISGFVVFQTHEE
Sbjct: 239 QSELESWFTQYGVRPVGFWTVKNIVEDTSNVNNNWSLNNSPYVEDQDSISGFVVFQTHEE 298

Query: 275 ATEALSLNGRSILSNMANTKQPRVVEHVVELQPSSTRVLDRAHELLSPFPQSKNKPRPGD 334
           ATE L+LNGRSILSN+ANTKQPRVVEHV+ELQPSST VLD+A E+LSPFPQSKNKPRPGD
Sbjct: 299 ATEVLALNGRSILSNLANTKQPRVVEHVLELQPSSTGVLDKAQEILSPFPQSKNKPRPGD 358

Query: 335 WNCPSCGFSNFQRRTACFRCSFPATS 360
           WNCPSCGFSNFQRRTACFRCSFPA S
Sbjct: 359 WNCPSCGFSNFQRRTACFRCSFPAPS 384

 Score = 82.4 bits (202), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 38/74 (51%), Positives = 49/74 (66%), Gaps = 2/74 (2%)

Query: 497 VPFRAGDWKCVSCTYHNFAKNVVCLRCGGPKTVGGAGVANQANLDVLLLDGSCQNGSAST 556
           +PFRAGDWKC +CTYHNFAKNVVCLRCGGPK++ G        +D      + +  S + 
Sbjct: 578 MPFRAGDWKCSTCTYHNFAKNVVCLRCGGPKSISGDASETNHYIDSSTFGPASRTPSNNN 637

Query: 557 ISLSEMHNGGSSFG 570
           IS++   NGGS+ G
Sbjct: 638 ISVNT--NGGSNAG 649

 Score = 38.5 bits (88), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 16/29 (55%)

Query: 331 RPGDWNCPSCGFSNFQRRTACFRCSFPAT 359
           R GDW C +C + NF +   C RC  P +
Sbjct: 581 RAGDWKCSTCTYHNFAKNVVCLRCGGPKS 609

 Score = 38.5 bits (88), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 15/27 (55%)

Query: 500 RAGDWKCVSCTYHNFAKNVVCLRCGGP 526
           R GDW C SC + NF +   C RC  P
Sbjct: 355 RPGDWNCPSCGFSNFQRRTACFRCSFP 381

>NCAS0A14150 Chr1 (2780086..2781798) [1713 bp, 570 aa] {ON}
           Anc_7.349 YDL167C
          Length = 570

 Score =  449 bits (1155), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 219/376 (58%), Positives = 272/376 (72%), Gaps = 20/376 (5%)

Query: 1   MYYVVLEAETVHGEEKPKDHTRVSRICYQFIHSDTLQSVFEQPIIVEV--GPGQLREQVA 58
           M+YVVLE ET H  E PKDH+R+++  YQFI+S+TLQ+ FE+P  +++       ++ ++
Sbjct: 1   MFYVVLELETSHQVETPKDHSRITKCSYQFINSETLQATFEEPKSIDIPDMANAFKDTIS 60

Query: 59  QLDQLVTSKITSDNHEFALVSLSSTWHIRVTIPRQARDEGFILPPYLQHPKVFDLWKEYD 118
           QL+  + ++I  D  +F L SL S W IRVT+PRQA D GFILP YL+HP+VF+LWKE+D
Sbjct: 61  QLEADIKAEIV-DFSDFVLCSLFSVWDIRVTLPRQAHDLGFILPSYLKHPRVFNLWKEFD 119

Query: 119 RWCVNHPETLPLRKNSNLGKKS----RDLPELSRVLE------APLQT------FPLDQT 162
           +WC NHPE +P+RK SNL  KS     D+ ++  +LE       PL T        +  +
Sbjct: 120 KWCGNHPEVIPMRK-SNLRVKSPKTAGDISDIVNILEIDTSLQVPLSTSNPQTLLSIQDS 178

Query: 163 IGILSQLHKKCLLPEDQSMVLTHPYDSYLDVRTFLQERSKVLYMNNLPPDTTQSELESWF 222
             IL++L KKC   +D  +VLT PYDSY D++TFLQERS+VLYMNNLP DTTQSELESWF
Sbjct: 179 TNILTKLRKKCTTLDDVQLVLTRPYDSYADIKTFLQERSRVLYMNNLPSDTTQSELESWF 238

Query: 223 TQFGARPVGFWXXXXXXXXXXXXXXXXXXXXXXYVEEQDSISGFVVFQTHEEATEALSLN 282
           TQFGARP+GFW                       V+EQD ++GFVVFQ+HEEATEAL LN
Sbjct: 239 TQFGARPIGFWTAKNTIEETSSINSNWSLNGNPLVDEQDCVAGFVVFQSHEEATEALVLN 298

Query: 283 GRSILSNMANTKQPRVVEHVVELQPSSTRVLDRAHELLSPFPQSKNKPRPGDWNCPSCGF 342
           GRSILSN+ANTKQPRVVEH+VE+QPSSTRVLD   ++LS FPQSKNKPRPGDW+CPSCGF
Sbjct: 299 GRSILSNIANTKQPRVVEHIVEIQPSSTRVLDAGQDILSAFPQSKNKPRPGDWSCPSCGF 358

Query: 343 SNFQRRTACFRCSFPA 358
           SNFQRRTACFRCSFPA
Sbjct: 359 SNFQRRTACFRCSFPA 374

 Score = 70.5 bits (171), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 30/43 (69%), Positives = 32/43 (74%)

Query: 497 VPFRAGDWKCVSCTYHNFAKNVVCLRCGGPKTVGGAGVANQAN 539
           VPFRAGDWKC SCTYHNFAKNVVCLRC  PK    +   N+ N
Sbjct: 473 VPFRAGDWKCPSCTYHNFAKNVVCLRCRIPKISQQSHNGNEGN 515

 Score = 44.3 bits (103), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 17/30 (56%)

Query: 331 RPGDWNCPSCGFSNFQRRTACFRCSFPATS 360
           R GDW CPSC + NF +   C RC  P  S
Sbjct: 476 RAGDWKCPSCTYHNFAKNVVCLRCRIPKIS 505

 Score = 40.4 bits (93), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 21/43 (48%), Gaps = 2/43 (4%)

Query: 500 RAGDWKCVSCTYHNFAKNVVCLRCG--GPKTVGGAGVANQANL 540
           R GDW C SC + NF +   C RC    P    G  ++  +N+
Sbjct: 347 RPGDWSCPSCGFSNFQRRTACFRCSFPAPNNNKGLNISGTSNI 389

>KLLA0D12364g Chr4 complement(1051765..1053660) [1896 bp, 631 aa]
           {ON} some similarities with uniprot|P32770 Saccharomyces
           cerevisiae YDL167C NRP1
          Length = 631

 Score =  411 bits (1057), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 206/398 (51%), Positives = 259/398 (65%), Gaps = 38/398 (9%)

Query: 1   MYYVVLEAETVHGEEKPKDHTRVSRICYQFIHSDTLQSVFEQPIIVEVGPGQ-LREQVAQ 59
           M+YV+ E ETV+ EE PKDHT +S I YQ I  +TL+ ++E+     +     L+  +  
Sbjct: 1   MFYVLFECETVYSEEAPKDHTMISSIAYQIISVETLKPIWEEARRHSIDATHSLKNTIQS 60

Query: 60  LDQLVTSKITSDNHEFALVSLSSTWHIRVTIPRQARDEGFILPPYLQHPKVFDLWKEYDR 119
           ++  V   +  +  EF L SL+STW +RVT+ RQARDE ++LP +LQHPKVFDLW+E DR
Sbjct: 61  MENAVMENVAGE--EFVLCSLNSTWDLRVTLSRQARDESWLLPSFLQHPKVFDLWREVDR 118

Query: 120 WCVNHPETLPL---RKNSNLGKKS----RDLPELSRVLEAPL------------------ 154
           W  NHPE       R   N+   +    R+  +L + ++A L                  
Sbjct: 119 WYRNHPEQYEKGTDRGGGNVANTNTTTQRNKHKLVKSIDALLVFLNIDLDNKSTTDQRME 178

Query: 155 ---------QTFP-LDQTIGILSQLHKKCLLPEDQSMVLTHPYDSYLDVRTFLQERSKVL 204
                    +T P + Q   +L +LH+ C    DQ++VLTHP+DSYLD++ FL E+S VL
Sbjct: 179 QVNIDKNSFETLPSIQQCEKVLFKLHRNCTSDNDQTLVLTHPFDSYLDIKNFLLEKSTVL 238

Query: 205 YMNNLPPDTTQSELESWFTQFGARPVGFWXXXXXXXXXXXXXXXXXXXXXXYVEEQDSIS 264
           YMNNLPPDTTQSELESWF QFG+RPVGFW                      YV+EQDSIS
Sbjct: 239 YMNNLPPDTTQSELESWFAQFGSRPVGFWTVKNVVEDTSNVNNNWSTNNNLYVDEQDSIS 298

Query: 265 GFVVFQTHEEATEALSLNGRSILSNMANTKQPRVVEHVVELQPSSTRVLDRAHELLSPFP 324
           GFVV+Q HEEA ++L+LNGRSILSNM+NTKQPRVVEHVVE+QPSS  VLDRA E+L+ FP
Sbjct: 299 GFVVYQAHEEALDSLTLNGRSILSNMSNTKQPRVVEHVVEIQPSSNSVLDRAQEILTAFP 358

Query: 325 QSKNKPRPGDWNCPSCGFSNFQRRTACFRCSFPATSAV 362
           QSKNKPRPGDW CPSC FSNFQRRTACFRCSFP +SA+
Sbjct: 359 QSKNKPRPGDWTCPSCSFSNFQRRTACFRCSFPMSSAL 396

 Score = 88.6 bits (218), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 48/119 (40%), Positives = 61/119 (51%), Gaps = 32/119 (26%)

Query: 497 VPFRAGDWKCVSCTYHNFAKNVVCLRCGGPKTVGGAGVANQANLDVLLLDGSC------- 549
           VPFRAGDWKC +CTYHNFAKNVVCLRCGGPKT   +  +N A +     + +        
Sbjct: 505 VPFRAGDWKCANCTYHNFAKNVVCLRCGGPKTANVSANSNNATVTNATSNAATSNKLVSH 564

Query: 550 ----------------QNGSASTISLSEMHNGG---------SSFGVSLETRSSSEPAW 583
                           QNG  +  ++S+++  G         S  G+SL  RSSSEP W
Sbjct: 565 DDMSVTPSLQNSSIYHQNGRINVHNMSDVNTTGYVSGQVPSFSGVGLSLNGRSSSEPNW 623

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 23/45 (51%), Gaps = 1/45 (2%)

Query: 322 PFPQSKNKP-RPGDWNCPSCGFSNFQRRTACFRCSFPATSAVNVN 365
           P     N P R GDW C +C + NF +   C RC  P T+ V+ N
Sbjct: 498 PMSNGSNVPFRAGDWKCANCTYHNFAKNVVCLRCGGPKTANVSAN 542

 Score = 39.7 bits (91), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 16/27 (59%)

Query: 500 RAGDWKCVSCTYHNFAKNVVCLRCGGP 526
           R GDW C SC++ NF +   C RC  P
Sbjct: 365 RPGDWTCPSCSFSNFQRRTACFRCSFP 391

>TBLA0E02060 Chr5 (502492..504186) [1695 bp, 564 aa] {ON} Anc_7.349
           YDL167C
          Length = 564

 Score =  401 bits (1031), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 198/366 (54%), Positives = 250/366 (68%), Gaps = 9/366 (2%)

Query: 1   MYYVVLEAETVHGEEKPKDHTRVSRICYQFIHSDTLQSVFEQPII--VEVGPGQLREQVA 58
           MYY ++E +T H  E PKDHT++  I YQFI+  TLQ+ F    I  ++     L E +A
Sbjct: 1   MYYTLIELQTAHDAEAPKDHTKIINISYQFINQSTLQASFPDDKIPNIDCTTLPLSESIA 60

Query: 59  QLDQLVTSKITSDNHEFALVSLSSTWHIRVTIPRQARDEGFILPPYLQHPKVFDLWKEYD 118
            L + +   +  +  +F L SL+STW +RVTI RQA+DE + LP + ++P++FDLWKE+D
Sbjct: 61  LLQKDLELNL-PNGEDFVLCSLNSTWDLRVTISRQAKDEQYTLPTFFKYPRIFDLWKEFD 119

Query: 119 RWCVNHPETLPLRKNSNLGKKSRDLPELSRVLEAP-LQTFP-LDQTIGILSQLHKKCLLP 176
           RWCVNH E +  R      +K +DL +L+ +L  P ++T   +     +L QLH+KC   
Sbjct: 120 RWCVNHKELVQTRD----PRKLKDLKQLATLLHIPSVETLSSISLASKVLVQLHEKCTTE 175

Query: 177 EDQSMVLTHPYDSYLDVRTFLQERSKVLYMNNLPPDTTQSELESWFTQFGARPVGFWXXX 236
           +DQ  VLT PYDS LD   F++  S VLYMNNLPPDTTQSELE+WFTQFG RP+GFW   
Sbjct: 176 DDQEKVLTSPYDSKLDWDIFIETSSTVLYMNNLPPDTTQSELETWFTQFGVRPIGFWTVK 235

Query: 237 XXXXXXXXXXXXXXXXXXXYVEEQDSISGFVVFQTHEEATEALSLNGRSILSNMANTKQP 296
                              YVEE DSISGF+VF TH+EA + L+LNG SILSN+ANTKQP
Sbjct: 236 NILEDTSIINNNWCVNNSPYVEEIDSISGFIVFSTHKEAIDVLTLNGHSILSNIANTKQP 295

Query: 297 RVVEHVVELQPSSTRVLDRAHELLSPFPQSKNKPRPGDWNCPSCGFSNFQRRTACFRCSF 356
           RVVEHVVE+QPSS +V++R   +L+PFPQSKNKPRPGDWNCPSCGFSNFQRRTACFRCSF
Sbjct: 296 RVVEHVVEIQPSSPKVMERIQSILTPFPQSKNKPRPGDWNCPSCGFSNFQRRTACFRCSF 355

Query: 357 PATSAV 362
           P   AV
Sbjct: 356 PQQQAV 361

 Score = 70.9 bits (172), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 30/32 (93%)

Query: 497 VPFRAGDWKCVSCTYHNFAKNVVCLRCGGPKT 528
           VPFRAGDWKC++C YHNFAKN+VCLRC GPK+
Sbjct: 477 VPFRAGDWKCLTCGYHNFAKNIVCLRCSGPKS 508

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 18/29 (62%)

Query: 331 RPGDWNCPSCGFSNFQRRTACFRCSFPAT 359
           R GDW C +CG+ NF +   C RCS P +
Sbjct: 480 RAGDWKCLTCGYHNFAKNIVCLRCSGPKS 508

 Score = 39.3 bits (90), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 16/28 (57%)

Query: 500 RAGDWKCVSCTYHNFAKNVVCLRCGGPK 527
           R GDW C SC + NF +   C RC  P+
Sbjct: 330 RPGDWNCPSCGFSNFQRRTACFRCSFPQ 357

>KAFR0B00870 Chr2 (162698..164326) [1629 bp, 542 aa] {ON} Anc_7.349
           YDL167C
          Length = 542

 Score =  397 bits (1020), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 210/391 (53%), Positives = 260/391 (66%), Gaps = 28/391 (7%)

Query: 1   MYYVVLEAETVHGEEKPKDHTRVSRICYQFIHSDTLQSVFEQ--PIIVEVGPGQLREQVA 58
           M+YV+LE +T+H  E PKDHTR++++ +Q ++++ L  V  +   I+++      +    
Sbjct: 1   MFYVILELDTLHQVETPKDHTRITKVTFQLVNANALGEVPTKVDQIVIDEQAESFKAAFE 60

Query: 59  QLDQLVTSKITSDNHEFALVSLSSTWHIRVTIPRQARDEGFILPPYLQHPKVFDLWKEYD 118
           +L++ +TS IT D+  F L SL STW IRVT+ RQARD G  +P +LQ+PK+FDL KEY 
Sbjct: 61  KLNESITS-ITRDS-SFILCSLFSTWDIRVTLNRQARDLGVSMPYFLQYPKIFDLMKEYQ 118

Query: 119 RWCVNHPETLPLR------KNSNLGKKSR------------DL----PELSRVLEAPLQT 156
           RWC+NHPE +  +      K  N+ KK              D+     E    ++  +  
Sbjct: 119 RWCLNHPEVMSWKPKLESDKTINMDKKKLGLLELLTVLGLEDMYNFKEENDGAIDDKMFK 178

Query: 157 FPLDQTIG--ILSQLHKKCLLPEDQSMVLTHPYDSYLDVRTFLQERSKVLYMNNLPPDTT 214
              D TI   +L QL  +C   +D   VLT PYDS  DVR+FLQERS+VLYMNNLP DTT
Sbjct: 179 NERDMTISTSVLLQLLIRCTTSDDTKNVLTCPYDSDTDVRSFLQERSRVLYMNNLPSDTT 238

Query: 215 QSELESWFTQFGARPVGFWXXXXXXXXXXXXXXXXXXXXXXYVEEQDSISGFVVFQTHEE 274
           QSELESWFTQFG RPVGFW                      YVEE DSI GFVVFQTHEE
Sbjct: 239 QSELESWFTQFGTRPVGFWTFKNVVGDTSSLANTWNSNNSPYVEELDSIPGFVVFQTHEE 298

Query: 275 ATEALSLNGRSILSNMANTKQPRVVEHVVELQPSSTRVLDRAHELLSPFPQSKNKPRPGD 334
           A E L+LNGR+ILSN+ANTKQPRVVEHVVE+QPSST VLD+AHE+LS FPQSKNKPRPGD
Sbjct: 299 AIEVLALNGRAILSNVANTKQPRVVEHVVEIQPSSTSVLDKAHEILSSFPQSKNKPRPGD 358

Query: 335 WNCPSCGFSNFQRRTACFRCSFPATSAVNVN 365
           W+CPSCGFSNFQRRTACFRCSFPA S  ++N
Sbjct: 359 WSCPSCGFSNFQRRTACFRCSFPAPSNGHIN 389

 Score = 75.1 bits (183), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 28/32 (87%), Positives = 30/32 (93%)

Query: 497 VPFRAGDWKCVSCTYHNFAKNVVCLRCGGPKT 528
           +PFRAGDW C SCTYHNFAKNV+CLRCGGPKT
Sbjct: 455 IPFRAGDWNCASCTYHNFAKNVLCLRCGGPKT 486

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 16/32 (50%), Positives = 19/32 (59%)

Query: 331 RPGDWNCPSCGFSNFQRRTACFRCSFPATSAV 362
           R GDWNC SC + NF +   C RC  P TS +
Sbjct: 458 RAGDWNCASCTYHNFAKNVLCLRCGGPKTSTI 489

 Score = 39.7 bits (91), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 16/32 (50%)

Query: 500 RAGDWKCVSCTYHNFAKNVVCLRCGGPKTVGG 531
           R GDW C SC + NF +   C RC  P    G
Sbjct: 355 RPGDWSCPSCGFSNFQRRTACFRCSFPAPSNG 386

>Kpol_530.32 s530 complement(78552..80606) [2055 bp, 684 aa] {ON}
           complement(78552..80606) [2055 nt, 685 aa]
          Length = 684

 Score =  397 bits (1019), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 198/416 (47%), Positives = 259/416 (62%), Gaps = 61/416 (14%)

Query: 1   MYYVVLEAETVHGEEKPKDHTRVSRICYQFIHSDTLQSVFEQPIIVEVGPGQ-----LRE 55
           MYY+V+E +T+H  E PKDHTR+S++ YQF+ +++L+  + +  +  +          ++
Sbjct: 1   MYYIVIETDTLHSVETPKDHTRISKLSYQFVDAESLECYYGKDEVKVISIDDESAISFKD 60

Query: 56  QVAQLDQLVTSKITSDNHEFALVSLSSTWHIRVTIPRQARDEGFILPPYLQHPKVFDLWK 115
            + QLD+ + + +  D  EF   SL+S W +RVTIPRQARDE   LP YLQ  KVFDLWK
Sbjct: 61  MIKQLDEDIKTVVGDD--EFVFCSLNSVWDLRVTIPRQARDEIVTLPDYLQEVKVFDLWK 118

Query: 116 EYDRWCVNHPETLPLRKNSNLGK-----------------KSRDLPELS----------- 147
           E++RW  NH +T+ ++K+ NL                   +++++ E S           
Sbjct: 119 EFNRWAKNHSDTVTVKKSKNLRDLEELLRVLELTAEKTTVETKEIEENSDKEDEVHANTG 178

Query: 148 -----------------------RVLEAPLQTFPLDQTIGILSQLHKKCLLPEDQSMVLT 184
                                   + E PL+   +++   IL+ +HKKC   ED ++VLT
Sbjct: 179 AEESGNATITTAADDDNNEDDSKEMKETPLE---INRVTEILTTIHKKCTTEEDITLVLT 235

Query: 185 HPYDSYLDVRTFLQERSKVLYMNNLPPDTTQSELESWFTQFGARPVGFWXXXXXXXXXXX 244
            PYDS  D + F +E SK+LYMNNLPPDTTQSELESWF QFG++PV FW           
Sbjct: 236 KPYDSNSDFKAFKEEASKLLYMNNLPPDTTQSELESWFAQFGSKPVSFWTVKNIVEETSN 295

Query: 245 XXXXXXXXXXXYVEEQDSISGFVVFQTHEEATEALSLNGRSILSNMANTKQPRVVEHVVE 304
                      YVEEQDSISGFV FQ+H+EAT+AL LNGRSILSNMANTKQPRVVEH+VE
Sbjct: 296 VNNNWSMNNSPYVEEQDSISGFVSFQSHKEATDALLLNGRSILSNMANTKQPRVVEHIVE 355

Query: 305 LQPSSTRVLDRAHELLSPFPQSKNKPRPGDWNCPSCGFSNFQRRTACFRCSFPATS 360
           +QPSS  VL+R  ++ +PFPQSKNKPRPGDWNC SCGFSNFQRRTACFRCS+PA S
Sbjct: 356 IQPSSVTVLERVQDISAPFPQSKNKPRPGDWNCMSCGFSNFQRRTACFRCSYPAAS 411

 Score = 78.2 bits (191), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 30/45 (66%), Positives = 37/45 (82%)

Query: 497 VPFRAGDWKCVSCTYHNFAKNVVCLRCGGPKTVGGAGVANQANLD 541
           VPFRAGDWKC++C+YHNFAKNVVCLRCGGPK+   +G  N   ++
Sbjct: 540 VPFRAGDWKCIACSYHNFAKNVVCLRCGGPKSHINSGDINSPTMN 584

 Score = 40.8 bits (94), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 16/27 (59%)

Query: 500 RAGDWKCVSCTYHNFAKNVVCLRCGGP 526
           R GDW C+SC + NF +   C RC  P
Sbjct: 382 RPGDWNCMSCGFSNFQRRTACFRCSYP 408

 Score = 39.7 bits (91), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 16/29 (55%)

Query: 331 RPGDWNCPSCGFSNFQRRTACFRCSFPAT 359
           R GDW C +C + NF +   C RC  P +
Sbjct: 543 RAGDWKCIACSYHNFAKNVVCLRCGGPKS 571

>TPHA0F02960 Chr6 (651108..653072) [1965 bp, 654 aa] {ON} Anc_7.349
           YDL167C
          Length = 654

 Score =  377 bits (967), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 191/395 (48%), Positives = 240/395 (60%), Gaps = 38/395 (9%)

Query: 1   MYYVVLEAETVHGEEKPKDHTRVSRICYQFIHSDTLQSVF-----EQPIIVEVGPGQLRE 55
           MYY+ +E ET+H  E PKDHT++  + YQ I+ +  + +         +I+ +G      
Sbjct: 1   MYYIFVETETLHKIETPKDHTQIVSLSYQLINVEYKEDLSYDVKKNDVVILSLGDSMANG 60

Query: 56  QVAQLDQLV-----TSKITSDNHEFALVSLSSTWHIRVTIPRQARDEGFILPPYLQHPKV 110
            +     ++       + T  N E  L SL+STW +RVTIPRQ+ DEG ILP +L+ P +
Sbjct: 61  DIMTFKDIIEQFSRNVEKTIGNEEKVLCSLNSTWDLRVTIPRQSNDEGIILPSFLKLPII 120

Query: 111 FDLWKEYDRWCVNHPETLPLRKNSNLGKKSRDLPELSRVLEAPLQT-------------- 156
           FDLWKEY RWC  H   +   K     KK +D  EL ++LE    +              
Sbjct: 121 FDLWKEYQRWCNLHFSEINTMK----TKKYKDSSELYKILEINQNSDAKTNNEKLNDRSG 176

Query: 157 -FPLDQ---------TIGILSQLHKKCLLPEDQSMVLTHPYDSYLDVRTFLQERSKVLYM 206
              +D+         T+ +   +  KC  PED   VLTHPY+S +D +TF+QE SK++YM
Sbjct: 177 NINMDRGYKKNDVRSTVDVFMAIVDKCSTPEDHESVLTHPYNSNVDFQTFIQETSKIIYM 236

Query: 207 NNLPPDTTQSELESWFTQFGARPVGFWXXXXXXXXXXXXXXXXXXXXXXYVEEQDSISGF 266
           NNLPPDTTQSELESWF QFG +P   W                      YVEE DSISGF
Sbjct: 237 NNLPPDTTQSELESWFAQFGIKPARLWTVRNILESTSYTNSNGNSNNSPYVEEHDSISGF 296

Query: 267 VVFQTHEEATEALSLNGRSILSNMANTKQPRVVEHVVELQPSSTRVLDRAHELLSPFPQS 326
            VFQTH+EAT+AL LNGRSILSNMANTKQPRVVEH+VELQPSS  +L+R  E+ S FPQS
Sbjct: 297 AVFQTHKEATDALLLNGRSILSNMANTKQPRVVEHIVELQPSSMVILERIQEISSQFPQS 356

Query: 327 KNKPRPGDWNCPSCGFSNFQRRTACFRCSFPATSA 361
           KNKPRPGDWNC SCGFSNFQRRT+CFRCSFPA ++
Sbjct: 357 KNKPRPGDWNCMSCGFSNFQRRTSCFRCSFPAATS 391

 Score = 76.6 bits (187), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 33/59 (55%), Positives = 40/59 (67%), Gaps = 3/59 (5%)

Query: 497 VPFRAGDWKCVSCTYHNFAKNVVCLRCGGPKTVGGAGVANQANLDVLLLDGSCQNGSAS 555
           VPFRAGDWKC +C+YHNFAKN+VCLRCGGPKT     + N  N  +    G   NG ++
Sbjct: 547 VPFRAGDWKCSACSYHNFAKNIVCLRCGGPKT---QAILNDMNKSMSHNSGQKYNGHSN 602

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 23/39 (58%), Gaps = 2/39 (5%)

Query: 331 RPGDWNCPSCGFSNFQRRTACFRCSFPATSAV--NVNKS 367
           R GDW C +C + NF +   C RC  P T A+  ++NKS
Sbjct: 550 RAGDWKCSACSYHNFAKNIVCLRCGGPKTQAILNDMNKS 588

 Score = 39.7 bits (91), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 16/27 (59%)

Query: 500 RAGDWKCVSCTYHNFAKNVVCLRCGGP 526
           R GDW C+SC + NF +   C RC  P
Sbjct: 361 RPGDWNCMSCGFSNFQRRTSCFRCSFP 387

>KNAG0C03780 Chr3 (743477..745093) [1617 bp, 538 aa] {ON} Anc_7.349
           YDL167C
          Length = 538

 Score =  369 bits (946), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 191/376 (50%), Positives = 243/376 (64%), Gaps = 18/376 (4%)

Query: 1   MYYVVLEAETVHGEEKPKDHTRVSRICYQFIHSDTLQS--VFEQPII-VEVGPGQLREQV 57
           M+YV++E ++    +  KD T++ R+ YQ I +D+L+   +    I  + V    L++ V
Sbjct: 1   MFYVLIELQSEQPRDSLKDQTKLKRLDYQIIDADSLEKRKINGNEIRQLAVEGSNLQDTV 60

Query: 58  AQLDQLVTSKITSDNHEFALVSLSSTWHIRVTIPRQARDEGFILPPYLQHPKVFDLWKEY 117
              ++ + S I  +  EF L S+ STW +RV +PR+A DE   LP  L++P V DLWKE+
Sbjct: 61  LLFEKEINSVINGE--EFVLCSMFSTWELRVVLPREANDEQVELPTILKYPIVLDLWKEF 118

Query: 118 DRWCVNHPETLPLRKNSNLGKKSRDLPELSRVL-------EAPLQTFPLDQTIGILS--- 167
           DRWC NHP+ L   K  N  +K ++LP + +VL       E+        + +GI S   
Sbjct: 119 DRWCTNHPDALQSVKGYN--RKCKNLPMVHQVLGVEQRLNESVNANGYTRKEVGITSDIL 176

Query: 168 -QLHKKCLLPEDQSMVLTHPYDSYLDVRTFLQERSKVLYMNNLPPDTTQSELESWFTQFG 226
            QLHKKC   +D + VLT PY+S LD  TF +E+S VLY+NNLPPDTTQ ELE+WF QFG
Sbjct: 177 LQLHKKCSSDDDTNTVLTQPYNSKLDYETFTEEQSTVLYLNNLPPDTTQGELETWFGQFG 236

Query: 227 ARPVGFWXXXXXXXXXXXXXXXXXXXXXXYVEEQDSISGFVVFQTHEEATEALSLNGRSI 286
           +RPV FW                      YVEEQDS+SGF  FQT EEA  AL L+GRSI
Sbjct: 237 SRPVSFWTFKNIVEDTSNINNNWNLNNSYYVEEQDSVSGFATFQTFEEAFNALKLSGRSI 296

Query: 287 LSNMANTKQPRVVEHVVELQPSSTRVLDRAHELLSPFPQSKNKPRPGDWNCPSCGFSNFQ 346
           LSN+ANTKQPR+VEHVVE+ PSS R+L  + E+LS FPQSKNKPRPGDWNCPSCGFSNFQ
Sbjct: 297 LSNVANTKQPRIVEHVVEIHPSSARILHSSEEILSAFPQSKNKPRPGDWNCPSCGFSNFQ 356

Query: 347 RRTACFRCSFPATSAV 362
           RRTACFRCSFP  SAV
Sbjct: 357 RRTACFRCSFPVPSAV 372

 Score = 72.0 bits (175), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 29/32 (90%)

Query: 497 VPFRAGDWKCVSCTYHNFAKNVVCLRCGGPKT 528
           +PFRAGDWKC +C YHNFAKN++CLRC GPKT
Sbjct: 442 IPFRAGDWKCAACAYHNFAKNIICLRCSGPKT 473

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 18/30 (60%)

Query: 331 RPGDWNCPSCGFSNFQRRTACFRCSFPATS 360
           R GDW C +C + NF +   C RCS P TS
Sbjct: 445 RAGDWKCAACAYHNFAKNIICLRCSGPKTS 474

 Score = 38.9 bits (89), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 15/27 (55%)

Query: 500 RAGDWKCVSCTYHNFAKNVVCLRCGGP 526
           R GDW C SC + NF +   C RC  P
Sbjct: 341 RPGDWNCPSCGFSNFQRRTACFRCSFP 367

>NDAI0A01900 Chr1 complement(426743..428440) [1698 bp, 565 aa] {ON}
           Anc_7.349 YDL167C
          Length = 565

 Score =  314 bits (805), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 161/362 (44%), Positives = 225/362 (62%), Gaps = 13/362 (3%)

Query: 1   MYYVVLEAETVHGEEKPKDHTRVSRICYQFIHSD--TL--QSVFEQPIIVEVGPGQLREQ 56
           M+YVVLE E+ H E   KD TR+  + YQ ++ D  TL  Q+     I +       ++ 
Sbjct: 1   MHYVVLEVESFHEEGTLKDQTRIINLSYQIVNIDDSTLLAQTNPVASIAISNDSENFQDA 60

Query: 57  VAQLDQLVTSKITSDNHEFALVSLSSTWHIRVTIPRQARDEGFILPPYLQHPKVFDLWKE 116
           + QLD  +  K T   +EF + +L+S  ++RVT+ RQA D G  LP YL++PK+FDLW E
Sbjct: 61  LVQLDSDI--KTTIGQNEFVICTLNSLTNLRVTLRRQALDIGVNLPQYLRYPKLFDLWVE 118

Query: 117 YDRWCVNHPETLPLRKNSNLGKKSRDLPELSRVLEAPLQTFPLDQTIGILSQLHKKCLLP 176
           + ++C NHPE L L +     K    L ++  +     + + +D +  +L  L+KKC   
Sbjct: 119 FKKFCANHPE-LDLNEEMVTSKDVAILTDILGLQSNNTENYTIDISTDVLLSLYKKCSSS 177

Query: 177 EDQSMVLTHPYDSYLDVRTFLQERSKVLYMNNLPPDTTQSELESWFTQFGARPVGFWXXX 236
           ED   VLT PYD  +D++TF +E ++V++++NLPPD TQ+ELE+WF    ++P+ +W   
Sbjct: 178 EDIKFVLTQPYDLQMDIKTFYEEEARVIFISNLPPDITQNELETWFANHNSKPICYWTSK 237

Query: 237 XXXXXXXXXXXXXXXXXXXYVEEQDSISGFVVFQTHEEATEALSLNGRSILSNMANTKQP 296
                              YV  Q SI GF++FQTHEEA ++L LNG+SI S+  + KQ 
Sbjct: 238 TPDEYSRNFHNNT------YVMNQHSIIGFIIFQTHEEAKQSLLLNGKSISSSTLHMKQL 291

Query: 297 RVVEHVVELQPSSTRVLDRAHELLSPFPQSKNKPRPGDWNCPSCGFSNFQRRTACFRCSF 356
             VEH++E+ PSST+VLD   ++L PFPQSKNKPR GDWNCPSCGFSNFQRRTACFRCSF
Sbjct: 292 YPVEHIIEVAPSSTKVLDHTQDILIPFPQSKNKPRLGDWNCPSCGFSNFQRRTACFRCSF 351

Query: 357 PA 358
           PA
Sbjct: 352 PA 353

 Score = 72.8 bits (177), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 29/34 (85%)

Query: 497 VPFRAGDWKCVSCTYHNFAKNVVCLRCGGPKTVG 530
           VPFRAGDWKC SCTYHNFAKN+ CLRCG PK  G
Sbjct: 446 VPFRAGDWKCPSCTYHNFAKNIACLRCGDPKLSG 479

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 16/32 (50%), Positives = 19/32 (59%)

Query: 331 RPGDWNCPSCGFSNFQRRTACFRCSFPATSAV 362
           R GDW CPSC + NF +  AC RC  P  S +
Sbjct: 449 RAGDWKCPSCTYHNFAKNIACLRCGDPKLSGI 480

 Score = 39.3 bits (90), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 15/27 (55%)

Query: 500 RAGDWKCVSCTYHNFAKNVVCLRCGGP 526
           R GDW C SC + NF +   C RC  P
Sbjct: 326 RLGDWNCPSCGFSNFQRRTACFRCSFP 352

>CAGL0I03344g Chr9 complement(285637..287448) [1812 bp, 603 aa] {ON}
           similar to uniprot|P32770 Saccharomyces cerevisiae
           YDL167c ARP1
          Length = 603

 Score =  255 bits (651), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 142/395 (35%), Positives = 215/395 (54%), Gaps = 40/395 (10%)

Query: 1   MYYVVLEAETVHGEEKPKDHTRVSRICYQFIHSDTLQSVFEQPIIVEVGPGQLREQVAQL 60
           M+YVVL+ +      KP     + R+ YQ I   +L++  E P +V+V    ++E +A+L
Sbjct: 1   MHYVVLDVQIDSSAVKP----VLLRLGYQVIDPVSLEARNE-PYVVDVDGESIKEFIAKL 55

Query: 61  DQLVTSKITSDNH---------------EFALVSLSSTWHIRVTIPRQARDEGFILPPYL 105
           D+ + S  T  NH               EF   +L+ +W ++V +   A D G  LP YL
Sbjct: 56  DEDLKSHATVANHQESQDGSQSGSDVEKEFVFCTLNPSWSVKVGLVSSANDLGVELPEYL 115

Query: 106 QHPKVFDLWKEYDRWCVNHPETLPLRKNSNLGKK----SRDLPELSRVLEAPLQ------ 155
           ++P  FD+WKEY  W  NH ++    +    G+     +  + EL R L+   +      
Sbjct: 116 RYPVFFDIWKEYSIWKKNHSDSSESPQTQANGESIDSFAGKIEELVRTLDVSTEYDELKQ 175

Query: 156 -----TFPLDQTIGILSQLHKKCLLPEDQSMVLTHPYDSYLDVRTFLQERSKVLYMNNLP 210
                TF +     +L+ LHKKC+ P D + VLT PYD  +D + F++E+SK+LY++N+P
Sbjct: 176 KNDDPTFDVRLATLVLTALHKKCVTPVDDTTVLTVPYDLGMDYKNFIEEQSKILYISNIP 235

Query: 211 PDTTQSELESWFTQFGARPVGFWXXXXXXXXXXXXXXXXXXXXXXYVEEQDSISGFVVFQ 270
            +  Q++LE WF Q G   VGFW                       +   DS+ GF +FQ
Sbjct: 236 SELNQTDLEGWFQQKGVASVGFWTLKNISDDATLASQRNHGKM---LSIPDSMFGFAIFQ 292

Query: 271 THEEATEALSLNGRSILSNMANTKQPRVVEHVVELQPSSTRVLDRAHELLSPFPQSKNKP 330
           +H +A  AL+L+G   +  +   K  + +E ++++QPSS R+L++  + L   PQ+KNKP
Sbjct: 293 SHNDAEYALNLHG--TVMKIVAPKGNKHIEQLLDIQPSSMRLLEKVQDNLILLPQNKNKP 350

Query: 331 RPGDWNCPSCGFSNFQRRTACFRCSFPATSAVNVN 365
           RPGDWNCPSCGFSNFQRRTACFRC+FP  + V+ N
Sbjct: 351 RPGDWNCPSCGFSNFQRRTACFRCAFPVPNGVSGN 385

 Score = 73.2 bits (178), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 31/47 (65%), Positives = 33/47 (70%)

Query: 497 VPFRAGDWKCVSCTYHNFAKNVVCLRCGGPKTVGGAGVANQANLDVL 543
           VPFRAGDWKC  C YHNFAKN+VCLRCGGPKT       N  + D L
Sbjct: 532 VPFRAGDWKCPGCFYHNFAKNIVCLRCGGPKTKTTTRDKNNQDGDTL 578

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 19/38 (50%)

Query: 331 RPGDWNCPSCGFSNFQRRTACFRCSFPATSAVNVNKST 368
           R GDW CP C + NF +   C RC  P T     +K+ 
Sbjct: 535 RAGDWKCPGCFYHNFAKNIVCLRCGGPKTKTTTRDKNN 572

 Score = 40.8 bits (94), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 20/38 (52%)

Query: 500 RAGDWKCVSCTYHNFAKNVVCLRCGGPKTVGGAGVANQ 537
           R GDW C SC + NF +   C RC  P   G +G A +
Sbjct: 351 RPGDWNCPSCGFSNFQRRTACFRCAFPVPNGVSGNAGK 388

>KLLA0B08976g Chr2 complement(786122..787039) [918 bp, 305 aa] {ON}
           similar to uniprot|P32605 Saccharomyces cerevisiae
           YBR119W MUD1 U1 snRNP A protein homolog of human U1-A
           involved in nuclear mRNA splicing
          Length = 305

 Score = 32.3 bits (72), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 40/100 (40%), Gaps = 13/100 (13%)

Query: 131 RKNSNLGKKSRDLPELSRVLEAPLQTFPLDQTIGILSQLHKKCLLPEDQSMVLTHPYDSY 190
           R  S L KK  D   + ++L  P +T P       +SQ  +K    +    ++ +P    
Sbjct: 175 RARSKLRKKDLDEETIQKLLSKPRKTNPEGTNKTAMSQQSEKVSSTKKVFDIVGNPPHH- 233

Query: 191 LDVRTFLQERSKVLYMNNLPPDTTQSELESWFTQFGARPV 230
                       VL + NLP D TQ ELE  F   G + V
Sbjct: 234 ------------VLLVQNLPKDVTQQELEKLFVSDGFKEV 261

>Ecym_1302 Chr1 complement(613499..614365) [867 bp, 288 aa] {ON}
           similar to Ashbya gossypii AAL018W
          Length = 288

 Score = 32.0 bits (71), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 18/28 (64%)

Query: 199 ERSKVLYMNNLPPDTTQSELESWFTQFG 226
           ERS+++Y  N+PP T +S+L   F   G
Sbjct: 207 ERSRIIYCENMPPATVESDLYDLFETIG 234

>YHR015W Chr8 (134554..136533) [1980 bp, 659 aa] {ON}  MIP6Putative
           RNA-binding protein, interacts with Mex67p, which is a
           component of the nuclear pore involved in nuclear mRNA
           export
          Length = 659

 Score = 32.3 bits (72), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 18/27 (66%)

Query: 200 RSKVLYMNNLPPDTTQSELESWFTQFG 226
           RSK + + NLP DTTQ E+  +F+  G
Sbjct: 311 RSKTILVKNLPSDTTQEEVLDYFSTIG 337

>TDEL0A00940 Chr1 complement(156781..158829) [2049 bp, 682 aa] {ON}
           Anc_2.52 YNL197C
          Length = 682

 Score = 32.3 bits (72), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 16/32 (50%), Positives = 20/32 (62%), Gaps = 1/32 (3%)

Query: 202 KVLYMNNLPPDTTQSELESWFT-QFGARPVGF 232
             LY+ NLPPDTT+ EL   F+ Q G R + F
Sbjct: 553 NTLYVGNLPPDTTEQELRHLFSGQQGFRRLSF 584

>SAKL0H17952g Chr8 complement(1599134..1600903) [1770 bp, 589 aa]
           {ON} highly similar to uniprot|P04147 Saccharomyces
           cerevisiae YER165W PAB1 Poly(A) binding protein part of
           the 3'-end RNA-processing complex mediates interactions
           between the 5' cap structure and the 3' mRNA poly(A)
           tail involved in control of poly(A) tail length
           interacts with translation factor eIF-4G
          Length = 589

 Score = 32.0 bits (71), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 27/48 (56%), Gaps = 3/48 (6%)

Query: 182 VLTHPYDSYLDVRTFLQERSKV---LYMNNLPPDTTQSELESWFTQFG 226
           V   P+ S  D ++ L+E       +Y+ N+  +TTQ E E+ FTQFG
Sbjct: 198 VYVAPHVSKKDRQSKLEEAKSNFTNIYVKNIDLETTQEEFEALFTQFG 245

>TBLA0B00600 Chr2 complement(123569..125773) [2205 bp, 734 aa] {ON}
           Anc_2.52 YNL197C
          Length = 734

 Score = 32.0 bits (71), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 16/32 (50%), Positives = 19/32 (59%), Gaps = 1/32 (3%)

Query: 202 KVLYMNNLPPDTTQSELESWF-TQFGARPVGF 232
             LY+ NLPPD T+ EL   F TQ G R + F
Sbjct: 608 NTLYVGNLPPDATEQELRQLFSTQDGFRRLSF 639

>Kwal_23.4597 s23 complement(781763..783757) [1995 bp, 664 aa] {ON}
           YNL197C (WHI3) - Putative RNA binding protein [contig 5]
           FULL
          Length = 664

 Score = 32.0 bits (71), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 16/32 (50%), Positives = 19/32 (59%), Gaps = 1/32 (3%)

Query: 202 KVLYMNNLPPDTTQSELESWF-TQFGARPVGF 232
             LY+ NLPPD T+ EL   F TQ G R + F
Sbjct: 545 NTLYVGNLPPDATEHELRQLFSTQKGFRRLSF 576

>KLTH0D01826g Chr4 complement(175846..179820) [3975 bp, 1324 aa]
           {ON} similar to uniprot|P22023 Saccharomyces cerevisiae
           YOR336W KRE5 Protein required for beta-1 6 glucan
           biosynthesis mutations result in aberrant morphology and
           severe growth defects
          Length = 1324

 Score = 32.0 bits (71), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 29/55 (52%), Gaps = 2/55 (3%)

Query: 276 TEALSLNGRSILSNMANTKQPRVVEHVVELQPSSTRVLDRAHELLSPFPQSKNKP 330
           T  L++NGR I  +    + P + E+ + +Q  +TRVLD    L   FP S  +P
Sbjct: 742 TSYLAVNGRFI--HFEQGELPTIYEYEMIVQREATRVLDAVASLQEVFPDSLKEP 794

>KLTH0B07546g Chr2 (609954..611873) [1920 bp, 639 aa] {ON} some
           similarities with Saccharomyces cerevisiae YDL224C WHI4
           and to uniprot|P34761 Saccharomyces cerevisiae YNL197C
           WHI3
          Length = 639

 Score = 31.6 bits (70), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 16/32 (50%), Positives = 19/32 (59%), Gaps = 1/32 (3%)

Query: 202 KVLYMNNLPPDTTQSELESWF-TQFGARPVGF 232
             LY+ NLPPD T+ EL   F TQ G R + F
Sbjct: 521 NTLYVGNLPPDATEHELRQLFSTQKGFRRLSF 552

>KLTH0H03828g Chr8 complement(348388..352851) [4464 bp, 1487 aa]
           {ON} similar to uniprot|P53127 Saccharomyces cerevisiae
           YGL131C SNT2 22% sequence identity with S. pombe Snt2
          Length = 1487

 Score = 31.6 bits (70), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 37/83 (44%), Gaps = 8/83 (9%)

Query: 150 LEAPLQTFPLDQTIGILSQLHKKCLLPEDQSMVLTHPYDSYLDVRTFLQERSKVLYMNNL 209
           L+ PL+  P+   I I S    +CL  + +S  LT P+   L+ +T      K   + ++
Sbjct: 327 LDPPLERKPIKGVIWICS----RCLHHDKESESLTEPHCQTLEFQTLQSRSGKKCALQSI 382

Query: 210 PPDTTQSELESWFTQFGARPVGF 232
           P +        WF   G++ V F
Sbjct: 383 PSNPEN----LWFHYLGSKVVDF 401

>NCAS0G02580 Chr7 complement(461003..461677) [675 bp, 224 aa] {ON}
           Anc_2.167
          Length = 224

 Score = 30.8 bits (68), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 19/30 (63%)

Query: 197 LQERSKVLYMNNLPPDTTQSELESWFTQFG 226
           L E S +LY++ LP    + EL  +F+QFG
Sbjct: 89  LAEYSSILYVSRLPQGFHERELSKYFSQFG 118

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.133    0.407 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 47,499,694
Number of extensions: 1843886
Number of successful extensions: 5672
Number of sequences better than 10.0: 31
Number of HSP's gapped: 5724
Number of HSP's successfully gapped: 90
Length of query: 583
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 468
Effective length of database: 40,294,809
Effective search space: 18857970612
Effective search space used: 18857970612
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)