Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0F11330g7.348ON20820810261e-143
KAFR0B008607.348ON2281947721e-104
NCAS0A141407.348ON2241927641e-103
TPHA0F029507.348ON2161817591e-103
Kpol_530.337.348ON1951957571e-102
NDAI0A019107.348ON2141907471e-101
KLLA0D12386g7.348ON2111847381e-99
TDEL0C020007.348ON2131837232e-97
Ecym_47257.348ON2342107211e-96
Kwal_56.246357.348ON2261837104e-95
KLTH0H01298g7.348ON2142097086e-95
ACL150W7.348ON2191847052e-94
Smik_4.727.348ON1971846999e-94
YDL166C (FAP7)7.348ON1971846911e-92
KNAG0C037707.348ON2231826862e-91
ZYRO0F11660g7.348ON1981836815e-91
Suva_4.807.348ON2061846702e-89
CAGL0I03366g7.348ON2121846679e-89
Skud_4.917.348ON1941906632e-88
TBLA0E005207.348ON2091836618e-88
KAFR0C037902.667ON202140890.003
ACR170C2.667ON289181860.011
KLLA0E08053g2.667ON302140840.018
Smik_11.2292.667ON20453830.019
Skud_11.2042.667ON27955830.027
TPHA0N018902.667ON303138820.039
Kpol_1057.162.667ON293138810.047
YKL024C (URA6)2.667ON204145790.061
KLTH0C00528g2.667ON282140780.12
NDAI0C001402.667ON212143770.12
Suva_11.2022.667ON27655760.18
TDEL0B076202.667ON303143760.19
CAGL0L09867g2.667ON260140760.23
Kpol_1033.248.295ON491527750.36
Ecym_56382.667ON301141740.42
Skud_12.1748.295ON490728750.46
KLTH0G12892g8.295ON492823740.53
Kwal_14.8682.667ON28255720.58
NDAI0A021007.320ON36645730.60
Kwal_56.236388.295ON492220730.70
KNAG0D010106.234ON115931720.87
KNAG0H001402.667ON29731711.0
ZYRO0A13310gsingletonOFF51523711.1
Zrou_YGOB_A13310g8.558ON55823711.1
Suva_10.1918.295ON490728711.3
YLR106C (MDN1)8.295ON491027711.3
Kpol_1048.538.558ON55223691.9
AGR074C8.295ON489920701.9
Smik_15.623.103ON32351682.0
Skud_2.3128.558ON53423692.2
YBR186W (PCH2)8.558ON56423692.2
YOR342C7.48ON319111682.2
NCAS0C020208.558ON56241682.2
Smik_2.3268.558ON56423682.3
Suva_4.4378.558ON55223682.6
TPHA0H006208.101ON35245672.8
NCAS0B025208.478ON18428663.1
KAFR0B055408.262ON51971664.3
Ecym_62781.308ON30143646.6
NDAI0I022306.68ON119561649.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0F11330g
         (208 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0F11330g Chr6 (882784..883410) [627 bp, 208 aa] {ON} similar...   399   e-143
KAFR0B00860 Chr2 (161692..162378) [687 bp, 228 aa] {ON} Anc_7.34...   301   e-104
NCAS0A14140 Chr1 (2779202..2779876) [675 bp, 224 aa] {ON} Anc_7....   298   e-103
TPHA0F02950 Chr6 (649875..650525) [651 bp, 216 aa] {ON} Anc_7.34...   296   e-103
Kpol_530.33 s530 complement(81184..81771) [588 bp, 195 aa] {ON} ...   296   e-102
NDAI0A01910 Chr1 complement(428746..429390) [645 bp, 214 aa] {ON...   292   e-101
KLLA0D12386g Chr4 complement(1054141..1054776) [636 bp, 211 aa] ...   288   1e-99
TDEL0C02000 Chr3 complement(347930..348571) [642 bp, 213 aa] {ON...   283   2e-97
Ecym_4725 Chr4 complement(1419236..1419940) [705 bp, 234 aa] {ON...   282   1e-96
Kwal_56.24635 s56 (1083026..1083706) [681 bp, 226 aa] {ON} YDL16...   278   4e-95
KLTH0H01298g Chr8 complement(124206..124850) [645 bp, 214 aa] {O...   277   6e-95
ACL150W Chr3 (87745..88404) [660 bp, 219 aa] {ON} Syntenic homol...   276   2e-94
Smik_4.72 Chr4 complement(140216..140809) [594 bp, 197 aa] {ON} ...   273   9e-94
YDL166C Chr4 complement(163449..164042) [594 bp, 197 aa] {ON}  F...   270   1e-92
KNAG0C03770 Chr3 (742558..743229) [672 bp, 223 aa] {ON} Anc_7.34...   268   2e-91
ZYRO0F11660g Chr6 (955635..956231) [597 bp, 198 aa] {ON} similar...   266   5e-91
Suva_4.80 Chr4 complement(150992..151612) [621 bp, 206 aa] {ON} ...   262   2e-89
CAGL0I03366g Chr9 complement(287811..288449) [639 bp, 212 aa] {O...   261   9e-89
Skud_4.91 Chr4 complement(159116..159700) [585 bp, 194 aa] {ON} ...   259   2e-88
TBLA0E00520 Chr5 (95049..95678) [630 bp, 209 aa] {ON} Anc_7.348 ...   259   8e-88
KAFR0C03790 Chr3 complement(771996..772604) [609 bp, 202 aa] {ON...    39   0.003
ACR170C Chr3 complement(653511..654380) [870 bp, 289 aa] {ON} Sy...    38   0.011
KLLA0E08053g Chr5 complement(724562..725470) [909 bp, 302 aa] {O...    37   0.018
Smik_11.229 Chr11 complement(379526..380140) [615 bp, 204 aa] {O...    37   0.019
Skud_11.204 Chr11 complement(373437..374051,374060..374284) [840...    37   0.027
TPHA0N01890 Chr14 (401294..401591,401593..402206) [912 bp, 303 a...    36   0.039
Kpol_1057.16 s1057 (29809..30690) [882 bp, 293 aa] {ON} (29809.....    36   0.047
YKL024C Chr11 complement(392526..393140) [615 bp, 204 aa] {ON}  ...    35   0.061
KLTH0C00528g Chr3 (55308..56156) [849 bp, 282 aa] {ON} highly si...    35   0.12 
NDAI0C00140 Chr3 complement(19018..19656) [639 bp, 212 aa] {ON} ...    34   0.12 
Suva_11.202 Chr11 complement(376372..376986,376995..377210) [831...    34   0.18 
TDEL0B07620 Chr2 (1335458..1336369) [912 bp, 303 aa] {ON} Anc_2....    34   0.19 
CAGL0L09867g Chr12 (1056341..1057123) [783 bp, 260 aa] {ON} some...    34   0.23 
Kpol_1033.24 s1033 complement(49973..58081,58083..64721) [14748 ...    33   0.36 
Ecym_5638 Chr5 complement(1291799..1292704) [906 bp, 301 aa] {ON...    33   0.42 
Skud_12.174 Chr12 complement(332096..346819) [14724 bp, 4907 aa]...    33   0.46 
KLTH0G12892g Chr7 (1095023..1109809) [14787 bp, 4928 aa] {ON} si...    33   0.53 
Kwal_14.868 s14 (88176..89024) [849 bp, 282 aa] {ON} YKL024C (UR...    32   0.58 
NDAI0A02100 Chr1 complement(470992..472092) [1101 bp, 366 aa] {O...    33   0.60 
Kwal_56.23638 s56 (632586..647354) [14769 bp, 4922 aa] {ON} YLR1...    33   0.70 
KNAG0D01010 Chr4 complement(166954..170433) [3480 bp, 1159 aa] {...    32   0.87 
KNAG0H00140 Chr8 complement(19224..20117) [894 bp, 297 aa] {ON}        32   1.0  
ZYRO0A13310g Chr1 complement(1050131..1051678) [1548 bp, 515 aa]...    32   1.1  
Zrou_YGOB_A13310g Chr1 complement(1049931..1050068,1050140..1051...    32   1.1  
Suva_10.191 Chr10 complement(353936..368659) [14724 bp, 4907 aa]...    32   1.3  
YLR106C Chr12 complement(349006..363738) [14733 bp, 4910 aa] {ON...    32   1.3  
Kpol_1048.53 s1048 (151366..153024) [1659 bp, 552 aa] {ON} (1513...    31   1.9  
AGR074C Chr7 complement(854312..869011) [14700 bp, 4899 aa] {ON}...    32   1.9  
Smik_15.62 Chr15 complement(104681..105652) [972 bp, 323 aa] {ON...    31   2.0  
Skud_2.312 Chr2 (567925..569382,569566..569712) [1605 bp, 534 aa...    31   2.2  
YBR186W Chr2 (600553..602103,602217..602360) [1695 bp, 564 aa] {...    31   2.2  
YOR342C Chr15 complement(966666..967625) [960 bp, 319 aa] {ON} P...    31   2.2  
NCAS0C02020 Chr3 (375594..377126,377196..377351) [1689 bp, 562 a...    31   2.2  
Smik_2.326 Chr2 (586919..588469,588545..588688) [1695 bp, 564 aa...    31   2.3  
Suva_4.437 Chr4 (770299..771957) [1659 bp, 552 aa] {ON} YBR186W ...    31   2.6  
TPHA0H00620 Chr8 complement(124152..125210) [1059 bp, 352 aa] {O...    30   2.8  
NCAS0B02520 Chr2 (422176..422730) [555 bp, 184 aa] {ON} Anc_8.47...    30   3.1  
KAFR0B05540 Chr2 complement(1134547..1136106) [1560 bp, 519 aa] ...    30   4.3  
Ecym_6278 Chr6 complement(526852..527757) [906 bp, 301 aa] {ON} ...    29   6.6  
NDAI0I02230 Chr9 complement(508175..511762) [3588 bp, 1195 aa] {...    29   9.7  

>SAKL0F11330g Chr6 (882784..883410) [627 bp, 208 aa] {ON} similar to
           uniprot|Q12055 Saccharomyces cerevisiae YDL166C FAP7
           Essential nuclear protein involved in the oxidative
           stress response
          Length = 208

 Score =  399 bits (1026), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 195/208 (93%), Positives = 195/208 (93%)

Query: 1   METKRSRPNILVTGTPGCGKSTTCELLVRRLSDYTYYNISDFAREHKCYDGYDEVRKSHI 60
           METKRSRPNILVTGTPGCGKSTTCELLVRRLSDYTYYNISDFAREHKCYDGYDEVRKSHI
Sbjct: 1   METKRSRPNILVTGTPGCGKSTTCELLVRRLSDYTYYNISDFAREHKCYDGYDEVRKSHI 60

Query: 61  VXXXXXXXXXXXXXRKGKSIVDWHVNDVFPERLIDLVVVLRCDNSILYDRLHKRGYHDSK 120
           V             RKGKSIVDWHVNDVFPERLIDLVVVLRCDNSILYDRLHKRGYHDSK
Sbjct: 61  VDEDKLLDELEPLLRKGKSIVDWHVNDVFPERLIDLVVVLRCDNSILYDRLHKRGYHDSK 120

Query: 121 IEENLDAEIMGVVMQDAAESYAQEIVVELQSDTVEHMDANVDRIVEWQEMWLNQHPNGVT 180
           IEENLDAEIMGVVMQDAAESYAQEIVVELQSDTVEHMDANVDRIVEWQEMWLNQHPNGVT
Sbjct: 121 IEENLDAEIMGVVMQDAAESYAQEIVVELQSDTVEHMDANVDRIVEWQEMWLNQHPNGVT 180

Query: 181 NELEPESDNASDSDDTHGSADTSDSEQE 208
           NELEPESDNASDSDDTHGSADTSDSEQE
Sbjct: 181 NELEPESDNASDSDDTHGSADTSDSEQE 208

>KAFR0B00860 Chr2 (161692..162378) [687 bp, 228 aa] {ON} Anc_7.348
           YDL166C
          Length = 228

 Score =  301 bits (772), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 142/194 (73%), Positives = 162/194 (83%)

Query: 2   ETKRSRPNILVTGTPGCGKSTTCELLVRRLSDYTYYNISDFAREHKCYDGYDEVRKSHIV 61
           E++R  PN+LVTGTPGCGKSTTCELL+RRL DYTY+NIS+FA +HKCYDGYDE RKSHIV
Sbjct: 7   ESRRYSPNLLVTGTPGCGKSTTCELLMRRLPDYTYFNISEFAEKHKCYDGYDESRKSHIV 66

Query: 62  XXXXXXXXXXXXXRKGKSIVDWHVNDVFPERLIDLVVVLRCDNSILYDRLHKRGYHDSKI 121
                        R+GKSI+DWHVNDVFPERLIDLVVVLRCDNSIL+DRLH RGYH+SKI
Sbjct: 67  DDDKLLDELEPLLRRGKSIIDWHVNDVFPERLIDLVVVLRCDNSILFDRLHGRGYHESKI 126

Query: 122 EENLDAEIMGVVMQDAAESYAQEIVVELQSDTVEHMDANVDRIVEWQEMWLNQHPNGVTN 181
           +ENLDAEIMGVV+QDA +SY QEIVVELQS++ E MDANV+RIV WQEMWL QH NGVTN
Sbjct: 127 QENLDAEIMGVVLQDALDSYEQEIVVELQSNSTEEMDANVERIVAWQEMWLTQHKNGVTN 186

Query: 182 ELEPESDNASDSDD 195
           E + E    S+SD+
Sbjct: 187 EYQGELPKDSNSDE 200

>NCAS0A14140 Chr1 (2779202..2779876) [675 bp, 224 aa] {ON} Anc_7.348
           YDL166C
          Length = 224

 Score =  298 bits (764), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 139/192 (72%), Positives = 161/192 (83%)

Query: 2   ETKRSRPNILVTGTPGCGKSTTCELLVRRLSDYTYYNISDFAREHKCYDGYDEVRKSHIV 61
           +++R +PN+L+TGTPGCGKSTTCELL RRL +Y YYNISDFA+EH CYDGYD+ RKSHIV
Sbjct: 3   KSRRYQPNLLITGTPGCGKSTTCELLQRRLPEYKYYNISDFAKEHDCYDGYDKGRKSHIV 62

Query: 62  XXXXXXXXXXXXXRKGKSIVDWHVNDVFPERLIDLVVVLRCDNSILYDRLHKRGYHDSKI 121
                        R+GKSI+DWHVNDVFPERLIDLV VLRCDNS+LYDRLH R YHD+KI
Sbjct: 63  DEDKLLDELEPLLRQGKSIIDWHVNDVFPERLIDLVAVLRCDNSVLYDRLHGRKYHDTKI 122

Query: 122 EENLDAEIMGVVMQDAAESYAQEIVVELQSDTVEHMDANVDRIVEWQEMWLNQHPNGVTN 181
           EEN+DAEIMGVV+QDA ESYA+EIVVELQSDT E MDANVDRIV+WQ+MWL QH +GVTN
Sbjct: 123 EENMDAEIMGVVLQDALESYAKEIVVELQSDTTEQMDANVDRIVDWQKMWLEQHEDGVTN 182

Query: 182 ELEPESDNASDS 193
           ELE +  N+ +S
Sbjct: 183 ELEDKQRNSDES 194

>TPHA0F02950 Chr6 (649875..650525) [651 bp, 216 aa] {ON} Anc_7.348
           YDL166C
          Length = 216

 Score =  296 bits (759), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 139/181 (76%), Positives = 154/181 (85%)

Query: 3   TKRSRPNILVTGTPGCGKSTTCELLVRRLSDYTYYNISDFAREHKCYDGYDEVRKSHIVX 62
           ++R +PN+L+TGTPGCGKSTTCELL RRLSDYTYYNISDFA+EH CYDG+DE RKSHIV 
Sbjct: 2   SRRYQPNLLITGTPGCGKSTTCELLQRRLSDYTYYNISDFAKEHNCYDGFDEGRKSHIVD 61

Query: 63  XXXXXXXXXXXXRKGKSIVDWHVNDVFPERLIDLVVVLRCDNSILYDRLHKRGYHDSKIE 122
                       RKGK IVDWHVNDVFPERLIDLVVVLRCDNS+LYDRL  RGYHDSKI+
Sbjct: 62  EDKLLDELEPLLRKGKCIVDWHVNDVFPERLIDLVVVLRCDNSVLYDRLKSRGYHDSKID 121

Query: 123 ENLDAEIMGVVMQDAAESYAQEIVVELQSDTVEHMDANVDRIVEWQEMWLNQHPNGVTNE 182
           EN+DAEIMGVV+QDA ESYAQEIVVELQSDT E MD NVD+IV+W E+W+ QH NGVTNE
Sbjct: 122 ENMDAEIMGVVLQDAQESYAQEIVVELQSDTTEQMDENVDKIVDWVELWIKQHKNGVTNE 181

Query: 183 L 183
           L
Sbjct: 182 L 182

>Kpol_530.33 s530 complement(81184..81771) [588 bp, 195 aa] {ON}
           complement(81184..81771) [588 nt, 196 aa]
          Length = 195

 Score =  296 bits (757), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 144/195 (73%), Positives = 159/195 (81%), Gaps = 3/195 (1%)

Query: 1   METKRSRPNILVTGTPGCGKSTTCELLVRRLSDYTYYNISDFAREHKCYDGYDEVRKSHI 60
           M ++R +PN+L+TGTPGCGKST+CELL RRLSDY YYNISDFA+EH CY+GYDE RKSHI
Sbjct: 1   MLSRRLKPNLLITGTPGCGKSTSCELLQRRLSDYKYYNISDFAKEHDCYEGYDEDRKSHI 60

Query: 61  VXXXXXXXXXXXXXRKGKSIVDWHVNDVFPERLIDLVVVLRCDNSILYDRLHKRGYHDSK 120
           V             R+G SIVDWHVNDVFPERLIDLVVVLRCDNSILYDRLH R YHDSK
Sbjct: 61  VDEDKLLDELEPLLREGGSIVDWHVNDVFPERLIDLVVVLRCDNSILYDRLHARKYHDSK 120

Query: 121 IEENLDAEIMGVVMQDAAESYAQEIVVELQSDTVEHMDANVDRIVEWQEMWLNQHPNGVT 180
           I+ENLDAEIMGVV+QDA ESYA+EIVVELQSDT E M+ANVDRIV+W E+WL QH  GVT
Sbjct: 121 IQENLDAEIMGVVLQDAQESYAEEIVVELQSDTTEQMEANVDRIVDWVELWLKQHKKGVT 180

Query: 181 NELE---PESDNASD 192
           NELE      DN SD
Sbjct: 181 NELEEGVSSDDNESD 195

>NDAI0A01910 Chr1 complement(428746..429390) [645 bp, 214 aa] {ON}
           Anc_7.348 YDL166C
          Length = 214

 Score =  292 bits (747), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 137/190 (72%), Positives = 159/190 (83%)

Query: 3   TKRSRPNILVTGTPGCGKSTTCELLVRRLSDYTYYNISDFAREHKCYDGYDEVRKSHIVX 62
           ++R  PN+L+TGTPG GKSTTCELL RRL +Y YYNISDFA+E+ CY+GYD+ RKSHIV 
Sbjct: 6   SRRYEPNLLITGTPGSGKSTTCELLQRRLPEYAYYNISDFAKENDCYEGYDKGRKSHIVD 65

Query: 63  XXXXXXXXXXXXRKGKSIVDWHVNDVFPERLIDLVVVLRCDNSILYDRLHKRGYHDSKIE 122
                       RKGKSIVDWHVND+FPERLIDLVVVLRCDNSILYDRL+KRGYHDSKI+
Sbjct: 66  EDKLLDELEPLLRKGKSIVDWHVNDIFPERLIDLVVVLRCDNSILYDRLNKRGYHDSKIQ 125

Query: 123 ENLDAEIMGVVMQDAAESYAQEIVVELQSDTVEHMDANVDRIVEWQEMWLNQHPNGVTNE 182
           ENLDAEIMGVV+QDA ESY QEIVVELQSD  E M+ANV+RIVEW +MW++QH NGVTNE
Sbjct: 126 ENLDAEIMGVVLQDAVESYQQEIVVELQSDDTEQMEANVERIVEWHKMWMDQHKNGVTNE 185

Query: 183 LEPESDNASD 192
           L+ ++ NA +
Sbjct: 186 LQGKNKNAQN 195

>KLLA0D12386g Chr4 complement(1054141..1054776) [636 bp, 211 aa]
           {ON} similar to uniprot|Q12055 Saccharomyces cerevisiae
           YDL166C FAP7 Essential nuclear protein involved in the
           oxidative stress response
          Length = 211

 Score =  288 bits (738), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 135/184 (73%), Positives = 153/184 (83%)

Query: 1   METKRSRPNILVTGTPGCGKSTTCELLVRRLSDYTYYNISDFAREHKCYDGYDEVRKSHI 60
           ME  R +PNI+V+GTPGCGKSTTCELL RRL +YTYYNISDFA+EH CYDGYD+ RKS+I
Sbjct: 1   MEPVRFKPNIIVSGTPGCGKSTTCELLSRRLPEYTYYNISDFAKEHDCYDGYDDARKSNI 60

Query: 61  VXXXXXXXXXXXXXRKGKSIVDWHVNDVFPERLIDLVVVLRCDNSILYDRLHKRGYHDSK 120
           V             RKG  I+DWHVNDVFPERL+DLVVVLRCDN ILYDRL+KRGYH++K
Sbjct: 61  VDDDKLLDELEPLLRKGGCIIDWHVNDVFPERLVDLVVVLRCDNGILYDRLNKRGYHNAK 120

Query: 121 IEENLDAEIMGVVMQDAAESYAQEIVVELQSDTVEHMDANVDRIVEWQEMWLNQHPNGVT 180
           IEEN+DAEIMGVV+QDA +SYAQEIVVELQSDT E MD NVDRI+ WQE+WL QH  GVT
Sbjct: 121 IEENMDAEIMGVVLQDAHDSYAQEIVVELQSDTTEEMDKNVDRIIAWQEIWLKQHKKGVT 180

Query: 181 NELE 184
           NEL+
Sbjct: 181 NELD 184

>TDEL0C02000 Chr3 complement(347930..348571) [642 bp, 213 aa] {ON}
           Anc_7.348 YDL166C
          Length = 213

 Score =  283 bits (723), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 131/183 (71%), Positives = 151/183 (82%)

Query: 1   METKRSRPNILVTGTPGCGKSTTCELLVRRLSDYTYYNISDFAREHKCYDGYDEVRKSHI 60
           ME +R +PN+L+TGTPGCGKSTTCELL RRL DY YYNISDFA+EH C+DGYDE RKS+I
Sbjct: 1   MEPRRFKPNLLITGTPGCGKSTTCELLQRRLPDYKYYNISDFAKEHDCHDGYDEARKSYI 60

Query: 61  VXXXXXXXXXXXXXRKGKSIVDWHVNDVFPERLIDLVVVLRCDNSILYDRLHKRGYHDSK 120
           V             R+G +IVDWHVNDVFPERLIDLVVVLRCDN+ILYDRL  R YHD+K
Sbjct: 61  VDEDKLLDELEPLLREGAAIVDWHVNDVFPERLIDLVVVLRCDNTILYDRLKSRDYHDAK 120

Query: 121 IEENLDAEIMGVVMQDAAESYAQEIVVELQSDTVEHMDANVDRIVEWQEMWLNQHPNGVT 180
           I+ENLDAEIMGVV+QDA +SY QEIVVELQSD+ E M+ANVDRIV W+++WL QH +G T
Sbjct: 121 IQENLDAEIMGVVLQDATDSYEQEIVVELQSDSTEQMEANVDRIVSWEKLWLKQHKDGQT 180

Query: 181 NEL 183
           NEL
Sbjct: 181 NEL 183

>Ecym_4725 Chr4 complement(1419236..1419940) [705 bp, 234 aa] {ON}
           similar to Ashbya gossypii ACL150W
          Length = 234

 Score =  282 bits (721), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 136/210 (64%), Positives = 161/210 (76%), Gaps = 2/210 (0%)

Query: 1   METKRSRPNILVTGTPGCGKSTTCELLVRRLSDYTYYNISDFAREHKCYDGYDEVRKSHI 60
           M++ R RPNI+VTGTPGCGK+TTCELL RRL D  YYNISDFA+EH CY+GYDE RKSHI
Sbjct: 15  MDSTRLRPNIIVTGTPGCGKTTTCELLQRRLDDCRYYNISDFAKEHDCYEGYDEGRKSHI 74

Query: 61  VXXXXXXXXXXXXXRKGKSIVDWHVNDVFPERLIDLVVVLRCDNSILYDRLHKRGYHDSK 120
           V             RKG +I+DWHVNDVFPERLIDLVVVLRCDNS LYDRLHKRGYHD+K
Sbjct: 75  VDEDKLLDELEPLLRKGGAIIDWHVNDVFPERLIDLVVVLRCDNSTLYDRLHKRGYHDAK 134

Query: 121 IEENLDAEIMGVVMQDAAESYAQEIVVELQSDTVEHMDANVDRIVEWQEMWLNQHPNGVT 180
           IEEN+DAEIMGVV+QDA +SY  +IVVELQS+T   M+ NV RIV W+  W++QHP GVT
Sbjct: 135 IEENIDAEIMGVVLQDAMDSYVHDIVVELQSNTANQMEENVGRIVAWESSWVSQHPTGVT 194

Query: 181 NELEP--ESDNASDSDDTHGSADTSDSEQE 208
           NEL+   +S++ SD D    + D  D  ++
Sbjct: 195 NELQQDYQSNDESDLDQYDLAKDEGDPNED 224

>Kwal_56.24635 s56 (1083026..1083706) [681 bp, 226 aa] {ON} YDL166C
           (FAP7) - Nuclear protein involved in oxidative stress
           response [contig 161] FULL
          Length = 226

 Score =  278 bits (710), Expect = 4e-95,   Method: Compositional matrix adjust.
 Identities = 131/183 (71%), Positives = 146/183 (79%)

Query: 1   METKRSRPNILVTGTPGCGKSTTCELLVRRLSDYTYYNISDFAREHKCYDGYDEVRKSHI 60
           M + R+ PNILVTGTPGCGK++TCELL RRL    YYNISDFA+E+KCYDGYDE RKSHI
Sbjct: 1   MASTRTSPNILVTGTPGCGKTSTCELLQRRLEGSKYYNISDFAKEYKCYDGYDEARKSHI 60

Query: 61  VXXXXXXXXXXXXXRKGKSIVDWHVNDVFPERLIDLVVVLRCDNSILYDRLHKRGYHDSK 120
           V             R G +IVDWHVNDVFPERLIDLVVVLR DNS L+DRL KRGYH++K
Sbjct: 61  VDEDKLLDELEPLLRAGGAIVDWHVNDVFPERLIDLVVVLRTDNSALFDRLSKRGYHEAK 120

Query: 121 IEENLDAEIMGVVMQDAAESYAQEIVVELQSDTVEHMDANVDRIVEWQEMWLNQHPNGVT 180
           I+EN+DAEIMGVVM DA +SYAQEIVVELQSDT E MD NVDRIV W++ W  QHP GVT
Sbjct: 121 IQENIDAEIMGVVMHDARDSYAQEIVVELQSDTTEQMDENVDRIVTWRDAWREQHPEGVT 180

Query: 181 NEL 183
           NEL
Sbjct: 181 NEL 183

>KLTH0H01298g Chr8 complement(124206..124850) [645 bp, 214 aa] {ON}
           similar to uniprot|Q12055 Saccharomyces cerevisiae
           YDL166C FAP7 Essential nuclear protein involved in the
           oxidative stress response
          Length = 214

 Score =  277 bits (708), Expect = 6e-95,   Method: Compositional matrix adjust.
 Identities = 135/209 (64%), Positives = 156/209 (74%), Gaps = 1/209 (0%)

Query: 1   METKRSRPNILVTGTPGCGKSTTCELLVRRLSDYTYYNISDFAREHKCYDGYDEVRKSHI 60
           M + R  PNILVTGTPGCGK++TCELL RRL D  YYNISDFA++H+CYDGYDE RKSHI
Sbjct: 1   MLSTRFAPNILVTGTPGCGKTSTCELLQRRLKDANYYNISDFAQQHECYDGYDEARKSHI 60

Query: 61  VXXXXXXXXXXXXXRKGKSIVDWHVNDVFPERLIDLVVVLRCDNSILYDRLHKRGYHDSK 120
           V             RKG +IVDWHVND+FPERLIDLVVVLR DN++LYDRL  RGYH++K
Sbjct: 61  VDEDRLLDELEPLMRKGGAIVDWHVNDIFPERLIDLVVVLRTDNTVLYDRLKSRGYHEAK 120

Query: 121 IEENLDAEIMGVVMQDAAESYAQEIVVELQSDTVEHMDANVDRIVEWQEMWLNQHPNGVT 180
           I+EN+DAEIMGVV+QDA +SY +EIVVELQSDT + MD NVDRI  W   WL Q+P GVT
Sbjct: 121 IQENIDAEIMGVVIQDAQDSYEKEIVVELQSDTADQMDENVDRIASWSAAWLEQNPKGVT 180

Query: 181 NEL-EPESDNASDSDDTHGSADTSDSEQE 208
           NEL E  SD    +D+  GS   S S  E
Sbjct: 181 NELVERGSDEEDGTDEEGGSYGNSASSGE 209

>ACL150W Chr3 (87745..88404) [660 bp, 219 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YDL166C (FAP7)
          Length = 219

 Score =  276 bits (705), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 128/184 (69%), Positives = 147/184 (79%)

Query: 1   METKRSRPNILVTGTPGCGKSTTCELLVRRLSDYTYYNISDFAREHKCYDGYDEVRKSHI 60
           M+  R RPNILV+GTPGCGKSTTCELL R L DY Y+NISDFAREH CYDGYDE RKSHI
Sbjct: 1   MQQTRCRPNILVSGTPGCGKSTTCELLQRHLPDYQYFNISDFAREHNCYDGYDEARKSHI 60

Query: 61  VXXXXXXXXXXXXXRKGKSIVDWHVNDVFPERLIDLVVVLRCDNSILYDRLHKRGYHDSK 120
           V             R+G +IVDWHVND+FPERLIDLVVVLRCDN+IL+DRL KRGYH SK
Sbjct: 61  VDEDRLLDELEPLLRRGGAIVDWHVNDIFPERLIDLVVVLRCDNAILHDRLQKRGYHSSK 120

Query: 121 IEENLDAEIMGVVMQDAAESYAQEIVVELQSDTVEHMDANVDRIVEWQEMWLNQHPNGVT 180
           IEEN+DAEIMGVV+QDA +SY +EIVVELQSD  E M  NVDRI  W+  W+++HP+GV+
Sbjct: 121 IEENIDAEIMGVVLQDALDSYVREIVVELQSDDTEQMQQNVDRIAAWEANWVSEHPDGVS 180

Query: 181 NELE 184
           N L+
Sbjct: 181 NALQ 184

>Smik_4.72 Chr4 complement(140216..140809) [594 bp, 197 aa] {ON}
           YDL166C (REAL)
          Length = 197

 Score =  273 bits (699), Expect = 9e-94,   Method: Compositional matrix adjust.
 Identities = 129/184 (70%), Positives = 146/184 (79%)

Query: 1   METKRSRPNILVTGTPGCGKSTTCELLVRRLSDYTYYNISDFAREHKCYDGYDEVRKSHI 60
           ME++R  PNI+VTGTPGCGKS+ CELL  +L DY YYNISDFA++H C++GYDE RKSHI
Sbjct: 1   MESRRYGPNIIVTGTPGCGKSSMCELLKNKLKDYKYYNISDFAKDHDCFEGYDEGRKSHI 60

Query: 61  VXXXXXXXXXXXXXRKGKSIVDWHVNDVFPERLIDLVVVLRCDNSILYDRLHKRGYHDSK 120
           V             R+G SIVDWHVND+FPERLIDLVVVLRCDNS LY RLH RGYHDSK
Sbjct: 61  VDEDKLLDVLEPLLRQGNSIVDWHVNDIFPERLIDLVVVLRCDNSYLYSRLHARGYHDSK 120

Query: 121 IEENLDAEIMGVVMQDAAESYAQEIVVELQSDTVEHMDANVDRIVEWQEMWLNQHPNGVT 180
           IEENLDAEIMGVV QDA ESY   IVVELQSDT E M++NV RI+ W++MWL QHP GVT
Sbjct: 121 IEENLDAEIMGVVKQDAVESYEPHIVVELQSDTKEDMESNVSRIITWEKMWLEQHPEGVT 180

Query: 181 NELE 184
           NE +
Sbjct: 181 NEYQ 184

>YDL166C Chr4 complement(163449..164042) [594 bp, 197 aa] {ON}
           FAP7Essential NTPase required for small ribosome subunit
           synthesis, mediates processing of the 20S pre-rRNA at
           site D in the cytoplasm but associates only transiently
           with 43S preribosomes via Rps14p, may be the
           endonuclease for site D
          Length = 197

 Score =  270 bits (691), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 130/184 (70%), Positives = 145/184 (78%)

Query: 1   METKRSRPNILVTGTPGCGKSTTCELLVRRLSDYTYYNISDFAREHKCYDGYDEVRKSHI 60
           ME +R  PNI+VTGTPGCGKS+TCE L  +L DY YYNISDFA+++ C++GYDE RKSHI
Sbjct: 1   MEARRYGPNIIVTGTPGCGKSSTCEFLKNKLKDYKYYNISDFAKDNDCFEGYDEGRKSHI 60

Query: 61  VXXXXXXXXXXXXXRKGKSIVDWHVNDVFPERLIDLVVVLRCDNSILYDRLHKRGYHDSK 120
           V             R+G SIVDWHVNDVFPERLIDLVVVLRCDNS LY RLH RGYHDSK
Sbjct: 61  VDEDKLLDMLEPLLRQGNSIVDWHVNDVFPERLIDLVVVLRCDNSNLYSRLHARGYHDSK 120

Query: 121 IEENLDAEIMGVVMQDAAESYAQEIVVELQSDTVEHMDANVDRIVEWQEMWLNQHPNGVT 180
           IEENLDAEIMGVV QDA ESY   IVVELQSDT E M +NV RIV W++MWL QHP+GVT
Sbjct: 121 IEENLDAEIMGVVKQDAVESYEPHIVVELQSDTKEDMVSNVSRIVAWEKMWLEQHPDGVT 180

Query: 181 NELE 184
           NE +
Sbjct: 181 NEYQ 184

>KNAG0C03770 Chr3 (742558..743229) [672 bp, 223 aa] {ON} Anc_7.348
           YDL166C
          Length = 223

 Score =  268 bits (686), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 126/182 (69%), Positives = 144/182 (79%)

Query: 2   ETKRSRPNILVTGTPGCGKSTTCELLVRRLSDYTYYNISDFAREHKCYDGYDEVRKSHIV 61
           E++R  PNILVTGTPG GKSTTCELL+R L DYTYYNISDFA ++KCYDGYDE RKSHIV
Sbjct: 3   ESRRLNPNILVTGTPGTGKSTTCELLLRNLPDYTYYNISDFAAKNKCYDGYDEARKSHIV 62

Query: 62  XXXXXXXXXXXXXRKGKSIVDWHVNDVFPERLIDLVVVLRCDNSILYDRLHKRGYHDSKI 121
                          G +I+DWHVNDVFPERLIDLV VLRCD+S+L+DRL+KR YH SKI
Sbjct: 63  DEDKLLDELEPLLHSGGNIIDWHVNDVFPERLIDLVAVLRCDSSVLFDRLNKREYHSSKI 122

Query: 122 EENLDAEIMGVVMQDAAESYAQEIVVELQSDTVEHMDANVDRIVEWQEMWLNQHPNGVTN 181
           +EN+DAEIMGVV+QDA +SY ++IVVELQSD  E M ANVDR+V W  MW  QHP GVTN
Sbjct: 123 DENMDAEIMGVVLQDALDSYEEQIVVELQSDDTEQMAANVDRVVTWTTMWKEQHPEGVTN 182

Query: 182 EL 183
           EL
Sbjct: 183 EL 184

>ZYRO0F11660g Chr6 (955635..956231) [597 bp, 198 aa] {ON} similar to
           uniprot|Q12055 Saccharomyces cerevisiae YDL166C FAP7
           Essential nuclear protein involved in the oxidative
           stress response
          Length = 198

 Score =  266 bits (681), Expect = 5e-91,   Method: Compositional matrix adjust.
 Identities = 126/183 (68%), Positives = 148/183 (80%)

Query: 1   METKRSRPNILVTGTPGCGKSTTCELLVRRLSDYTYYNISDFAREHKCYDGYDEVRKSHI 60
           ME++R  PN+L+TGTPG GKSTT ELL RRLSD+ YYNISDFA+E+ C+DGYDE RKSHI
Sbjct: 1   MESRRYHPNVLITGTPGSGKSTTSELLQRRLSDFQYYNISDFAQENDCFDGYDEGRKSHI 60

Query: 61  VXXXXXXXXXXXXXRKGKSIVDWHVNDVFPERLIDLVVVLRCDNSILYDRLHKRGYHDSK 120
           V             RKG +I+DWHVNDVFPERLIDLVVVLRC+NSIL+ RL KRGYH +K
Sbjct: 61  VDEDKLLDLLEPLLRKGGNIIDWHVNDVFPERLIDLVVVLRCENSILFKRLKKRGYHQTK 120

Query: 121 IEENLDAEIMGVVMQDAAESYAQEIVVELQSDTVEHMDANVDRIVEWQEMWLNQHPNGVT 180
           I+EN+DAEIMGVVMQDA +SY +EIVVEL SD+ E M+ NVDRIV W E+W +QH +GVT
Sbjct: 121 IDENIDAEIMGVVMQDALDSYEKEIVVELTSDSTEQMENNVDRIVSWVELWQDQHHSGVT 180

Query: 181 NEL 183
           NEL
Sbjct: 181 NEL 183

>Suva_4.80 Chr4 complement(150992..151612) [621 bp, 206 aa] {ON}
           YDL166C (REAL)
          Length = 206

 Score =  262 bits (670), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 125/184 (67%), Positives = 144/184 (78%)

Query: 1   METKRSRPNILVTGTPGCGKSTTCELLVRRLSDYTYYNISDFAREHKCYDGYDEVRKSHI 60
           ME++R  PNI+VTGTPGCGKS+TCELL   L  Y YYNISDFA+++ C++GYDE RKSHI
Sbjct: 1   MESRRYGPNIIVTGTPGCGKSSTCELLKDELKGYKYYNISDFAKDNDCFEGYDEGRKSHI 60

Query: 61  VXXXXXXXXXXXXXRKGKSIVDWHVNDVFPERLIDLVVVLRCDNSILYDRLHKRGYHDSK 120
           V             R+G SI+DWHVNDVFPERLIDLVVVLRCDNS LY RLH RGYHDSK
Sbjct: 61  VDEDKLLDTLEPLMRQGNSIIDWHVNDVFPERLIDLVVVLRCDNSKLYSRLHARGYHDSK 120

Query: 121 IEENLDAEIMGVVMQDAAESYAQEIVVELQSDTVEHMDANVDRIVEWQEMWLNQHPNGVT 180
           IEENLDAEIMGVV QDA +SY   IVVELQSDT + + +NV RI+ W++MWL QHP GVT
Sbjct: 121 IEENLDAEIMGVVKQDAVDSYEPHIVVELQSDTKQDIVSNVARIIAWEKMWLEQHPEGVT 180

Query: 181 NELE 184
           NE +
Sbjct: 181 NEYQ 184

>CAGL0I03366g Chr9 complement(287811..288449) [639 bp, 212 aa] {ON}
           highly similar to uniprot|Q12055 Saccharomyces
           cerevisiae YDL166c
          Length = 212

 Score =  261 bits (667), Expect = 9e-89,   Method: Compositional matrix adjust.
 Identities = 127/184 (69%), Positives = 144/184 (78%)

Query: 1   METKRSRPNILVTGTPGCGKSTTCELLVRRLSDYTYYNISDFAREHKCYDGYDEVRKSHI 60
           M ++R  PNI+VTGTPGCGKSTTCELL RRL  Y YYNIS+FA EHKCYDGYDE RKSHI
Sbjct: 1   MGSRRFHPNIIVTGTPGCGKSTTCELLQRRLDGYKYYNISEFAEEHKCYDGYDEGRKSHI 60

Query: 61  VXXXXXXXXXXXXXRKGKSIVDWHVNDVFPERLIDLVVVLRCDNSILYDRLHKRGYHDSK 120
           V              +GKSI+DWHVNDVFPERLIDLVVVLR +N  LYDRL  RGYHDSK
Sbjct: 61  VDEDKLLDELEPLLLEGKSIIDWHVNDVFPERLIDLVVVLRSENGKLYDRLKARGYHDSK 120

Query: 121 IEENLDAEIMGVVMQDAAESYAQEIVVELQSDTVEHMDANVDRIVEWQEMWLNQHPNGVT 180
           IEENLDAEIMGVV+QDA ESY  EIVVELQS+T E M+ NVDRI  W + W+ +H +GV+
Sbjct: 121 IEENLDAEIMGVVLQDAQESYEPEIVVELQSNTTEDMENNVDRINTWVDNWVEEHKDGVS 180

Query: 181 NELE 184
           +EL+
Sbjct: 181 SELK 184

>Skud_4.91 Chr4 complement(159116..159700) [585 bp, 194 aa] {ON}
           YDL166C (REAL)
          Length = 194

 Score =  259 bits (663), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 127/190 (66%), Positives = 144/190 (75%), Gaps = 1/190 (0%)

Query: 1   METKRSRPNILVTGTPGCGKSTTCELLVRRLSDYTYYNISDFAREHKCYDGYDEVRKSHI 60
           ME +R  PNI+VTGTPGCGKS+TCELL   L  Y YYNISDFA+++ C++ YDE RKSHI
Sbjct: 1   MELRRFGPNIIVTGTPGCGKSSTCELLKDELKGYKYYNISDFAKDNDCFEAYDEARKSHI 60

Query: 61  VXXXXXXXXXXXXXRKGKSIVDWHVNDVFPERLIDLVVVLRCDNSILYDRLHKRGYHDSK 120
           V             R+G SI+DWHVNDVFPERLIDLVVVLRCDNS LY RLH RGYHDSK
Sbjct: 61  VDEDKLLDKLEPLLRQGNSIIDWHVNDVFPERLIDLVVVLRCDNSNLYSRLHARGYHDSK 120

Query: 121 IEENLDAEIMGVVMQDAAESYAQEIVVELQSDTVEHMDANVDRIVEWQEMWLNQHPNGVT 180
           IEENLDAEIMGVV QDA +SY   IVVELQ DT E M +NV RIV W++MWL QH +GVT
Sbjct: 121 IEENLDAEIMGVVKQDAVDSYEPHIVVELQGDTKEDMVSNVARIVAWEKMWLEQHSDGVT 180

Query: 181 NELE-PESDN 189
           NE + P  D+
Sbjct: 181 NEYQGPHGDD 190

>TBLA0E00520 Chr5 (95049..95678) [630 bp, 209 aa] {ON} Anc_7.348
           YDL166C
          Length = 209

 Score =  259 bits (661), Expect = 8e-88,   Method: Compositional matrix adjust.
 Identities = 120/183 (65%), Positives = 144/183 (78%)

Query: 1   METKRSRPNILVTGTPGCGKSTTCELLVRRLSDYTYYNISDFAREHKCYDGYDEVRKSHI 60
           M+++R  PN+L++GTPG GKS+TCELL R L DY Y NISDFA+E  CYDG+D+ RKSHI
Sbjct: 1   MKSRRYLPNLLISGTPGTGKSSTCELLKRELEDYKYINISDFAKEFNCYDGFDKGRKSHI 60

Query: 61  VXXXXXXXXXXXXXRKGKSIVDWHVNDVFPERLIDLVVVLRCDNSILYDRLHKRGYHDSK 120
           V             R+G +IVDWHVNDVFPERLIDLVV+LR DNS+LYDRL  R YHD+K
Sbjct: 61  VDEDKLLDELEPILREGHNIVDWHVNDVFPERLIDLVVILRADNSVLYDRLQNRKYHDAK 120

Query: 121 IEENLDAEIMGVVMQDAAESYAQEIVVELQSDTVEHMDANVDRIVEWQEMWLNQHPNGVT 180
           ++ENLDAEIMGVV+QDA +SYAQEIV+ELQS+  E M +NVDRIV W E+W  QH +GVT
Sbjct: 121 VQENLDAEIMGVVLQDAIDSYAQEIVIELQSNNTEEMTSNVDRIVSWVELWKKQHADGVT 180

Query: 181 NEL 183
           NEL
Sbjct: 181 NEL 183

>KAFR0C03790 Chr3 complement(771996..772604) [609 bp, 202 aa] {ON}
           Anc_2.667 YKL024C possible ribosomal frameshifting
          Length = 202

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 31/140 (22%), Positives = 60/140 (42%), Gaps = 25/140 (17%)

Query: 10  ILVTGTPGCGKSTTCELLVRRLSDYTYYNIS--DFAREHKCYDG--YDEVRKSHIVXXXX 65
           I V G PG GK T C  LV+   DY + ++S  D  R  +  +G  +  + K++I     
Sbjct: 15  IFVLGGPGAGKGTQCAKLVK---DYGFVHLSAGDLLRAEQDREGSEFGSLIKNYIKEGLI 71

Query: 66  XXXXXXXXXRKGKSIVDW------HVNDVFPERL------------IDLVVVLRCDNSIL 107
                     K   + ++      ++ D FP ++               V+   C  +++
Sbjct: 72  VPQEITIQLLKNAILENYEKGSTKYLVDGFPRKMDQAITFEQVIVKAKFVLFFDCSETVM 131

Query: 108 YDRLHKRGYHDSKIEENLDA 127
            +RL +RG    +I++N+++
Sbjct: 132 LERLLERGKSSGRIDDNIES 151

>ACR170C Chr3 complement(653511..654380) [870 bp, 289 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YKL024C
           (URA6)
          Length = 289

 Score = 37.7 bits (86), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 41/181 (22%), Positives = 67/181 (37%), Gaps = 39/181 (21%)

Query: 10  ILVTGTPGCGKSTTCELLVRRLSDYTYYNISDFAREHKCYDG--YDEVRKSHI------- 60
           + V G PG GK T C  LV R+  + +    D  R+ +   G  Y E+ K HI       
Sbjct: 101 VFVLGGPGSGKGTQCSRLVERM-QFVHVGAGDLLRDEQNRPGSQYGELIKHHIKEGLIVP 159

Query: 61  --VXXXXXXXXXXXXXRKGKSIVDWHVNDVFPERL------------IDLVVVLRCDNSI 106
             V             R G+      + D FP ++               V+   C   +
Sbjct: 160 QEVTVALLRRAIEEHYRAGRR---KFLVDGFPRKMDQAFTFEKTVVPSKFVLFFDCPERV 216

Query: 107 LYDRLHKRGYHDSKIEENLDAEIMGVVMQDAAESYAQEIVVELQSDTVEHMDANVDRIVE 166
           + +RL  RG    + ++N+++      ++    +Y     VE     VEH  A  D++V 
Sbjct: 217 MLERLLTRGQTSGRSDDNIES------IKKRFRTY-----VETSMPVVEHF-AQQDKVVR 264

Query: 167 W 167
            
Sbjct: 265 L 265

>KLLA0E08053g Chr5 complement(724562..725470) [909 bp, 302 aa] {ON}
           highly similar to uniprot|P15700 Saccharomyces
           cerevisiae YKL024C URA6
          Length = 302

 Score = 37.0 bits (84), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 33/140 (23%), Positives = 57/140 (40%), Gaps = 25/140 (17%)

Query: 10  ILVTGTPGCGKSTTCELLVRRLSDYTYYNIS--DFAREHKCYDG--YDEVRKSHI----- 60
           + V G PG GK T C  LV+   D+ + ++S  D  R  +  +G  Y E+ K  I     
Sbjct: 115 VFVLGGPGAGKGTQCAKLVK---DFGFVHLSAGDLLRAEQAREGSQYGELIKKCIKDGEI 171

Query: 61  ------VXXXXXXXXXXXXXRKGKSIVDWHVNDV-----FPERLID--LVVVLRCDNSIL 107
                 V                K +VD     +     F E ++   + +   C   I+
Sbjct: 172 VPQEVTVALLKNAITSNYNSSNKKFLVDGFPRKMDQAITFEEEIVPSTMTLFFDCPEKIM 231

Query: 108 YDRLHKRGYHDSKIEENLDA 127
            +RL +RG    +I++N+++
Sbjct: 232 LERLLQRGKTSGRIDDNIES 251

>Smik_11.229 Chr11 complement(379526..380140) [615 bp, 204 aa]
          {ON} YKL024C (REAL)
          Length = 204

 Score = 36.6 bits (83), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 29/53 (54%), Gaps = 3/53 (5%)

Query: 10 ILVTGTPGCGKSTTCELLVRRLSDYTYYNISDFAREHKCYDG--YDEVRKSHI 60
          I V G PG GK T CE LV+  S + + +  D  R  +  +G  Y E+ +++I
Sbjct: 19 IFVLGGPGAGKGTQCERLVKDFS-FVHLSAGDLLRAEQSREGSQYGELIRNYI 70

>Skud_11.204 Chr11 complement(373437..374051,374060..374284) [840
           bp, 279 aa] {ON} YKL024C (REAL)
          Length = 279

 Score = 36.6 bits (83), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 30/55 (54%), Gaps = 7/55 (12%)

Query: 10  ILVTGTPGCGKSTTCELLVRRLSDYTYYNIS--DFAREHKCYDG--YDEVRKSHI 60
           + V G PG GK T CE LV+   DY++ ++S  D  R  +   G  Y E+  +HI
Sbjct: 94  VFVLGGPGAGKGTQCEKLVK---DYSFVHLSAGDLLRAEQGRKGSQYGELISNHI 145

>TPHA0N01890 Chr14 (401294..401591,401593..402206) [912 bp, 303 aa]
           {ON} Anc_2.667 YKL024C ribosomal frameshifting
          Length = 303

 Score = 36.2 bits (82), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 34/138 (24%), Positives = 55/138 (39%), Gaps = 21/138 (15%)

Query: 10  ILVTGTPGCGKSTTCELLVRRLSDYTYYNISDFAREHKCYDG--YDEVRKSHIVXXXXXX 67
           I V G PG GK T C  LV R   + + +  D  R  +  DG  +  + K  I       
Sbjct: 115 IFVLGGPGVGKGTQCAKLVDRYG-FVHLSAGDLLRAEQNRDGSEFGPLIKQCITEGLIVP 173

Query: 68  XXXXXXXRK---------GKS--IVDWHVNDV-----FPERLI--DLVVVLRCDNSILYD 109
                   K         GKS  +VD     +     F E L+     +   C  +++ +
Sbjct: 174 QEVTVALLKNAIQANLDNGKSNFLVDGFPRKMDQAITFEESLVPSKFTLFFTCSEAVMLE 233

Query: 110 RLHKRGYHDSKIEENLDA 127
           RL +RG    +I++N+++
Sbjct: 234 RLLERGKTSGRIDDNIES 251

>Kpol_1057.16 s1057 (29809..30690) [882 bp, 293 aa] {ON}
           (29809..30690) [882 nt, 294 aa]
          Length = 293

 Score = 35.8 bits (81), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 30/138 (21%), Positives = 58/138 (42%), Gaps = 21/138 (15%)

Query: 10  ILVTGTPGCGKSTTCELLVRRLSDYTYYNISDFAREHKCYDG--YDEVRKSHI------- 60
           + V G PG GK T C+ LV+    + + +  D  R  +  +G  Y E+ K +I       
Sbjct: 105 VFVLGGPGAGKGTQCDKLVKN-HQFVHLSAGDLLRAEQNREGSQYGELIKKYIKDGLIVP 163

Query: 61  --VXXXXXXXXXXXXXRKGKS--IVDWHVND-----VFPERLI--DLVVVLRCDNSILYD 109
             +             ++G+S  +VD          +F E ++    V+   C   ++  
Sbjct: 164 QEITIALLKNAMSENVKEGRSKFLVDGFPRKMDQAVIFEEEIVPSKFVLFFECPEDVMLR 223

Query: 110 RLHKRGYHDSKIEENLDA 127
           RL +RG    + ++N+++
Sbjct: 224 RLLERGKTSGRSDDNIES 241

>YKL024C Chr11 complement(392526..393140) [615 bp, 204 aa] {ON}
           URA6Uridylate kinase, catalyzes the seventh enzymatic
           step in the de novo biosynthesis of pyrimidines,
           converting uridine monophosphate (UMP) into
           uridine-5'-diphosphate (UDP)
          Length = 204

 Score = 35.0 bits (79), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 34/145 (23%), Positives = 58/145 (40%), Gaps = 35/145 (24%)

Query: 10  ILVTGTPGCGKSTTCELLVRRLSDYTYYNIS--DFAREHKCYDG--YDEVRKSHI----- 60
           I V G PG GK T CE LV+   DY++ ++S  D  R  +   G  Y E+ K+ I     
Sbjct: 19  IFVLGGPGAGKGTQCEKLVK---DYSFVHLSAGDLLRAEQGRAGSQYGELIKNCIKEGQI 75

Query: 61  ------VXXXXXXXXXXXXXRKGKSIVDWHVNDVFPERL------------IDLVVVLRC 102
                 +              K K ++D      FP ++               ++   C
Sbjct: 76  VPQEITLALLRNAISDNVKANKHKFLIDG-----FPRKMDQAISFERDIVESKFILFFDC 130

Query: 103 DNSILYDRLHKRGYHDSKIEENLDA 127
              I+ +RL +RG    + ++N+++
Sbjct: 131 PEDIMLERLLERGKTSGRSDDNIES 155

>KLTH0C00528g Chr3 (55308..56156) [849 bp, 282 aa] {ON} highly
           similar to uniprot|P15700 Saccharomyces cerevisiae
           YKL024C URA6
          Length = 282

 Score = 34.7 bits (78), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 34/140 (24%), Positives = 58/140 (41%), Gaps = 25/140 (17%)

Query: 10  ILVTGTPGCGKSTTCELLVRRLSDYTYYNIS--DFAR--EHKCYDGYDEVRKSHI----- 60
           I V G PG GK T C  LVR   D+ + ++S  D  R  +++    Y E+ K +I     
Sbjct: 96  IFVLGGPGAGKGTQCANLVR---DFQFVHLSAGDLLRAEQNRSNSKYGELIKHYIKEGLI 152

Query: 61  ----VXXXXXXXXXXXXXRKGKS--IVDWHVNDV-----FPERLI--DLVVVLRCDNSIL 107
               V              KG+   +VD     +     F E ++     +   C  S++
Sbjct: 153 VPQEVTVALLKQAIQESYEKGQKRFLVDGFPRKMDQAVTFEEEIVPSKFTLFFDCPESVM 212

Query: 108 YDRLHKRGYHDSKIEENLDA 127
             RL +RG    + ++N+++
Sbjct: 213 LKRLLERGKTSGRSDDNVES 232

>NDAI0C00140 Chr3 complement(19018..19656) [639 bp, 212 aa] {ON}
           Anc_2.667 YKL024C
          Length = 212

 Score = 34.3 bits (77), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 32/143 (22%), Positives = 56/143 (39%), Gaps = 30/143 (20%)

Query: 10  ILVTGTPGCGKSTTCELLVRRLSDYTYYNIS--DFAREHKCYDG--YDEVRKSHIVXXXX 65
           I V G PG GK T C  LV    DY + ++S  D  R  +  +G  Y  + K +I     
Sbjct: 23  IFVLGGPGAGKGTQCAKLVE---DYGFVHLSAGDLLRAEQAREGSEYGTLIKHYIKEGLI 79

Query: 66  XXXXXXXXXRKGKSIVDWHVN---------DVFPERL------------IDLVVVLRCDN 104
                       K+ +  H N         D FP ++                +   C  
Sbjct: 80  VPQEITLALL--KNAIQEHYNNKGAKNFLIDGFPRKMDQAISFEEQIAPSKFTLFFDCPE 137

Query: 105 SILYDRLHKRGYHDSKIEENLDA 127
           +++ +RL +RG    ++++N+++
Sbjct: 138 NVMLERLLERGKTSGRVDDNIES 160

>Suva_11.202 Chr11 complement(376372..376986,376995..377210) [831
           bp, 276 aa] {ON} YKL023C-A (REAL)
          Length = 276

 Score = 33.9 bits (76), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 32/55 (58%), Gaps = 7/55 (12%)

Query: 10  ILVTGTPGCGKSTTCELLVRRLSDYTYYNIS--DFAREHKCYDG--YDEVRKSHI 60
           + V G PG GK T CE LV+   DY++ +++  D  R  +  +G  + E+ K++I
Sbjct: 91  VFVLGGPGAGKGTQCEKLVK---DYSFVHLAAGDLLRAEQNREGSEFGELIKNYI 142

>TDEL0B07620 Chr2 (1335458..1336369) [912 bp, 303 aa] {ON} Anc_2.667
           YKL024C
          Length = 303

 Score = 33.9 bits (76), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 33/143 (23%), Positives = 58/143 (40%), Gaps = 31/143 (21%)

Query: 10  ILVTGTPGCGKSTTCELLVRRLSDYTYYNIS--DFAREHKCYDG--YDE-----VRKSHI 60
           + V G PG GK T C  LV+   DY + ++S  D  R  +  +G  Y E     +++  I
Sbjct: 116 VFVLGGPGAGKGTQCAKLVK---DYQFVHLSAGDLLRAERNREGSKYGEMISHYIKEGLI 172

Query: 61  VXXXXXXXXXXXXXR----KGKSIVDWHVNDVFPERL------------IDLVVVLRCDN 104
           V             R    KGK+     + D FP ++                +   C  
Sbjct: 173 VPQEVTVELLKQAIRENYEKGKT---KFLVDGFPRKMDQAVTFEKQIVPSKFTLFFDCPE 229

Query: 105 SILYDRLHKRGYHDSKIEENLDA 127
            ++ +RL +RG    + ++N+++
Sbjct: 230 RVMLERLIERGKTSGRDDDNIES 252

>CAGL0L09867g Chr12 (1056341..1057123) [783 bp, 260 aa] {ON} some
           similarities with uniprot|P15700 Saccharomyces
           cerevisiae YKL024c URA6 uridine-monophosphate kinase
          Length = 260

 Score = 33.9 bits (76), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 30/140 (21%), Positives = 55/140 (39%), Gaps = 25/140 (17%)

Query: 10  ILVTGTPGCGKSTTCELLVRRLSDYTYYNIS--DFAREHKCYDG--YDEVRKSHIVXXXX 65
           I V G PG GK T C  LV   +DY + ++S  D  R  +  +G  + E+ K +I     
Sbjct: 73  IFVLGGPGAGKGTQCAKLV---NDYKFVHLSAGDLLRAEQNREGSEFGELIKHYIKEGLI 129

Query: 66  XXXXXXXXXRKGKSIVDWHVN------DVFPERL------------IDLVVVLRCDNSIL 107
                     +     ++  N      D FP ++                +   C   ++
Sbjct: 130 VPQEITLSLLQKAIKENYEKNYTKFLVDGFPRKMDQALSFEKQIVPSKFTLFFECPEQVM 189

Query: 108 YDRLHKRGYHDSKIEENLDA 127
            +RL +RG    + ++N+++
Sbjct: 190 LERLLERGKTSGRADDNIES 209

>Kpol_1033.24 s1033 complement(49973..58081,58083..64721) [14748 bp,
            4915 aa] {ON} complement(49973..58081,58083..64721)
            [14748 nt, 4916 aa]
          Length = 4915

 Score = 33.5 bits (75), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 18/27 (66%)

Query: 5    RSRPNILVTGTPGCGKSTTCELLVRRL 31
            ++R  IL+ G  GCGK+T C++L   L
Sbjct: 1357 KNREPILLVGETGCGKTTVCQILAEHL 1383

>Ecym_5638 Chr5 complement(1291799..1292704) [906 bp, 301 aa] {ON}
           similar to Ashbya gossypii ACR170C
          Length = 301

 Score = 33.1 bits (74), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 31/141 (21%), Positives = 55/141 (39%), Gaps = 27/141 (19%)

Query: 10  ILVTGTPGCGKSTTCELLVRRLSDYTYYNISDFAREHKCYDG--YDEVRKSHI------- 60
           I V G PG GK T C  LV +L  + +    D  R+ +   G  Y ++ K +I       
Sbjct: 113 IFVLGGPGAGKGTQCARLVEKLG-FVHVGAGDLLRDEQNRPGSQYGDLIKDYIKEGLIVP 171

Query: 61  --VXXXXXXXXXXXXXRKGKSIVDWHVNDVFPERL------------IDLVVVLRCDNSI 106
             +             +KGK   ++ V D FP ++               V+   C   +
Sbjct: 172 QEITVALLKRAIEESYKKGKK--NFLV-DGFPRKMDQAITFEKEVTPSKFVLFFDCPEKV 228

Query: 107 LYDRLHKRGYHDSKIEENLDA 127
           + +RL  R     + ++N+++
Sbjct: 229 MLERLLVRSQTSGRTDDNIES 249

>Skud_12.174 Chr12 complement(332096..346819) [14724 bp, 4907 aa] {ON}
            YLR106C (REAL)
          Length = 4907

 Score = 33.5 bits (75), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 11/28 (39%), Positives = 20/28 (71%)

Query: 5    RSRPNILVTGTPGCGKSTTCELLVRRLS 32
            +++  +L+ G  GCGK+T C+LL + +S
Sbjct: 1358 KNKEPVLLVGETGCGKTTICQLLAQFMS 1385

>KLTH0G12892g Chr7 (1095023..1109809) [14787 bp, 4928 aa] {ON} similar
            to uniprot|Q12019 Saccharomyces cerevisiae YLR106C MDN1
            Huge dynein-related AAA-type ATPase (midasin) forms
            extended pre-60S particle with the Rix1 complex
            (Rix1p-Ipi1p-Ipi3p) may mediate ATP-dependent remodeling
            of 60S subunits and subsequent export from nucleoplasm to
            cytoplasm
          Length = 4928

 Score = 33.1 bits (74), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 11/23 (47%), Positives = 17/23 (73%)

Query: 10   ILVTGTPGCGKSTTCELLVRRLS 32
            +L+ G  GCGK+T C+L+ + LS
Sbjct: 1369 VLLVGETGCGKTTVCQLIAKYLS 1391

>Kwal_14.868 s14 (88176..89024) [849 bp, 282 aa] {ON} YKL024C (URA6)
           - uridine-monophosphate kinase (uridylate kinase)
           [contig 245] FULL
          Length = 282

 Score = 32.3 bits (72), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 28/55 (50%), Gaps = 7/55 (12%)

Query: 10  ILVTGTPGCGKSTTCELLVRRLSDYTYYNIS--DFAREHKCYDG--YDEVRKSHI 60
           I V G PG GK T C  LVR   DY + ++S  D  R  +  +G  Y  + K +I
Sbjct: 96  IFVLGGPGAGKGTQCANLVR---DYQFVHLSAGDLLRAEQNREGSKYGALIKHYI 147

>NDAI0A02100 Chr1 complement(470992..472092) [1101 bp, 366 aa]
          {ON} Anc_7.320
          Length = 366

 Score = 32.7 bits (73), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 24/45 (53%), Gaps = 2/45 (4%)

Query: 8  PNILVTGTPGCGKSTTCELLVRRLSDYTYYNISDFAREHKCYDGY 52
          PN+LV G  G G  T   L +R+LS  +    SD+  +H   +GY
Sbjct: 13 PNVLVIGAGGVGVITALSLYIRKLSHVSMVIRSDY--DHVTANGY 55

>Kwal_56.23638 s56 (632586..647354) [14769 bp, 4922 aa] {ON} YLR106C
            (MDN1) - Protein required for cell viability [contig 175]
            FULL
          Length = 4922

 Score = 32.7 bits (73), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 11/20 (55%), Positives = 15/20 (75%)

Query: 10   ILVTGTPGCGKSTTCELLVR 29
            IL+ G  GCGK+T C+L+ R
Sbjct: 1366 ILLVGETGCGKTTVCQLIAR 1385

>KNAG0D01010 Chr4 complement(166954..170433) [3480 bp, 1159 aa] {ON}
           Anc_6.234 YPL217C
          Length = 1159

 Score = 32.3 bits (72), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 19/31 (61%)

Query: 10  ILVTGTPGCGKSTTCELLVRRLSDYTYYNIS 40
           + V G PG GK+T  + LVRRL+  T   I+
Sbjct: 72  VCVVGPPGTGKTTLIKSLVRRLTKSTLTEIN 102

>KNAG0H00140 Chr8 complement(19224..20117) [894 bp, 297 aa] {ON} 
          Length = 297

 Score = 32.0 bits (71), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 19/31 (61%), Gaps = 3/31 (9%)

Query: 10  ILVTGTPGCGKSTTCELLVRRLSDYTYYNIS 40
           I V G PG GK T C+ LVR   DY + ++S
Sbjct: 112 IFVLGGPGAGKGTQCDNLVR---DYHFVHLS 139

>ZYRO0A13310g Chr1 complement(1050131..1051678) [1548 bp, 515 aa]
           {OFF} similar to uniprot|P38126 Saccharomyces cerevisiae
           YBR186W PCH2 Nucleolar component of the pachytene
           checkpoint which prevents chromosome segregation when
           recombination and chromosome synapsis are defective also
           represses meiotic interhomolog recombination in the rDNA
          Length = 515

 Score = 32.0 bits (71), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 12/23 (52%), Positives = 17/23 (73%)

Query: 10  ILVTGTPGCGKSTTCELLVRRLS 32
           +LV G PG GK+T C+ L ++LS
Sbjct: 307 LLVQGPPGTGKTTICKALCQKLS 329

>Zrou_YGOB_A13310g Chr1
           complement(1049931..1050068,1050140..1051678) [1677 bp,
           558 aa] {ON} ANNOTATED BY YGOB -
          Length = 558

 Score = 32.0 bits (71), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 12/23 (52%), Positives = 17/23 (73%)

Query: 10  ILVTGTPGCGKSTTCELLVRRLS 32
           +LV G PG GK+T C+ L ++LS
Sbjct: 307 LLVQGPPGTGKTTICKALCQKLS 329

>Suva_10.191 Chr10 complement(353936..368659) [14724 bp, 4907 aa] {ON}
            YLR106C (REAL)
          Length = 4907

 Score = 32.0 bits (71), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 10/28 (35%), Positives = 20/28 (71%)

Query: 5    RSRPNILVTGTPGCGKSTTCELLVRRLS 32
            +++  +L+ G  GCGK+T C+LL + ++
Sbjct: 1359 KNKEPVLLVGETGCGKTTICQLLAQFMN 1386

>YLR106C Chr12 complement(349006..363738) [14733 bp, 4910 aa] {ON}
            MDN1Huge dynein-related AAA-type ATPase (midasin), forms
            extended pre-60S particle with the Rix1 complex
            (Rix1p-Ipi1p-Ipi3p); acts in removal of ribosomal
            biogenesis factors at successive steps of pre-60S
            assembly and export from nucleus
          Length = 4910

 Score = 32.0 bits (71), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 10/27 (37%), Positives = 19/27 (70%)

Query: 5    RSRPNILVTGTPGCGKSTTCELLVRRL 31
            +++  +L+ G  GCGK+T C+LL + +
Sbjct: 1359 KNKEPVLLVGETGCGKTTICQLLAQFM 1385

>Kpol_1048.53 s1048 (151366..153024) [1659 bp, 552 aa] {ON}
           (151366..153024) [1659 nt, 553 aa]
          Length = 552

 Score = 31.2 bits (69), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 12/23 (52%), Positives = 17/23 (73%)

Query: 10  ILVTGTPGCGKSTTCELLVRRLS 32
           +LV G PG GK+T C+ L ++LS
Sbjct: 304 LLVHGPPGTGKTTVCKALCQKLS 326

>AGR074C Chr7 complement(854312..869011) [14700 bp, 4899 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YLR106C
            (MDN1)
          Length = 4899

 Score = 31.6 bits (70), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 10/20 (50%), Positives = 15/20 (75%)

Query: 10   ILVTGTPGCGKSTTCELLVR 29
            +L+ G  GCGK+T C+L+ R
Sbjct: 1364 VLLVGETGCGKTTICDLIAR 1383

>Smik_15.62 Chr15 complement(104681..105652) [972 bp, 323 aa] {ON}
          YOL094C (REAL)
          Length = 323

 Score = 30.8 bits (68), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 27/51 (52%), Gaps = 5/51 (9%)

Query: 8  PNILVTGTPGCGKSTTCELLVRRLSDYTYYNISDFAREHKCYD--GYDEVR 56
          P+++++G PG GK+T+   L   L  ++Y   +D   E    D  G D VR
Sbjct: 43 PHMIISGMPGIGKTTSVHCLAHELLGHSY---ADGVLELNASDDRGIDVVR 90

>Skud_2.312 Chr2 (567925..569382,569566..569712) [1605 bp, 534 aa]
           {ON} YBR186W (REAL)
          Length = 534

 Score = 31.2 bits (69), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 12/23 (52%), Positives = 17/23 (73%)

Query: 10  ILVTGTPGCGKSTTCELLVRRLS 32
           +LV G PG GK+T C+ L ++LS
Sbjct: 312 LLVHGPPGTGKTTLCKALCQKLS 334

>YBR186W Chr2 (600553..602103,602217..602360) [1695 bp, 564 aa] {ON}
            PCH2Nucleolar component of the pachytene checkpoint,
           which prevents chromosome segregation when recombination
           and chromosome synapsis are defective; also represses
           meiotic interhomolog recombination in the rDNA; required
           for meiotic double-stranded break formation
          Length = 564

 Score = 31.2 bits (69), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 12/23 (52%), Positives = 17/23 (73%)

Query: 10  ILVTGTPGCGKSTTCELLVRRLS 32
           +LV G PG GK+T C+ L ++LS
Sbjct: 310 LLVHGPPGTGKTTLCKALCQKLS 332

>YOR342C Chr15 complement(966666..967625) [960 bp, 319 aa] {ON}
           Putative protein of unknown function; green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           and the nucleus
          Length = 319

 Score = 30.8 bits (68), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 27/111 (24%), Positives = 47/111 (42%), Gaps = 16/111 (14%)

Query: 91  ERLIDLVVVLRCDNSILYDRLHKRGYHDSKIEEN--------LDAEIMGVVMQDAAESYA 142
           E L D  +  R DN I +  +H   + D  +E N        L  E++  +  +    +A
Sbjct: 5   EELNDSSIPQRLDNHIFFGSVHSLTHTDFLVENNIRFFINVDLSTELISHIYHEVRSKFA 64

Query: 143 QEIV-VELQSDTVEHMDANVDRIVEWQEMWLNQH-------PNGVTNELEP 185
            EIV V + +D+   +++++ R   W    L Q         +G+ N  EP
Sbjct: 65  HEIVIVNIDNDSQIPIESDLVRSFHWHNTSLLQQLIHHLDFLSGINNHGEP 115

>NCAS0C02020 Chr3 (375594..377126,377196..377351) [1689 bp, 562 aa]
           {ON} Anc_8.558 YBR186W
          Length = 562

 Score = 30.8 bits (68), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 24/41 (58%), Gaps = 2/41 (4%)

Query: 10  ILVTGTPGCGKSTTCELLVRRLS--DYTYYNISDFAREHKC 48
           +LV G PG GK++ C  L ++LS  +  + NI +   E KC
Sbjct: 304 LLVYGPPGTGKTSICRALCQKLSIRNDLHTNIGEGELECKC 344

>Smik_2.326 Chr2 (586919..588469,588545..588688) [1695 bp, 564 aa]
           {ON} YBR186W (REAL)
          Length = 564

 Score = 30.8 bits (68), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 12/23 (52%), Positives = 17/23 (73%)

Query: 10  ILVTGTPGCGKSTTCELLVRRLS 32
           +LV G PG GK+T C+ L ++LS
Sbjct: 310 LLVHGPPGTGKTTLCKALCQKLS 332

>Suva_4.437 Chr4 (770299..771957) [1659 bp, 552 aa] {ON} YBR186W
           (REAL)
          Length = 552

 Score = 30.8 bits (68), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 12/23 (52%), Positives = 17/23 (73%)

Query: 10  ILVTGTPGCGKSTTCELLVRRLS 32
           +LV G PG GK+T C+ L ++LS
Sbjct: 311 LLVHGPPGTGKTTLCKALCQKLS 333

>TPHA0H00620 Chr8 complement(124152..125210) [1059 bp, 352 aa]
          {ON} Anc_8.101 YFR007W
          Length = 352

 Score = 30.4 bits (67), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 25/45 (55%), Gaps = 2/45 (4%)

Query: 3  TKRSRPNILVTGTPGCGKSTTCELLVRRL-SDYTYYNISDFAREH 46
           K  R  +L+ G PG GKST  + L   + + YT Y +S+F  +H
Sbjct: 20 AKNYRVIVLLVGPPGSGKSTVAQSLCDAINAKYTSY-LSNFTGKH 63

>NCAS0B02520 Chr2 (422176..422730) [555 bp, 184 aa] {ON} Anc_8.478
          YDR248C
          Length = 184

 Score = 30.0 bits (66), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 19/28 (67%), Gaps = 1/28 (3%)

Query: 3  TKRSRPNILV-TGTPGCGKSTTCELLVR 29
          T + RP +LV  GT G GKST  E+L++
Sbjct: 2  TTQQRPKVLVLAGTAGTGKSTIAEVLLK 29

>KAFR0B05540 Chr2 complement(1134547..1136106) [1560 bp, 519 aa]
           {ON} Anc_8.262 YDR110W
          Length = 519

 Score = 30.0 bits (66), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 36/71 (50%), Gaps = 15/71 (21%)

Query: 89  FPERLIDLV------VVLRCDNSILY-------DRLHKRGYHDSKIE--ENLDAEIMGVV 133
           F E++I ++       VLR DN +++       D  H   Y + + E  +++D E MG V
Sbjct: 382 FKEKIIQILENAVSESVLRVDNGLIFLEVDEPHDEPHDEPYDEFQFEGDQSIDEEDMGAV 441

Query: 134 MQDAAESYAQE 144
           M  A E+ AQ+
Sbjct: 442 MPPATEADAQD 452

>Ecym_6278 Chr6 complement(526852..527757) [906 bp, 301 aa] {ON}
           similar to Ashbya gossypii AEL156W
          Length = 301

 Score = 29.3 bits (64), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 14/43 (32%), Positives = 23/43 (53%)

Query: 4   KRSRPNILVTGTPGCGKSTTCELLVRRLSDYTYYNISDFAREH 46
           K+ +P +L+T T G       +L +    D++YY +S F  EH
Sbjct: 248 KQLKPELLLTATAGTSWEGMVDLHMEDGFDHSYYFVSSFVPEH 290

>NDAI0I02230 Chr9 complement(508175..511762) [3588 bp, 1195 aa] {ON}
           Anc_6.68 YLR272C
          Length = 1195

 Score = 29.3 bits (64), Expect = 9.7,   Method: Composition-based stats.
 Identities = 22/61 (36%), Positives = 29/61 (47%), Gaps = 4/61 (6%)

Query: 152 DTVEHMDANVDRIVEWQEMWLNQHPNGVTNELEPESDNAS---DSDDTHGSADT-SDSEQ 207
           D  +H+ A  +R+  +         +  TNEL P  DN S   DSDD     D+ SD EQ
Sbjct: 449 DWEKHLKAVKNRLENFMASNSKTETSRNTNELPPSKDNESSKGDSDDHDEEMDSDSDGEQ 508

Query: 208 E 208
           E
Sbjct: 509 E 509

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.131    0.388 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 22,362,434
Number of extensions: 902716
Number of successful extensions: 5303
Number of sequences better than 10.0: 102
Number of HSP's gapped: 5286
Number of HSP's successfully gapped: 102
Length of query: 208
Length of database: 53,481,399
Length adjustment: 105
Effective length of query: 103
Effective length of database: 41,441,469
Effective search space: 4268471307
Effective search space used: 4268471307
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 63 (28.9 bits)