Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0F11308g7.347ON19119110251e-144
Kwal_56.246347.347ON1901908301e-114
KLTH0H01320g7.347ON1901908221e-113
ZYRO0F11638g7.347ON1911927871e-107
TDEL0C020107.347ON1911927761e-106
Suva_4.817.347ON1911927741e-105
YDL165W (CDC36)7.347ON1911927741e-105
Kpol_530.347.347ON1911937711e-105
Skud_4.927.347ON1911927701e-105
Smik_4.737.347ON1911927691e-105
KAFR0B008507.347ON1921937651e-104
NDAI0A019207.347ON1931947531e-102
CAGL0I03388g7.347ON1911927381e-100
TPHA0F029407.347ON1911927371e-100
ACL151C7.347ON2081977318e-99
NCAS0A141307.347ON1911927281e-98
KNAG0C037607.347ON1911947272e-98
Ecym_47267.347ON1911957221e-97
TBLA0E005107.347ON2871686883e-91
KLLA0D12408g7.347ON1841896751e-90
SAKL0B08052g3.370ON576841091e-05
ZYRO0C16588g3.370ON608831063e-05
Kwal_23.39623.370ON553851036e-05
KAFR0H008603.370ON578821021e-04
KLTH0F11880g3.370ON563851011e-04
CAGL0D01342g3.370ON548841002e-04
Smik_16.3163.370ON560821002e-04
YPR072W (NOT5)3.370ON560821002e-04
NDAI0A050803.370ON57582993e-04
Skud_16.3613.370ON56082984e-04
TPHA0A035003.370ON54882984e-04
Suva_16.4013.370ON56582974e-04
Kpol_1006.73.370ON54081966e-04
KNAG0A072903.370ON50785920.002
TBLA0H014903.370ON55282900.003
Ecym_34563.370ON50885900.003
ADL364C3.370ON50483890.005
TDEL0C051203.370ON56283860.010
KLTH0A03652g7.214ON77265830.025
KLLA0B09196g3.370ON59047790.079
Kpol_1070.257.214ON68683770.15
NDAI0A026907.214ON84681750.30
ZYRO0D16302g7.214ON82981730.56
TDEL0H023307.214ON81281730.60
NCAS0A133507.214ON80081710.92
KNAG0D050507.25ON16867691.1
TBLA0D042707.214ON84766701.3
Kpol_538.387.25ON16945672.1
KLLA0E04335g7.214ON75839682.1
Kwal_47.181147.214ON76380682.5
NCAS0A112103.370ON58294682.5
KLTH0D01012g7.25ON17471653.9
SAKL0D14366g7.25ON16767644.0
Kpol_388.44.14ON312853655.8
KLLA0E02685g5.455ON56969646.3
Kwal_26.68337.25ON17445636.4
Ecym_20855.113ON2010149647.4
YIL034C (CAP2)7.208ON28786638.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0F11308g
         (191 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0F11308g Chr6 complement(882040..882615) [576 bp, 191 aa] {O...   399   e-144
Kwal_56.24634 s56 complement(1082319..1082891) [573 bp, 190 aa] ...   324   e-114
KLTH0H01320g Chr8 (125017..125589) [573 bp, 190 aa] {ON} highly ...   321   e-113
ZYRO0F11638g Chr6 complement(954908..955483) [576 bp, 191 aa] {O...   307   e-107
TDEL0C02010 Chr3 (348737..349312) [576 bp, 191 aa] {ON} Anc_7.34...   303   e-106
Suva_4.81 Chr4 (151849..152424) [576 bp, 191 aa] {ON} YDL165W (R...   302   e-105
YDL165W Chr4 (164290..164865) [576 bp, 191 aa] {ON}  CDC36Compon...   302   e-105
Kpol_530.34 s530 (82095..82670) [576 bp, 191 aa] {ON} (82095..82...   301   e-105
Skud_4.92 Chr4 (159953..160528) [576 bp, 191 aa] {ON} YDL165W (R...   301   e-105
Smik_4.73 Chr4 (141054..141629) [576 bp, 191 aa] {ON} YDL165W (R...   300   e-105
KAFR0B00850 Chr2 complement(160852..161430) [579 bp, 192 aa] {ON...   299   e-104
NDAI0A01920 Chr1 (429808..430389) [582 bp, 193 aa] {ON} Anc_7.34...   294   e-102
CAGL0I03388g Chr9 (288784..289359) [576 bp, 191 aa] {ON} highly ...   288   e-100
TPHA0F02940 Chr6 complement(648881..649456) [576 bp, 191 aa] {ON...   288   e-100
ACL151C Chr3 complement(87037..87663) [627 bp, 208 aa] {ON} Synt...   286   8e-99
NCAS0A14130 Chr1 complement(2778386..2778961) [576 bp, 191 aa] {...   285   1e-98
KNAG0C03760 Chr3 complement(741798..742373) [576 bp, 191 aa] {ON...   284   2e-98
Ecym_4726 Chr4 (1420080..1420655) [576 bp, 191 aa] {ON} similar ...   282   1e-97
TBLA0E00510 Chr5 complement(93705..94568) [864 bp, 287 aa] {ON} ...   269   3e-91
KLLA0D12408g Chr4 (1055117..1055671) [555 bp, 184 aa] {ON} simil...   264   1e-90
SAKL0B08052g Chr2 (688482..690212) [1731 bp, 576 aa] {ON} highly...    47   1e-05
ZYRO0C16588g Chr3 (1293001..1294827) [1827 bp, 608 aa] {ON} high...    45   3e-05
Kwal_23.3962 s23 complement(502287..503948) [1662 bp, 553 aa] {O...    44   6e-05
KAFR0H00860 Chr8 complement(158881..160617) [1737 bp, 578 aa] {O...    44   1e-04
KLTH0F11880g Chr6 complement(1000583..1002274) [1692 bp, 563 aa]...    44   1e-04
CAGL0D01342g Chr4 complement(149562..151208) [1647 bp, 548 aa] {...    43   2e-04
Smik_16.316 Chr16 (567157..568839) [1683 bp, 560 aa] {ON} YPR072...    43   2e-04
YPR072W Chr16 (690107..691789) [1683 bp, 560 aa] {ON}  NOT5Subun...    43   2e-04
NDAI0A05080 Chr1 complement(1154530..1156257) [1728 bp, 575 aa] ...    43   3e-04
Skud_16.361 Chr16 (655247..656929) [1683 bp, 560 aa] {ON} YPR072...    42   4e-04
TPHA0A03500 Chr1 complement(769721..771367) [1647 bp, 548 aa] {O...    42   4e-04
Suva_16.401 Chr16 (697328..699025) [1698 bp, 565 aa] {ON} YPR072...    42   4e-04
Kpol_1006.7 s1006 (30700..32322) [1623 bp, 540 aa] {ON} (30700.....    42   6e-04
KNAG0A07290 Chr1 (1139630..1141153) [1524 bp, 507 aa] {ON} Anc_3...    40   0.002
TBLA0H01490 Chr8 complement(331583..333241) [1659 bp, 552 aa] {O...    39   0.003
Ecym_3456 Chr3 complement(853907..855433) [1527 bp, 508 aa] {ON}...    39   0.003
ADL364C Chr4 complement(66072..67586) [1515 bp, 504 aa] {ON} Syn...    39   0.005
TDEL0C05120 Chr3 (917832..919520) [1689 bp, 562 aa] {ON} Anc_3.3...    38   0.010
KLTH0A03652g Chr1 (314336..316654) [2319 bp, 772 aa] {ON} some s...    37   0.025
KLLA0B09196g Chr2 complement(803259..805031) [1773 bp, 590 aa] {...    35   0.079
Kpol_1070.25 s1070 complement(58286..59491,59501..59509,59592..6...    34   0.15 
NDAI0A02690 Chr1 complement(603611..606151) [2541 bp, 846 aa] {O...    33   0.30 
ZYRO0D16302g Chr4 (1357223..1359712) [2490 bp, 829 aa] {ON} simi...    33   0.56 
TDEL0H02330 Chr8 complement(391361..393799) [2439 bp, 812 aa] {O...    33   0.60 
NCAS0A13350 Chr1 (2627917..2630319) [2403 bp, 800 aa] {ON} Anc_7...    32   0.92 
KNAG0D05050 Chr4 (923903..924409) [507 bp, 168 aa] {ON} Anc_7.25...    31   1.1  
TBLA0D04270 Chr4 complement(1055025..1057568) [2544 bp, 847 aa] ...    32   1.3  
Kpol_538.38 s538 (82776..83285) [510 bp, 169 aa] {ON} (82776..83...    30   2.1  
KLLA0E04335g Chr5 (391816..394092) [2277 bp, 758 aa] {ON} simila...    31   2.1  
Kwal_47.18114 s47 (692928..695219) [2292 bp, 763 aa] {ON} YIL038...    31   2.5  
NCAS0A11210 Chr1 (2223815..2225563) [1749 bp, 582 aa] {ON} Anc_3...    31   2.5  
KLTH0D01012g Chr4 complement(93016..93540) [525 bp, 174 aa] {ON}...    30   3.9  
SAKL0D14366g Chr4 (1182056..1182559) [504 bp, 167 aa] {ON} highl...    29   4.0  
Kpol_388.4 s388 complement(7814..17200) [9387 bp, 3128 aa] {ON} ...    30   5.8  
KLLA0E02685g Chr5 complement(248162..249871) [1710 bp, 569 aa] {...    29   6.3  
Kwal_26.6833 s26 complement(83965..84489) [525 bp, 174 aa] {ON} ...    29   6.4  
Ecym_2085 Chr2 complement(147345..153377) [6033 bp, 2010 aa] {ON...    29   7.4  
YIL034C Chr9 complement(289226..290089) [864 bp, 287 aa] {ON}  C...    29   8.0  

>SAKL0F11308g Chr6 complement(882040..882615) [576 bp, 191 aa] {ON}
           highly similar to uniprot|P06100 Saccharomyces
           cerevisiae YDL165W CDC36 Component of the CCR4-NOT
           complex which has multiple roles in regulating mRNA
           levels including regulation of transcription and
           destabilizing mRNAs by deadenylation basal transcription
           factor
          Length = 191

 Score =  399 bits (1025), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 191/191 (100%), Positives = 191/191 (100%)

Query: 1   MAVEKYGLKALLPLIKQETGNAEYDPAMTMGMDLSSMLHSLGIDSNQEYKTRVLDTFPSP 60
           MAVEKYGLKALLPLIKQETGNAEYDPAMTMGMDLSSMLHSLGIDSNQEYKTRVLDTFPSP
Sbjct: 1   MAVEKYGLKALLPLIKQETGNAEYDPAMTMGMDLSSMLHSLGIDSNQEYKTRVLDTFPSP 60

Query: 61  WVETSRSEVEPKFFTPESFVNIPNVLQSPSPPSFNSVQQDHPKIALFQDETLFYLFYKHP 120
           WVETSRSEVEPKFFTPESFVNIPNVLQSPSPPSFNSVQQDHPKIALFQDETLFYLFYKHP
Sbjct: 61  WVETSRSEVEPKFFTPESFVNIPNVLQSPSPPSFNSVQQDHPKIALFQDETLFYLFYKHP 120

Query: 121 GTVVQEITYLELRKRNWRYHKTLKVWLTKDPMMEPVVSQDGLSERGSYVFFDPQRWEKCQ 180
           GTVVQEITYLELRKRNWRYHKTLKVWLTKDPMMEPVVSQDGLSERGSYVFFDPQRWEKCQ
Sbjct: 121 GTVVQEITYLELRKRNWRYHKTLKVWLTKDPMMEPVVSQDGLSERGSYVFFDPQRWEKCQ 180

Query: 181 RDFVLFYNAIM 191
           RDFVLFYNAIM
Sbjct: 181 RDFVLFYNAIM 191

>Kwal_56.24634 s56 complement(1082319..1082891) [573 bp, 190 aa]
           {ON} YDL165W (CDC36) - nuclear protein that negatively
           regulates basal transcription [contig 161] FULL
          Length = 190

 Score =  324 bits (830), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 155/190 (81%), Positives = 170/190 (89%), Gaps = 1/190 (0%)

Query: 3   VEKYGLKALLPLIKQETGNAEYDPAMTMGMDLSSMLHSLGIDSNQEYKTRVLDTFPSPWV 62
           +EKYGL ALLPLI++E  + EYD +MT+G+DLS +LHSLGI SNQ  + RVLDTF SPWV
Sbjct: 1   MEKYGLSALLPLIRREDQSPEYDSSMTLGIDLSPVLHSLGIASNQSTRYRVLDTFQSPWV 60

Query: 63  ETSRSEVEPKFFTPESFVNIPNVLQSPS-PPSFNSVQQDHPKIALFQDETLFYLFYKHPG 121
           ETSRSEVEPKFF PESF NIPNVLQ+   PP+FNSVQQDH KI+LFQDETLFYLFYKHPG
Sbjct: 61  ETSRSEVEPKFFVPESFKNIPNVLQAGDKPPAFNSVQQDHAKISLFQDETLFYLFYKHPG 120

Query: 122 TVVQEITYLELRKRNWRYHKTLKVWLTKDPMMEPVVSQDGLSERGSYVFFDPQRWEKCQR 181
           +VVQE+TYLELRKRNWRYHKTLKVWLTKDPMMEPVV+  G SERGSYVFFDPQRWEKCQR
Sbjct: 121 SVVQELTYLELRKRNWRYHKTLKVWLTKDPMMEPVVAPGGASERGSYVFFDPQRWEKCQR 180

Query: 182 DFVLFYNAIM 191
           DFVLFYNAIM
Sbjct: 181 DFVLFYNAIM 190

>KLTH0H01320g Chr8 (125017..125589) [573 bp, 190 aa] {ON} highly
           similar to uniprot|P06100 Saccharomyces cerevisiae
           YDL165W CDC36 Component of the CCR4-NOT complex which
           has multiple roles in regulating mRNA levels including
           regulation of transcription and destabilizing mRNAs by
           deadenylation basal transcription factor
          Length = 190

 Score =  321 bits (822), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 154/190 (81%), Positives = 170/190 (89%), Gaps = 1/190 (0%)

Query: 3   VEKYGLKALLPLIKQETGNAEYDPAMTMGMDLSSMLHSLGIDSNQEYKTRVLDTFPSPWV 62
           +EKYGL ALLPLI++E  + +YD +MT+G+DLS +LHSLGI +NQ  + RVLDTF SPWV
Sbjct: 1   MEKYGLSALLPLIRREDQSPDYDSSMTLGIDLSPVLHSLGIPNNQPSRNRVLDTFQSPWV 60

Query: 63  ETSRSEVEPKFFTPESFVNIPNVLQSPS-PPSFNSVQQDHPKIALFQDETLFYLFYKHPG 121
           ETSRSEVEPKFF PESF NIPNVLQS   PP+FNSVQQDH KI+LFQDETLFYLFYKHPG
Sbjct: 61  ETSRSEVEPKFFVPESFKNIPNVLQSGERPPAFNSVQQDHAKISLFQDETLFYLFYKHPG 120

Query: 122 TVVQEITYLELRKRNWRYHKTLKVWLTKDPMMEPVVSQDGLSERGSYVFFDPQRWEKCQR 181
           +VVQE+TYLELRKRNWRYHKTLKVWLTKDPMMEPVV+  G SERGSYVFFDPQRWEKCQR
Sbjct: 121 SVVQELTYLELRKRNWRYHKTLKVWLTKDPMMEPVVAPGGASERGSYVFFDPQRWEKCQR 180

Query: 182 DFVLFYNAIM 191
           DFVLFYNAIM
Sbjct: 181 DFVLFYNAIM 190

>ZYRO0F11638g Chr6 complement(954908..955483) [576 bp, 191 aa] {ON}
           highly similar to uniprot|P06100 Saccharomyces
           cerevisiae YDL165W CDC36 Component of the CCR4-NOT
           complex which has multiple roles in regulating mRNA
           levels including regulation of transcription and
           destabilizing mRNAs by deadenylation basal transcription
           factor
          Length = 191

 Score =  307 bits (787), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 148/192 (77%), Positives = 168/192 (87%), Gaps = 4/192 (2%)

Query: 3   VEKYGLKALLPLIKQETG--NAEYDPAMTMGMDLSSMLHSLGIDSNQEYKTRVLDTFPSP 60
           ++K+GL+AL+PL+KQE    + +YD +MT+G DLSSMLHSLGI  + + + +VLDTF SP
Sbjct: 1   MDKFGLEALVPLVKQEDRELSGKYDHSMTLGADLSSMLHSLGIPRDSK-RHKVLDTFQSP 59

Query: 61  WVETSRSEVEPKFFTPESFVNIPNVLQSPS-PPSFNSVQQDHPKIALFQDETLFYLFYKH 119
           W ETSRSEVEP+FF PESFVNIPNVL S S PP FNSVQQD  ++ALFQDETLFYLFYKH
Sbjct: 60  WAETSRSEVEPRFFIPESFVNIPNVLHSQSTPPCFNSVQQDQQRVALFQDETLFYLFYKH 119

Query: 120 PGTVVQEITYLELRKRNWRYHKTLKVWLTKDPMMEPVVSQDGLSERGSYVFFDPQRWEKC 179
           PGTV+QE+TYLELRKRNWRYHKTLK WLTKDP MEPVVS DGLSERGSYVFFDPQRWEKC
Sbjct: 120 PGTVIQELTYLELRKRNWRYHKTLKAWLTKDPKMEPVVSSDGLSERGSYVFFDPQRWEKC 179

Query: 180 QRDFVLFYNAIM 191
           QRDF+LFYNAIM
Sbjct: 180 QRDFLLFYNAIM 191

>TDEL0C02010 Chr3 (348737..349312) [576 bp, 191 aa] {ON} Anc_7.347
           YDL165W
          Length = 191

 Score =  303 bits (776), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 147/192 (76%), Positives = 164/192 (85%), Gaps = 4/192 (2%)

Query: 3   VEKYGLKALLPLIKQETGNAE--YDPAMTMGMDLSSMLHSLGIDSNQEYKTRVLDTFPSP 60
           +EK+GLKAL+PLIKQE       YD ++T+G DLSSMLHSLGI  + + + RVLDTF SP
Sbjct: 1   MEKFGLKALVPLIKQEERETASLYDHSITLGADLSSMLHSLGIPRDSK-RHRVLDTFQSP 59

Query: 61  WVETSRSEVEPKFFTPESFVNIPNVLQS-PSPPSFNSVQQDHPKIALFQDETLFYLFYKH 119
           W ETSRSEVEPKFF P+SF NIP VLQS  +PP FNSVQ D  ++ALFQDETLFYLFYKH
Sbjct: 60  WAETSRSEVEPKFFIPDSFTNIPQVLQSQTTPPCFNSVQHDQQRVALFQDETLFYLFYKH 119

Query: 120 PGTVVQEITYLELRKRNWRYHKTLKVWLTKDPMMEPVVSQDGLSERGSYVFFDPQRWEKC 179
           PGTV+QE+TYLELRKRNWRYHKTLK WLTKDP MEPVVS DGLSERGSYVFFDPQRWEKC
Sbjct: 120 PGTVIQELTYLELRKRNWRYHKTLKAWLTKDPKMEPVVSSDGLSERGSYVFFDPQRWEKC 179

Query: 180 QRDFVLFYNAIM 191
           QR+F+LFYNAIM
Sbjct: 180 QREFLLFYNAIM 191

>Suva_4.81 Chr4 (151849..152424) [576 bp, 191 aa] {ON} YDL165W
           (REAL)
          Length = 191

 Score =  302 bits (774), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 144/192 (75%), Positives = 168/192 (87%), Gaps = 4/192 (2%)

Query: 3   VEKYGLKALLPLIKQETG--NAEYDPAMTMGMDLSSMLHSLGIDSNQEYKTRVLDTFPSP 60
           ++K+GL+AL+PL+KQE    ++ YD +MT+G DLSSML+SLGI  + +   RVLDTF SP
Sbjct: 1   MDKFGLQALVPLLKQEDKELSSTYDHSMTLGADLSSMLYSLGIPRDSQ-DHRVLDTFQSP 59

Query: 61  WVETSRSEVEPKFFTPESFVNIPNVLQSP-SPPSFNSVQQDHPKIALFQDETLFYLFYKH 119
           W ETSRSEVEP+FFTPESF NIP+VLQS  +PP FNS+Q D  ++ALFQDETLF+LFYKH
Sbjct: 60  WAETSRSEVEPRFFTPESFTNIPSVLQSNVTPPCFNSIQNDQQRVALFQDETLFFLFYKH 119

Query: 120 PGTVVQEITYLELRKRNWRYHKTLKVWLTKDPMMEPVVSQDGLSERGSYVFFDPQRWEKC 179
           PGTV+QE+TYLELRKRNWRYHKTLK WLTKDPMMEP+VS DGLSERGSYVFFDPQRWEKC
Sbjct: 120 PGTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSADGLSERGSYVFFDPQRWEKC 179

Query: 180 QRDFVLFYNAIM 191
           QRDF+LFYNAIM
Sbjct: 180 QRDFLLFYNAIM 191

>YDL165W Chr4 (164290..164865) [576 bp, 191 aa] {ON}  CDC36Component
           of the CCR4-NOT complex, which has multiple roles in
           regulating mRNA levels including regulation of
           transcription and destabilizing mRNAs by deadenylation;
           basal transcription factor
          Length = 191

 Score =  302 bits (774), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 145/192 (75%), Positives = 166/192 (86%), Gaps = 4/192 (2%)

Query: 3   VEKYGLKALLPLIKQETG--NAEYDPAMTMGMDLSSMLHSLGIDSNQEYKTRVLDTFPSP 60
           +EK+GLKAL+PL+K E    ++ YD +MT+G DLSSML+SLGI  + +   RVLDTF SP
Sbjct: 1   MEKFGLKALVPLLKLEDKELSSTYDHSMTLGADLSSMLYSLGIPRDSQ-DHRVLDTFQSP 59

Query: 61  WVETSRSEVEPKFFTPESFVNIPNVLQSP-SPPSFNSVQQDHPKIALFQDETLFYLFYKH 119
           W ETSRSEVEP+FFTPESF NIP VLQS  +PP FNS+Q D  ++ALFQDETLF+LFYKH
Sbjct: 60  WAETSRSEVEPRFFTPESFTNIPGVLQSTVTPPCFNSIQNDQQRVALFQDETLFFLFYKH 119

Query: 120 PGTVVQEITYLELRKRNWRYHKTLKVWLTKDPMMEPVVSQDGLSERGSYVFFDPQRWEKC 179
           PGTV+QE+TYLELRKRNWRYHKTLK WLTKDPMMEP+VS DGLSERGSYVFFDPQRWEKC
Sbjct: 120 PGTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSADGLSERGSYVFFDPQRWEKC 179

Query: 180 QRDFVLFYNAIM 191
           QRDF+LFYNAIM
Sbjct: 180 QRDFLLFYNAIM 191

>Kpol_530.34 s530 (82095..82670) [576 bp, 191 aa] {ON}
           (82095..82670) [576 nt, 192 aa]
          Length = 191

 Score =  301 bits (771), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 146/193 (75%), Positives = 168/193 (87%), Gaps = 6/193 (3%)

Query: 3   VEKYGLKALLPLIKQETG--NAEYDPAMTMGMDLSSMLHSLGI-DSNQEYKTRVLDTFPS 59
           ++K+GL+ALLPLIKQ+    + +Y+ AMT+G DLSSMLHSLGI   NQ Y  R+LDTF S
Sbjct: 1   MDKFGLEALLPLIKQDDTELSKKYNHAMTIGTDLSSMLHSLGIPRDNQRY--RILDTFQS 58

Query: 60  PWVETSRSEVEPKFFTPESFVNIPNVLQSP-SPPSFNSVQQDHPKIALFQDETLFYLFYK 118
           PW ETSRSEVEP+FFTPESF NIPNVLQS  +PP FNS++ D  ++ LFQDETLFYLFYK
Sbjct: 59  PWAETSRSEVEPRFFTPESFKNIPNVLQSKVTPPVFNSIENDQQRVTLFQDETLFYLFYK 118

Query: 119 HPGTVVQEITYLELRKRNWRYHKTLKVWLTKDPMMEPVVSQDGLSERGSYVFFDPQRWEK 178
           HPGTV+QE+TYLELRKRNWRYHKTLK WLTKDPM+EP+VS DGLSERGSY+FFDPQRWEK
Sbjct: 119 HPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPMVEPLVSGDGLSERGSYIFFDPQRWEK 178

Query: 179 CQRDFVLFYNAIM 191
           CQR+FVLFYNAIM
Sbjct: 179 CQREFVLFYNAIM 191

>Skud_4.92 Chr4 (159953..160528) [576 bp, 191 aa] {ON} YDL165W
           (REAL)
          Length = 191

 Score =  301 bits (770), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 144/192 (75%), Positives = 166/192 (86%), Gaps = 4/192 (2%)

Query: 3   VEKYGLKALLPLIKQETG--NAEYDPAMTMGMDLSSMLHSLGIDSNQEYKTRVLDTFPSP 60
           +EK+GL+AL+PL+K E    ++ YD +MT+G DLSSML+SLGI  + +   RVLDTF SP
Sbjct: 1   MEKFGLRALVPLLKLEDKELSSTYDHSMTLGADLSSMLYSLGIPRDSQ-DHRVLDTFQSP 59

Query: 61  WVETSRSEVEPKFFTPESFVNIPNVLQSP-SPPSFNSVQQDHPKIALFQDETLFYLFYKH 119
           W ETSRSEVEP+FFTPESF NIP VLQS  +PP FNS+Q D  ++ALFQDETLF+LFYKH
Sbjct: 60  WAETSRSEVEPRFFTPESFTNIPGVLQSNVTPPCFNSIQNDQQRVALFQDETLFFLFYKH 119

Query: 120 PGTVVQEITYLELRKRNWRYHKTLKVWLTKDPMMEPVVSQDGLSERGSYVFFDPQRWEKC 179
           PGTV+QE+TYLELRKRNWRYHKTLK WLTKDPMMEP+VS DGLSERGSYVFFDPQRWEKC
Sbjct: 120 PGTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSADGLSERGSYVFFDPQRWEKC 179

Query: 180 QRDFVLFYNAIM 191
           QRDF+LFYNAIM
Sbjct: 180 QRDFLLFYNAIM 191

>Smik_4.73 Chr4 (141054..141629) [576 bp, 191 aa] {ON} YDL165W
           (REAL)
          Length = 191

 Score =  300 bits (769), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 144/192 (75%), Positives = 166/192 (86%), Gaps = 4/192 (2%)

Query: 3   VEKYGLKALLPLIKQETG--NAEYDPAMTMGMDLSSMLHSLGIDSNQEYKTRVLDTFPSP 60
           +EK+GL+AL+PL+K E    ++ YD +MT+G DLSSML+SLGI  + +   RVLDTF SP
Sbjct: 1   MEKFGLQALVPLLKLEDKELSSTYDHSMTLGADLSSMLYSLGIPRDSQ-DHRVLDTFQSP 59

Query: 61  WVETSRSEVEPKFFTPESFVNIPNVLQSP-SPPSFNSVQQDHPKIALFQDETLFYLFYKH 119
           W ETSRSEVEP+FFTPESF NIP VLQS  +PP FNS+Q D  ++ALFQDETLF+LFYKH
Sbjct: 60  WAETSRSEVEPRFFTPESFTNIPGVLQSNVTPPCFNSIQNDQQRVALFQDETLFFLFYKH 119

Query: 120 PGTVVQEITYLELRKRNWRYHKTLKVWLTKDPMMEPVVSQDGLSERGSYVFFDPQRWEKC 179
           PGTV+QE+TYLELRKRNWRYHKTLK WLTKDPMMEP+VS DGLSERGSYVFFDPQRWEKC
Sbjct: 120 PGTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSADGLSERGSYVFFDPQRWEKC 179

Query: 180 QRDFVLFYNAIM 191
           QRDF+LFYNAIM
Sbjct: 180 QRDFLLFYNAIM 191

>KAFR0B00850 Chr2 complement(160852..161430) [579 bp, 192 aa] {ON}
           Anc_7.347 YDL165W
          Length = 192

 Score =  299 bits (765), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 143/193 (74%), Positives = 167/193 (86%), Gaps = 5/193 (2%)

Query: 3   VEKYGLKALLPLIKQE---TGNAEYDPAMTMGMDLSSMLHSLGIDSNQEYKTRVLDTFPS 59
           ++K+GLKAL+PLIKQ+     N +YD +MT+G DLSSML+SLGI  ++++  RVLDTF S
Sbjct: 1   MDKFGLKALIPLIKQDPQGEKNGQYDHSMTLGADLSSMLYSLGIPRDKQHH-RVLDTFQS 59

Query: 60  PWVETSRSEVEPKFFTPESFVNIPNVLQSP-SPPSFNSVQQDHPKIALFQDETLFYLFYK 118
           PW ETSRSEVEPKF  P+SF NI NVLQS  +PP F+S+Q D  ++ALFQDETLFYLFYK
Sbjct: 60  PWAETSRSEVEPKFSIPDSFNNISNVLQSNVTPPCFDSIQNDQQRVALFQDETLFYLFYK 119

Query: 119 HPGTVVQEITYLELRKRNWRYHKTLKVWLTKDPMMEPVVSQDGLSERGSYVFFDPQRWEK 178
           HP TV+QE+TYLELRKRNWRYHKTLK WLTKDPMMEP+VSQDGLSE+GSYVFFDPQRWEK
Sbjct: 120 HPATVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSQDGLSEKGSYVFFDPQRWEK 179

Query: 179 CQRDFVLFYNAIM 191
           CQRDF+LFYNAIM
Sbjct: 180 CQRDFLLFYNAIM 192

>NDAI0A01920 Chr1 (429808..430389) [582 bp, 193 aa] {ON} Anc_7.347
           YDL165W
          Length = 193

 Score =  294 bits (753), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 142/194 (73%), Positives = 166/194 (85%), Gaps = 6/194 (3%)

Query: 3   VEKYGLKALLPLIKQETGNAE--YDPAMTMGMDLSSMLHSLGIDSNQEYKTRVLDTFPSP 60
           ++K+GL+AL+PLIK +       YD +MT+G DL+SMLHSLGI  + + + RVLDTF SP
Sbjct: 1   MDKFGLEALVPLIKPDDKELSKIYDHSMTLGADLTSMLHSLGIPRDSK-RHRVLDTFQSP 59

Query: 61  WVETSRSEVEPKFFTPESFVNIPNVLQS---PSPPSFNSVQQDHPKIALFQDETLFYLFY 117
           W ETSRSEVEP FF P+SF +IP+VLQS    +PPSF+SVQ+D  ++ALFQDETLFYLFY
Sbjct: 60  WAETSRSEVEPTFFIPDSFTHIPDVLQSNTKDTPPSFDSVQKDQQRVALFQDETLFYLFY 119

Query: 118 KHPGTVVQEITYLELRKRNWRYHKTLKVWLTKDPMMEPVVSQDGLSERGSYVFFDPQRWE 177
           KHPGTV+QE+TYLELRKRNWRYHKTLK WLTKDPMMEPVVS DGLSERGSYVFFDPQRWE
Sbjct: 120 KHPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPVVSNDGLSERGSYVFFDPQRWE 179

Query: 178 KCQRDFVLFYNAIM 191
           KCQR+F+LFYNAIM
Sbjct: 180 KCQREFLLFYNAIM 193

>CAGL0I03388g Chr9 (288784..289359) [576 bp, 191 aa] {ON} highly
           similar to uniprot|P06100 Saccharomyces cerevisiae
           YDL165w CDC36 transcription factor
          Length = 191

 Score =  288 bits (738), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 139/192 (72%), Positives = 162/192 (84%), Gaps = 4/192 (2%)

Query: 3   VEKYGLKALLPLIK--QETGNAEYDPAMTMGMDLSSMLHSLGIDSNQEYKTRVLDTFPSP 60
           + K+GL+ L+PLI+  +E     YD +MT+G DLSSMLHSLGI  + ++  RVLDTF SP
Sbjct: 1   MSKFGLQKLVPLIRADEEKDGKVYDHSMTIGTDLSSMLHSLGIPRDSKHH-RVLDTFQSP 59

Query: 61  WVETSRSEVEPKFFTPESFVNIPNVLQSPS-PPSFNSVQQDHPKIALFQDETLFYLFYKH 119
           W ETSRSEVEPK++ PESF NIP+VLQS + PP+F+ VQ D  ++ALFQDETLFYLFYKH
Sbjct: 60  WAETSRSEVEPKYYIPESFKNIPDVLQSKTTPPTFDDVQTDQQRVALFQDETLFYLFYKH 119

Query: 120 PGTVVQEITYLELRKRNWRYHKTLKVWLTKDPMMEPVVSQDGLSERGSYVFFDPQRWEKC 179
           PGTV+QE+TYLELRKRNWRYHK LK WLTKDPMMEPVV+ DGLSERGSYVFFDPQRWEKC
Sbjct: 120 PGTVIQELTYLELRKRNWRYHKGLKAWLTKDPMMEPVVAADGLSERGSYVFFDPQRWEKC 179

Query: 180 QRDFVLFYNAIM 191
           QRDF LFY+AIM
Sbjct: 180 QRDFPLFYSAIM 191

>TPHA0F02940 Chr6 complement(648881..649456) [576 bp, 191 aa] {ON}
           Anc_7.347 YDL165W
          Length = 191

 Score =  288 bits (737), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 138/192 (71%), Positives = 165/192 (85%), Gaps = 4/192 (2%)

Query: 3   VEKYGLKALLPLIKQETG--NAEYDPAMTMGMDLSSMLHSLGIDSNQEYKTRVLDTFPSP 60
           ++K+GL+ALLPLIKQ+    + +Y+ AMT+G DL+S+ HSLGI +N + + RVLDTF SP
Sbjct: 1   MDKFGLEALLPLIKQDDPEFSKKYNHAMTIGADLTSIQHSLGIPNNNK-RYRVLDTFQSP 59

Query: 61  WVETSRSEVEPKFFTPESFVNIPNVLQSPSPPS-FNSVQQDHPKIALFQDETLFYLFYKH 119
           W ETSRSEVEP++FTP+SF NIP VLQS   PS FNSV+ D  +I+LFQDETLFYLFYKH
Sbjct: 60  WAETSRSEVEPRYFTPKSFTNIPKVLQSIDTPSVFNSVETDQQRISLFQDETLFYLFYKH 119

Query: 120 PGTVVQEITYLELRKRNWRYHKTLKVWLTKDPMMEPVVSQDGLSERGSYVFFDPQRWEKC 179
           PGTV+QE+TYLELRKRNWRYHK LK WLTKDP++EP+V+ DG SERGSY+FFDPQRWEKC
Sbjct: 120 PGTVIQELTYLELRKRNWRYHKILKAWLTKDPIVEPIVTADGQSERGSYIFFDPQRWEKC 179

Query: 180 QRDFVLFYNAIM 191
           QRDFVLFYNAIM
Sbjct: 180 QRDFVLFYNAIM 191

>ACL151C Chr3 complement(87037..87663) [627 bp, 208 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL165W
           (CDC36)
          Length = 208

 Score =  286 bits (731), Expect = 8e-99,   Method: Compositional matrix adjust.
 Identities = 139/197 (70%), Positives = 158/197 (80%), Gaps = 10/197 (5%)

Query: 1   MAVEKYGLKALLPLIKQETGNAEYDPAMTMGMDLSSMLHSLGIDSNQEYKT------RVL 54
           + ++KYGLK LLP+IK E    +YD  MT+G+D+SS+LHSL + S   Y T        L
Sbjct: 16  LNMDKYGLKGLLPVIKHE---KQYDAFMTLGVDVSSLLHSLQVSSKDGYNTALSNGHHAL 72

Query: 55  DTFPSPWVETSRSEVEPKFFTPESFVNIPNVLQSPSPPSFNSVQQDHPKIALFQDETLFY 114
           DTFPSPWVETSRSEVEPKFF PESF NI  VL   S   F SV +DHP+I+L QDETLFY
Sbjct: 73  DTFPSPWVETSRSEVEPKFFIPESFCNIGGVLGQAST-DFTSVARDHPRISLLQDETLFY 131

Query: 115 LFYKHPGTVVQEITYLELRKRNWRYHKTLKVWLTKDPMMEPVVSQDGLSERGSYVFFDPQ 174
           LFYKHPGTV+QE+TYLELRKRNWRYHKTLKVWLTKDP+MEP+VSQD  SERGSYVFFDPQ
Sbjct: 132 LFYKHPGTVLQELTYLELRKRNWRYHKTLKVWLTKDPLMEPIVSQDSTSERGSYVFFDPQ 191

Query: 175 RWEKCQRDFVLFYNAIM 191
           RWEKCQRDF+L Y+AIM
Sbjct: 192 RWEKCQRDFILNYSAIM 208

>NCAS0A14130 Chr1 complement(2778386..2778961) [576 bp, 191 aa] {ON}
           Anc_7.347 YDL165W
          Length = 191

 Score =  285 bits (728), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 136/192 (70%), Positives = 159/192 (82%), Gaps = 4/192 (2%)

Query: 3   VEKYGLKALLPLIKQETGNAE--YDPAMTMGMDLSSMLHSLGIDSNQEYKTRVLDTFPSP 60
           ++K+GLKAL+PL++Q+       YD +MT+G DLSSM+HSLGI  +   + RVLDTF SP
Sbjct: 1   MDKFGLKALVPLLRQDDKELSKPYDHSMTLGADLSSMIHSLGIPRDNT-RHRVLDTFQSP 59

Query: 61  WVETSRSEVEPKFFTPESFVNIPNVLQSP-SPPSFNSVQQDHPKIALFQDETLFYLFYKH 119
           W ETSRSEVEP FF P+SFV I  VLQSP +PP F+S Q D  ++ALFQDETLFYLFYKH
Sbjct: 60  WAETSRSEVEPTFFIPDSFVGISGVLQSPVTPPRFDSAQNDQQRVALFQDETLFYLFYKH 119

Query: 120 PGTVVQEITYLELRKRNWRYHKTLKVWLTKDPMMEPVVSQDGLSERGSYVFFDPQRWEKC 179
           PGTV+QE+TYLELR RNWRYH TL+ WLTKDP+MEP VS DGLSERGSYVFFDPQRWEKC
Sbjct: 120 PGTVLQELTYLELRNRNWRYHTTLRAWLTKDPLMEPEVSADGLSERGSYVFFDPQRWEKC 179

Query: 180 QRDFVLFYNAIM 191
           Q+DF+LFYNAIM
Sbjct: 180 QKDFLLFYNAIM 191

>KNAG0C03760 Chr3 complement(741798..742373) [576 bp, 191 aa] {ON}
           Anc_7.347 YDL165W
          Length = 191

 Score =  284 bits (727), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 140/194 (72%), Positives = 161/194 (82%), Gaps = 8/194 (4%)

Query: 3   VEKYGLKALLPLIKQETGNAE----YDPAMTMGMDLSSMLHSLGIDSNQEYKTRVLDTFP 58
           ++K+GLKAL+PL++Q  G+ E    YD +M +G DLSSMLHSLGI  + + +  VL TF 
Sbjct: 1   MDKFGLKALVPLVRQ--GDPEVASKYDHSMALGADLSSMLHSLGIPRDSK-RQAVLATFQ 57

Query: 59  SPWVETSRSEVEPKFFTPESFVNIPNVLQSPS-PPSFNSVQQDHPKIALFQDETLFYLFY 117
           SPW ETSRSEVEP F+ P SF+ I  VLQS S PP F+SVQ+D  ++ALFQDETLFYLFY
Sbjct: 58  SPWAETSRSEVEPTFYIPASFLGIDEVLQSESTPPCFDSVQRDQQRVALFQDETLFYLFY 117

Query: 118 KHPGTVVQEITYLELRKRNWRYHKTLKVWLTKDPMMEPVVSQDGLSERGSYVFFDPQRWE 177
           KHPGTV+QE+TYLELRKRNWRYHKTLK WLTKDP MEPVVS DGLSERGSYVFFDPQRWE
Sbjct: 118 KHPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPTMEPVVSPDGLSERGSYVFFDPQRWE 177

Query: 178 KCQRDFVLFYNAIM 191
           KCQRDF+LFYNAIM
Sbjct: 178 KCQRDFLLFYNAIM 191

>Ecym_4726 Chr4 (1420080..1420655) [576 bp, 191 aa] {ON} similar to
           Ashbya gossypii ACL151C
          Length = 191

 Score =  282 bits (722), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 138/195 (70%), Positives = 157/195 (80%), Gaps = 10/195 (5%)

Query: 3   VEKYGLKALLPLIKQETGNAEYDPAMTMGMDLSSMLHSLGIDSNQEYKT------RVLDT 56
           + KYGLK+LLP+IK +    +YD +MT+G DL S+LHSL + +   Y +        LDT
Sbjct: 1   MSKYGLKSLLPVIKHD---KQYDSSMTLGTDLPSILHSLQLTTRDSYNSGLNNGHHTLDT 57

Query: 57  FPSPWVETSRSEVEPKFFTPESFVNIPNVLQSPSPPSFNSVQQDHPKIALFQDETLFYLF 116
           FPSPWVETSRSEVEPKFF PESF NI  VL  PS   F SV +DHP+I+L QDETLFYLF
Sbjct: 58  FPSPWVETSRSEVEPKFFIPESFKNIVGVLGQPST-YFTSVARDHPRISLLQDETLFYLF 116

Query: 117 YKHPGTVVQEITYLELRKRNWRYHKTLKVWLTKDPMMEPVVSQDGLSERGSYVFFDPQRW 176
           YKHPGTV+QE+TYLELRKRNWRYHKTLKVWLTKDP+MEP+VSQD  SERGSYVFFDPQRW
Sbjct: 117 YKHPGTVLQELTYLELRKRNWRYHKTLKVWLTKDPLMEPIVSQDSTSERGSYVFFDPQRW 176

Query: 177 EKCQRDFVLFYNAIM 191
           EKCQRDF+L YNAIM
Sbjct: 177 EKCQRDFILNYNAIM 191

>TBLA0E00510 Chr5 complement(93705..94568) [864 bp, 287 aa] {ON}
           Anc_7.347 YDL165W
          Length = 287

 Score =  269 bits (688), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 121/168 (72%), Positives = 146/168 (86%), Gaps = 2/168 (1%)

Query: 25  DPAMTMGMDLSSMLHSLGIDSNQEYKTRVLDTFPSPWVETSRSEVEPKFFTPESFVNIPN 84
           D ++T+G DLSSMLHSLG+  + + + R+LDTF SPW ETSRSEV+P+FF P SF NI N
Sbjct: 121 DHSLTIGADLSSMLHSLGLPRDNK-RHRILDTFQSPWAETSRSEVQPRFFIPSSFSNISN 179

Query: 85  VLQ-SPSPPSFNSVQQDHPKIALFQDETLFYLFYKHPGTVVQEITYLELRKRNWRYHKTL 143
           VLQ + +PP+FN+++ D  ++ALFQDETLFYLFYKHPGTV+QE+TYLELRKRNWR+HK L
Sbjct: 180 VLQCNTTPPTFNNIELDQQRVALFQDETLFYLFYKHPGTVIQELTYLELRKRNWRFHKIL 239

Query: 144 KVWLTKDPMMEPVVSQDGLSERGSYVFFDPQRWEKCQRDFVLFYNAIM 191
           K WLTKDPMMEP+V+ DG SERGSYVFFDPQRWEKCQR+F+LFYNAIM
Sbjct: 240 KTWLTKDPMMEPIVAADGFSERGSYVFFDPQRWEKCQREFILFYNAIM 287

>KLLA0D12408g Chr4 (1055117..1055671) [555 bp, 184 aa] {ON} similar
           to uniprot|P06100 Saccharomyces cerevisiae YDL165W CDC36
           Component of the CCR4-NOT complex which has multiple
           roles in regulating mRNA levels including regulation of
           transcription and destabilizing mRNAs by deadenylation
           basal transcription factor
          Length = 184

 Score =  264 bits (675), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 128/189 (67%), Positives = 152/189 (80%), Gaps = 5/189 (2%)

Query: 3   VEKYGLKALLPLIKQETGNAEYDPAMTMGMDLSSMLHSLGIDSNQEYKTRVLDTFPSPWV 62
           +EKYGLK L+P+++ +     YD  MT+G+DL+S+L+SL I  + +     LD F SPWV
Sbjct: 1   MEKYGLKDLVPVLRHD---PTYDANMTLGIDLNSLLNSLDITKDTK-SHHCLDAFESPWV 56

Query: 63  ETSRSEVEPKFFTPESFVNIPNVLQSPSPPSFNSVQQDHPKIALFQDETLFYLFYKHPGT 122
           ETSRSEV+P FF PESF NI  +L +     F SV +D P+I+L QDETLFYLFYKHPG+
Sbjct: 57  ETSRSEVQPTFFIPESFKNIKGMLGT-DQVEFTSVNRDQPRISLLQDETLFYLFYKHPGS 115

Query: 123 VVQEITYLELRKRNWRYHKTLKVWLTKDPMMEPVVSQDGLSERGSYVFFDPQRWEKCQRD 182
           V+QE+TYLELRKRNWRYHKTLKVWLTKDPMMEPVV+QD +SERGSYVFFDPQRWEKCQRD
Sbjct: 116 VIQELTYLELRKRNWRYHKTLKVWLTKDPMMEPVVAQDSMSERGSYVFFDPQRWEKCQRD 175

Query: 183 FVLFYNAIM 191
           FVL YNAIM
Sbjct: 176 FVLHYNAIM 184

>SAKL0B08052g Chr2 (688482..690212) [1731 bp, 576 aa] {ON} highly
           similar to uniprot|Q12514 Saccharomyces cerevisiae
           YPR072W NOT5 Subunit of global transcriptional regulator
          Length = 576

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 31/84 (36%), Positives = 46/84 (54%), Gaps = 6/84 (7%)

Query: 107 FQDETLFYLFYKHPGTVVQEITYLEL-RKRNWRYHKTLKVWLTKDPMMEP--VVSQDGLS 163
           F  +TLF++FY + GT  Q +   EL + RNW+++K    W  K+    P  VVS +   
Sbjct: 484 FDLDTLFFIFYHYQGTYEQFLAARELSQNRNWQFNKLNHCWFYKEVEKLPPGVVSSENKQ 543

Query: 164 ERGSYVFFDPQR-W--EKCQRDFV 184
           E  S+ +FD Q+ W   +C  DFV
Sbjct: 544 EEISWRYFDYQKSWLARRCGSDFV 567

>ZYRO0C16588g Chr3 (1293001..1294827) [1827 bp, 608 aa] {ON} highly
           similar to uniprot|Q12514 Saccharomyces cerevisiae
           YPR072W NOT5 Subunit of global transcriptional regulator
          Length = 608

 Score = 45.4 bits (106), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 47/83 (56%), Gaps = 8/83 (9%)

Query: 107 FQDETLFYLFYKHPGTVVQEITYLELRK-RNWRYHKTLKVWLTKD-PMMEPVVSQDGLSE 164
           F  +TLF++FY + GT  Q +   EL K R W+++K  + W  K+   + P ++Q   SE
Sbjct: 519 FDLDTLFFIFYHYQGTYEQFLAARELAKNRKWKFNKVDRCWYYKEVEKLPPGMAQ---SE 575

Query: 165 RGSYVFFDPQR-W--EKCQRDFV 184
             S+ +FD QR W   +C  DF+
Sbjct: 576 EESWRYFDYQRSWLARRCNSDFI 598

>Kwal_23.3962 s23 complement(502287..503948) [1662 bp, 553 aa] {ON}
           YPR072W (NOT5) - member of the NOT complex, a global
           negative regulator of transcription [contig 255] FULL
          Length = 553

 Score = 44.3 bits (103), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 47/85 (55%), Gaps = 7/85 (8%)

Query: 104 IALFQDETLFYLFYKHPGTVVQEITYLELRKRNWRYHKTLKVWLTKD-PMMEPVVSQDGL 162
           ++ F  +TLF++FY + GT  Q +   EL  R W+++K  + W  K+   + P + Q   
Sbjct: 463 MSKFDLDTLFFIFYHYQGTHEQFLAARELTMRGWQFNKVNRCWFYKEVEKLPPGMEQ--- 519

Query: 163 SERGSYVFFDPQR-W--EKCQRDFV 184
           SE  S+ +FD Q+ W   +C  DFV
Sbjct: 520 SEEISWRYFDYQKSWLARRCGTDFV 544

>KAFR0H00860 Chr8 complement(158881..160617) [1737 bp, 578 aa] {ON}
           Anc_3.370 YPR072W
          Length = 578

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 47/82 (57%), Gaps = 6/82 (7%)

Query: 107 FQDETLFYLFYKHPGTVVQEITYLELRK-RNWRYHKTLKVWLTKDPMMEPVVSQDGLSER 165
           F  +TLF++FY + GT  Q ++  EL K RNW+++K  + W  K+  +E +      SE 
Sbjct: 490 FDLDTLFFIFYHYQGTYEQFLSSRELNKNRNWQFNKVDRCWYYKE--IEKLPPGMNKSEE 547

Query: 166 GSYVFFDPQR-W--EKCQRDFV 184
            S+ +FD ++ W   +C  DFV
Sbjct: 548 ESWRYFDYKKSWLARRCSPDFV 569

>KLTH0F11880g Chr6 complement(1000583..1002274) [1692 bp, 563 aa]
           {ON} highly similar to uniprot|Q12514 Saccharomyces
           cerevisiae YPR072W NOT5 Subunit of global
           transcriptional regulator
          Length = 563

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 28/85 (32%), Positives = 48/85 (56%), Gaps = 7/85 (8%)

Query: 104 IALFQDETLFYLFYKHPGTVVQEITYLELRKRNWRYHKTLKVWLTKD-PMMEPVVSQDGL 162
           ++ F  +TLF++FY + GT  Q ++  EL  R W+++K  + W  K+   + P + Q   
Sbjct: 473 MSKFDLDTLFFIFYHYQGTYEQFLSARELSIRGWQFNKVNRCWFYKEVEKLPPGMEQ--- 529

Query: 163 SERGSYVFFDPQR-W--EKCQRDFV 184
           SE  S+ +FD Q+ W   +C  +FV
Sbjct: 530 SEEISWRYFDYQKSWLARRCGAEFV 554

>CAGL0D01342g Chr4 complement(149562..151208) [1647 bp, 548 aa] {ON}
           similar to uniprot|Q12514 Saccharomyces cerevisiae
           YPR072w NOT5
          Length = 548

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/84 (34%), Positives = 48/84 (57%), Gaps = 8/84 (9%)

Query: 106 LFQDETLFYLFYKHPGTVVQEITYLELRK-RNWRYHKTLKVWLTKD-PMMEPVVSQDGLS 163
           +F  +TLF++FY + GT  Q +   EL K RNW+++K  + W  K+   + P +++   S
Sbjct: 459 MFDLDTLFFIFYHYQGTYEQFLAARELAKIRNWQFNKKDRCWYYKEIEKLPPGMTK---S 515

Query: 164 ERGSYVFFD-PQRW--EKCQRDFV 184
           E  S+ +FD  + W   +C  DFV
Sbjct: 516 EEESWRYFDFKKSWLSRRCGSDFV 539

>Smik_16.316 Chr16 (567157..568839) [1683 bp, 560 aa] {ON} YPR072W
           (REAL)
          Length = 560

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 46/82 (56%), Gaps = 6/82 (7%)

Query: 107 FQDETLFYLFYKHPGTVVQEITYLEL-RKRNWRYHKTLKVWLTKDPMMEPVVSQDGLSER 165
           F  +TLF++FY + G+  Q +   EL + RNW ++K  + W  K+  +E +    G SE 
Sbjct: 472 FDLDTLFFIFYHYQGSYEQFLAARELYKNRNWLFNKVDRCWYYKE--IEKLPPGMGKSEE 529

Query: 166 GSYVFFDPQR-W--EKCQRDFV 184
            S+ +FD ++ W   +C  DFV
Sbjct: 530 ESWRYFDYKKSWLARRCGNDFV 551

>YPR072W Chr16 (690107..691789) [1683 bp, 560 aa] {ON}  NOT5Subunit
           of the CCR4-NOT complex, which is a global
           transcriptional regulator with roles in transcription
           initiation and elongation and in mRNA degradation
          Length = 560

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 46/82 (56%), Gaps = 6/82 (7%)

Query: 107 FQDETLFYLFYKHPGTVVQEITYLEL-RKRNWRYHKTLKVWLTKDPMMEPVVSQDGLSER 165
           F  +TLF++FY + G+  Q +   EL + RNW ++K  + W  K+  +E +    G SE 
Sbjct: 472 FDLDTLFFIFYHYQGSYEQFLAARELFKNRNWLFNKVDRCWYYKE--IEKLPPGMGKSEE 529

Query: 166 GSYVFFDPQR-W--EKCQRDFV 184
            S+ +FD ++ W   +C  DFV
Sbjct: 530 ESWRYFDYKKSWLARRCGNDFV 551

>NDAI0A05080 Chr1 complement(1154530..1156257) [1728 bp, 575 aa]
           {ON} Anc_3.370
          Length = 575

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 43/82 (52%), Gaps = 4/82 (4%)

Query: 107 FQDETLFYLFYKHPGTVVQEITYLELRK-RNWRYHKTLKVWLTKDPMMEPVVSQDGLSER 165
           F  +TLF++FY + GT  Q +   EL K R+W+Y+K    W  K+    P  +     E 
Sbjct: 485 FDLDTLFFIFYHYQGTYDQFLASRELSKNRDWKYNKVDYCWYYKEIEKLPPGANYNKDEE 544

Query: 166 GSYVFFDPQR-W--EKCQRDFV 184
            S+ +FD ++ W   +C  DFV
Sbjct: 545 ESWRYFDYKKSWLSRRCGNDFV 566

>Skud_16.361 Chr16 (655247..656929) [1683 bp, 560 aa] {ON} YPR072W
           (REAL)
          Length = 560

 Score = 42.4 bits (98), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 46/82 (56%), Gaps = 6/82 (7%)

Query: 107 FQDETLFYLFYKHPGTVVQEITYLEL-RKRNWRYHKTLKVWLTKDPMMEPVVSQDGLSER 165
           F  +TLF++FY + G+  Q +   EL + RNW +++  + W  K+  +E +    G SE 
Sbjct: 472 FDLDTLFFIFYHYQGSYEQFLAARELYKNRNWLFNRVDRCWYYKE--IEKLPPGMGKSEE 529

Query: 166 GSYVFFDPQR-W--EKCQRDFV 184
            S+ +FD ++ W   +C  DFV
Sbjct: 530 ESWRYFDYKKSWLARRCGNDFV 551

>TPHA0A03500 Chr1 complement(769721..771367) [1647 bp, 548 aa] {ON}
           Anc_3.370 YPR072W
          Length = 548

 Score = 42.4 bits (98), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 45/82 (54%), Gaps = 8/82 (9%)

Query: 107 FQDETLFYLFYKHPGTVVQEITYLELRK-RNWRYHKTLKVWLTKD-PMMEPVVSQDGLSE 164
           F  +TLF++FY + GT  Q +   EL K RNW+Y+K  + W  K+     P ++Q   +E
Sbjct: 460 FDLDTLFFIFYHYQGTYEQFLVARELSKCRNWKYNKVDRNWYFKEVTKSAPDMAQ---TE 516

Query: 165 RGSYVFFDPQR-W--EKCQRDF 183
             ++ +FD Q  W   +C  DF
Sbjct: 517 EETWRYFDYQNSWLARRCNHDF 538

>Suva_16.401 Chr16 (697328..699025) [1698 bp, 565 aa] {ON} YPR072W
           (REAL)
          Length = 565

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 46/82 (56%), Gaps = 6/82 (7%)

Query: 107 FQDETLFYLFYKHPGTVVQEITYLEL-RKRNWRYHKTLKVWLTKDPMMEPVVSQDGLSER 165
           F  +TLF++FY + G+  Q +   EL + RNW +++  + W  K+  +E +    G SE 
Sbjct: 477 FDLDTLFFIFYHYQGSYEQFLAARELYKNRNWLFNRVDRCWYYKE--IEKLPPGMGKSEE 534

Query: 166 GSYVFFDPQR-W--EKCQRDFV 184
            S+ +FD ++ W   +C  DFV
Sbjct: 535 ESWRYFDYKKSWLARRCGNDFV 556

>Kpol_1006.7 s1006 (30700..32322) [1623 bp, 540 aa] {ON}
           (30700..32322) [1623 nt, 541 aa]
          Length = 540

 Score = 41.6 bits (96), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 42/81 (51%), Gaps = 6/81 (7%)

Query: 107 FQDETLFYLFYKHPGTVVQEITYLELRK-RNWRYHKTLKVWLTKDPMMEPVVSQDGLSER 165
           F  +TLF++FY + GT  Q +   EL K RNW+++K  + W  K+    P   Q    E 
Sbjct: 452 FDLDTLFFIFYHYQGTYEQFLVARELAKHRNWKFNKINRNWYYKEVTKSPPGMQQA--EE 509

Query: 166 GSYVFFDPQR-W--EKCQRDF 183
            ++ +FD Q  W   +C  DF
Sbjct: 510 ETWRYFDYQNSWLARRCNSDF 530

>KNAG0A07290 Chr1 (1139630..1141153) [1524 bp, 507 aa] {ON}
           Anc_3.370 YPR072W
          Length = 507

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 46/85 (54%), Gaps = 6/85 (7%)

Query: 104 IALFQDETLFYLFYKHPGTVVQEITYLELR-KRNWRYHKTLKVWLTKDPMMEPVVSQDGL 162
           +  F  +TLF++FY + GT  Q +   EL   R+W+++K  + W  K+  +E +      
Sbjct: 416 LTKFDLDTLFFIFYHYQGTYEQFLAARELSINRDWQFNKKDRCWYYKE--IEKLPPGMNK 473

Query: 163 SERGSYVFFDPQR-W--EKCQRDFV 184
           SE  S+ +FD ++ W   +C  DFV
Sbjct: 474 SEEESWRYFDYKKSWLARRCNSDFV 498

>TBLA0H01490 Chr8 complement(331583..333241) [1659 bp, 552 aa] {ON}
           Anc_3.370 YPR072W
          Length = 552

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 46/82 (56%), Gaps = 8/82 (9%)

Query: 107 FQDETLFYLFYKHPGTVVQEITYLELRK-RNWRYHKTLKVWLTKD-PMMEPVVSQDGLSE 164
           F  +TLF++FY + GT  Q ++  EL K RNW ++K  + W  ++   + P + Q   SE
Sbjct: 463 FDLDTLFFIFYHYQGTYDQFLSARELAKNRNWEFNKVDRRWYYREVEKLPPGLPQ---SE 519

Query: 165 RGSYVFFDPQR-W--EKCQRDF 183
             S+ +FD Q+ W   +C  +F
Sbjct: 520 EISWRYFDYQKSWLSRRCNSNF 541

>Ecym_3456 Chr3 complement(853907..855433) [1527 bp, 508 aa] {ON}
           similar to Ashbya gossypii ADL364C
          Length = 508

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 44/85 (51%), Gaps = 7/85 (8%)

Query: 104 IALFQDETLFYLFYKHPGTVVQEITYLELRKRNWRYHKTLKVWLTKD-PMMEPVVSQDGL 162
           +  F  +TLF++FY + GT  Q +   EL  R W +++  + W  ++   + P + Q   
Sbjct: 418 LTKFDLDTLFFIFYHYQGTYEQFLAARELNIRGWLFNRVNRCWFYREVEKLPPGMEQ--- 474

Query: 163 SERGSYVFFDPQR-W--EKCQRDFV 184
            E  S+ +FD Q+ W   +C  DFV
Sbjct: 475 KEEVSWRYFDYQKSWLARRCGPDFV 499

>ADL364C Chr4 complement(66072..67586) [1515 bp, 504 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR072W
           (NOT5)
          Length = 504

 Score = 38.9 bits (89), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 43/83 (51%), Gaps = 7/83 (8%)

Query: 107 FQDETLFYLFYKHPGTVVQEITYLELRKRNWRYHKTLKVWLTKD-PMMEPVVSQDGLSER 165
           F  +TLF++FY + GT  Q +   EL  R W +++  + W  K+   + P + Q    E 
Sbjct: 417 FDLDTLFFIFYHYQGTYDQFLAARELIIRGWIFNRVNRCWFYKEVEKLPPGMDQ---KEE 473

Query: 166 GSYVFFDPQR-W--EKCQRDFVL 185
            S+ +FD Q+ W   +C  DFV 
Sbjct: 474 VSWRYFDYQKSWLARRCGPDFVF 496

>TDEL0C05120 Chr3 (917832..919520) [1689 bp, 562 aa] {ON} Anc_3.370
           YPR072W
          Length = 562

 Score = 37.7 bits (86), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 28/83 (33%), Positives = 44/83 (53%), Gaps = 8/83 (9%)

Query: 107 FQDETLFYLFYKHPGTVVQEITYLELRK-RNWRYHKTLKVWLTKD-PMMEPVVSQDGLSE 164
           F  +TLF++FY + GT  Q +   EL K R W+++K  + W  K+   + P + Q   +E
Sbjct: 473 FDLDTLFFIFYHYQGTYDQFLAARELSKNRKWKFNKIDRCWYYKEVEKLPPGMLQ---AE 529

Query: 165 RGSYVFFDPQ-RW--EKCQRDFV 184
             S+ +FD Q  W   +C  D V
Sbjct: 530 EESWRYFDYQGSWLARRCNNDVV 552

>KLTH0A03652g Chr1 (314336..316654) [2319 bp, 772 aa] {ON} some
           similarities with uniprot|P06102 Saccharomyces
           cerevisiae YIL038C NOT3 Subunit of the CCR4-NOT complex
           which is a global transcriptional regulator with roles
           in transcription initiation and elongation and in mRNA
           degradation
          Length = 772

 Score = 36.6 bits (83), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 32/65 (49%), Gaps = 3/65 (4%)

Query: 112 LFYLFYKHPGTVVQEITYLELRKRNWRYHKTLKVWLTKDPMMEPVVSQDGLSERGSYVFF 171
           LFY FY     + QEI Y  L +RNW+  KT + W ++  +  P  S + L E   +  F
Sbjct: 667 LFYCFYYSITPLEQEIAYTLLGERNWKVSKTGENWFSRHSL--PKFSNE-LCEVADFKIF 723

Query: 172 DPQRW 176
           +   W
Sbjct: 724 NLDDW 728

>KLLA0B09196g Chr2 complement(803259..805031) [1773 bp, 590 aa] {ON}
           similar to uniprot|Q12514 Saccharomyces cerevisiae
           YPR072W NOT5 Subunit of global transcriptional regulator
          Length = 590

 Score = 35.0 bits (79), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 27/47 (57%)

Query: 104 IALFQDETLFYLFYKHPGTVVQEITYLELRKRNWRYHKTLKVWLTKD 150
           ++ F  +TLF++FY + G+  Q +   EL  R W ++K  + W  K+
Sbjct: 499 MSKFALDTLFFIFYHYQGSYDQFLASRELSLRGWTFNKVNRCWFHKE 545

>Kpol_1070.25 s1070
           complement(58286..59491,59501..59509,59592..60437) [2061
           bp, 686 aa] {ON}
           complement(58286..59491,59501..59509,59592..60437) [2061
           nt, 687 aa]
          Length = 686

 Score = 34.3 bits (77), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 44/83 (53%), Gaps = 6/83 (7%)

Query: 111 TLFYLFYKHPGTVVQ-EITYLELRKRNWRYHKTLKVWLTKDPMMEPVVSQDGLSERGSYV 169
           TLFY +Y  P T +Q +I+ + L +R+W+  K   +W  K    EP  S +   E G+Y 
Sbjct: 564 TLFYHYY-FPLTPLQKQISSILLIERDWKLLKNGTMWFLK--QGEPKFSNESF-EVGNYK 619

Query: 170 FFDPQRWEKCQR-DFVLFYNAIM 191
            F    W   ++ +F L +N++M
Sbjct: 620 IFKADDWTVIEKFNFKLDFNSLM 642

>NDAI0A02690 Chr1 complement(603611..606151) [2541 bp, 846 aa] {ON}
           Anc_7.214
          Length = 846

 Score = 33.5 bits (75), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 38/81 (46%), Gaps = 4/81 (4%)

Query: 111 TLFYLFYKHPGTVVQEITYLELRKRNWRYHKTLKVWLTKDPMMEPVVSQDGLSERGSYVF 170
           TLFY +Y     + +EI  + L +RNW+      +W  +     P+  Q+ L E G Y  
Sbjct: 719 TLFYNYYFAVTPLEKEIANVILNERNWKVSFDETMWFLR---QGPIKFQNELCELGDYKI 775

Query: 171 FDPQRWEKCQR-DFVLFYNAI 190
           F    W    + +F L Y+++
Sbjct: 776 FKLDEWLVVDKINFKLDYSSL 796

>ZYRO0D16302g Chr4 (1357223..1359712) [2490 bp, 829 aa] {ON} similar
           to uniprot|P06102 Saccharomyces cerevisiae YIL038C NOT3
           Subunit of the CCR4-NOT complex which is a global
           transcriptional regulator with roles in transcription
           initiation and elongation and in mRNA degradation
          Length = 829

 Score = 32.7 bits (73), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 35/81 (43%), Gaps = 4/81 (4%)

Query: 111 TLFYLFYKHPGTVVQEITYLELRKRNWRYHKTLKVWLTKDPMMEPVVSQDGLSERGSYVF 170
           TLFY +Y     + QEI  + L +R+W+  K   +W  +    +     + L E   Y  
Sbjct: 712 TLFYNYYFAVTPLEQEIASIILSERDWKVSKNCAMWFLRQSETKFA---NELCEVADYKI 768

Query: 171 FDPQRWEKCQR-DFVLFYNAI 190
           F    W    R +F L Y A+
Sbjct: 769 FKLDDWTVIDRLNFKLDYAAL 789

>TDEL0H02330 Chr8 complement(391361..393799) [2439 bp, 812 aa] {ON}
           Anc_7.214 YIL038C
          Length = 812

 Score = 32.7 bits (73), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 37/81 (45%), Gaps = 4/81 (4%)

Query: 111 TLFYLFYKHPGTVVQEITYLELRKRNWRYHKTLKVWLTKDPMMEPVVSQDGLSERGSYVF 170
           TLFY +Y     + Q I  L L +RNW+  K+  +W  +    EP  + + + E   Y  
Sbjct: 692 TLFYNYYFAVTPLEQTIASLVLSERNWKVSKSGTLWFLR--QGEPKFANE-VCEVADYKI 748

Query: 171 FDPQRWEKCQR-DFVLFYNAI 190
           F    W    + +F L Y A+
Sbjct: 749 FKLDDWTVADKPNFKLDYAAL 769

>NCAS0A13350 Chr1 (2627917..2630319) [2403 bp, 800 aa] {ON}
           Anc_7.214 YIL038C
          Length = 800

 Score = 32.0 bits (71), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 37/81 (45%), Gaps = 4/81 (4%)

Query: 111 TLFYLFYKHPGTVVQEITYLELRKRNWRYHKTLKVWLTKDPMMEPVVSQDGLSERGSYVF 170
           TLFY +Y     + +EI+ + L +R+WR  K   +W  +      V  Q+   E G Y  
Sbjct: 671 TLFYNYYFAVTPLEKEISNVILNERSWRISKDETLWFLR---QGSVKLQNEFCEIGDYKI 727

Query: 171 FDPQRWEKCQR-DFVLFYNAI 190
           F    W    + +F L Y+ +
Sbjct: 728 FKLDDWTVIDKINFKLDYSNL 748

>KNAG0D05050 Chr4 (923903..924409) [507 bp, 168 aa] {ON} Anc_7.25
           YAL044C
          Length = 168

 Score = 31.2 bits (69), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 30/67 (44%), Gaps = 5/67 (7%)

Query: 71  PKFFTPESFVNIPNVLQSP-----SPPSFNSVQQDHPKIALFQDETLFYLFYKHPGTVVQ 125
           P+ F      N  N L+ P     S PS     +DH  ++L +D T F    K+    + 
Sbjct: 16  PRLFLRAQSTNSLNKLELPFKYSNSGPSQVKYTKDHEWVSLHEDGTAFLGITKYAADALG 75

Query: 126 EITYLEL 132
           + TY+EL
Sbjct: 76  DATYVEL 82

>TBLA0D04270 Chr4 complement(1055025..1057568) [2544 bp, 847 aa]
           {ON} Anc_7.214 YIL038C
          Length = 847

 Score = 31.6 bits (70), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 33/66 (50%), Gaps = 3/66 (4%)

Query: 111 TLFYLFYKHPGTVVQEITYLELRKRNWRYHKTLKVWLTKDPMMEPVVSQDGLSERGSYVF 170
           TLFY +Y     + +E++ + L +R+WR      +W ++    E  +S D L E G Y  
Sbjct: 725 TLFYNYYFSVTPLEKEVSMVVLAERDWRITNNETMWFSR--QGEAKLS-DELYEIGDYRI 781

Query: 171 FDPQRW 176
           F  + W
Sbjct: 782 FSLEDW 787

>Kpol_538.38 s538 (82776..83285) [510 bp, 169 aa] {ON}
           (82776..83285) [510 nt, 170 aa]
          Length = 169

 Score = 30.4 bits (67), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 22/45 (48%)

Query: 88  SPSPPSFNSVQQDHPKIALFQDETLFYLFYKHPGTVVQEITYLEL 132
           S S PSF     +H  IA  +D T F    K+    + + TY+EL
Sbjct: 37  SASGPSFIKYTNEHEWIAAHEDGTAFLGITKYAADALGDATYVEL 81

>KLLA0E04335g Chr5 (391816..394092) [2277 bp, 758 aa] {ON} similar
           to uniprot|Q75AN0 Ashbya gossypii ADL108C ADL108Cp and
           some similarites with YIL038C uniprot|P06102
           Saccharomyces cerevisiae YIL038C NOT3 Subunit of the
           CCR4- NOT complex which is a global transcriptional
           regulator with roles in transcription initiation and
           elongation and in mRNA degradation
          Length = 758

 Score = 30.8 bits (68), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 20/39 (51%)

Query: 111 TLFYLFYKHPGTVVQEITYLELRKRNWRYHKTLKVWLTK 149
           TLFY +Y     + Q I  L L++R WR  KT   W  +
Sbjct: 641 TLFYHYYFSVTPLEQRICALLLKQREWRVLKTGDCWFLR 679

>Kwal_47.18114 s47 (692928..695219) [2292 bp, 763 aa] {ON} YIL038C
           (NOT3) - CCR4 trascriptional complex component [contig
           198] FULL
          Length = 763

 Score = 30.8 bits (68), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 39/80 (48%), Gaps = 4/80 (5%)

Query: 112 LFYLFYKHPGTVVQEITYLELRKRNWRYHKTLKVWLTKDPMMEPVVSQDGLSERGSYVFF 171
           LFY FY     + +EI Y  L +R+W+  K+   W ++  +  P  S + L E   +  F
Sbjct: 674 LFYCFYYSITPLEREIAYTLLIERSWKVSKSGDSWFSRHGV--PKFSNE-LCEVADFKIF 730

Query: 172 DPQRWEKCQR-DFVLFYNAI 190
           +   W   ++ +F L Y+ +
Sbjct: 731 NLDDWTVSEKLNFKLDYSIL 750

>NCAS0A11210 Chr1 (2223815..2225563) [1749 bp, 582 aa] {ON}
           Anc_3.370 YPR072W
          Length = 582

 Score = 30.8 bits (68), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 27/94 (28%), Positives = 47/94 (50%), Gaps = 16/94 (17%)

Query: 107 FQDETLFYLFYKHPGTVVQEITYLEL-RKRNWRYHKTLKVWLTKD-PMMEPVVS------ 158
           F  +TLF++FY + GT  Q +   EL + R+W ++K    W  ++   + P ++      
Sbjct: 480 FDLDTLFFIFYHYQGTYDQFLAARELSQNRHWLFNKVDSCWYFREIEKLPPTINMSNTIP 539

Query: 159 ----QDGLS-ERGSYVFFDPQR-W--EKCQRDFV 184
               +D  S E  S+ +FD ++ W   +C  DFV
Sbjct: 540 NNKREDSNSDEEESWRYFDYKKSWLARRCGPDFV 573

>KLTH0D01012g Chr4 complement(93016..93540) [525 bp, 174 aa] {ON}
           similar to uniprot|P39726 Saccharomyces cerevisiae
           YAL044C GCV3 H subunit of the mitochondrial glycine
           decarboxylase complex required for the catabolism of
           glycine to 5 10-methylene-THF expression is regulated by
           levels of levels of 5 10-methylene-THF in the cytoplasm
          Length = 174

 Score = 29.6 bits (65), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 27/71 (38%), Gaps = 5/71 (7%)

Query: 67  SEVEPKFFTPESFVNIPNVLQSP-----SPPSFNSVQQDHPKIALFQDETLFYLFYKHPG 121
           S + P+ F      N     Q P     S PS       H  IA  QD T F    K+  
Sbjct: 17  SAISPRLFLRAQSSNALTKTQPPFTFSKSGPSSVKYTSQHEWIAAHQDGTAFVGITKYAA 76

Query: 122 TVVQEITYLEL 132
             + + TY+EL
Sbjct: 77  DALGDATYIEL 87

>SAKL0D14366g Chr4 (1182056..1182559) [504 bp, 167 aa] {ON} highly
           similar to gnl|GLV|KLLA0A03597g Kluyveromyces lactis
           KLLA0A03597g and similar to YAL044C uniprot|P39726
           Saccharomyces cerevisiae YAL044C GCV3 H subunit of the
           mitochondrial glycine decarboxylase complex required for
           the catabolism of glycine to 5 10-methylene- THF
           expression is regulated by levels of levels of 5 10-
           methylene-THF in the cytoplasm
          Length = 167

 Score = 29.3 bits (64), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 26/67 (38%), Gaps = 5/67 (7%)

Query: 71  PKFFTPESFVNIPNVLQSP-----SPPSFNSVQQDHPKIALFQDETLFYLFYKHPGTVVQ 125
           P+ F      N  N  Q P     S PS       H  IA  QD T F    K+    + 
Sbjct: 14  PRLFLRAQSTNALNKSQLPFTYSSSGPSVVKYTSQHEWIAAHQDGTAFVGITKYAADALG 73

Query: 126 EITYLEL 132
           + TY+EL
Sbjct: 74  DATYIEL 80

>Kpol_388.4 s388 complement(7814..17200) [9387 bp, 3128 aa] {ON}
            complement(7814..17200) [9387 nt, 3129 aa]
          Length = 3128

 Score = 29.6 bits (65), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 15/53 (28%), Positives = 29/53 (54%), Gaps = 4/53 (7%)

Query: 80   VNIPNVLQSPSPPSFNSVQQDHP----KIALFQDETLFYLFYKHPGTVVQEIT 128
             N PNVL   + P   +  ++HP     I+  +D+T   +++KH   ++QE++
Sbjct: 2623 ANFPNVLYPTAIPDNKNENENHPVLYGSISKVKDDTHGVVYFKHLTVLLQELS 2675

>KLLA0E02685g Chr5 complement(248162..249871) [1710 bp, 569 aa] {ON}
           similar to uniprot|P21264 Saccharomyces cerevisiae
           YOR128C ADE2 Phosphoribosylaminoimidazole carboxylase
           catalyzes a step in the 'de novo' purine nucleotide
           biosynthetic pathway red pigment accumulates in mutant
           cells deprived of adenine
          Length = 569

 Score = 29.3 bits (64), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 29/69 (42%), Gaps = 9/69 (13%)

Query: 50  KTRVLDTFPSPW--VETSRSEVEPKFFTPESFVNIPNV-------LQSPSPPSFNSVQQD 100
           KT +LD   SP   +      V   F  PE    I ++       ++    P+   VQQD
Sbjct: 28  KTIILDAENSPAKQINALSEHVNGSFAKPEDIKKIASLCDVLTVEIEHVDVPTLKRVQQD 87

Query: 101 HPKIALFQD 109
           HP + ++ D
Sbjct: 88  HPNLKIYPD 96

>Kwal_26.6833 s26 complement(83965..84489) [525 bp, 174 aa] {ON}
           YAL044C (GCV3) - H-protein subunit of the glycine
           cleavage system [contig 44] FULL
          Length = 174

 Score = 28.9 bits (63), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 20/45 (44%)

Query: 88  SPSPPSFNSVQQDHPKIALFQDETLFYLFYKHPGTVVQEITYLEL 132
           S S PS       H  IA  QD T F    K+    + + TY+EL
Sbjct: 43  SKSGPSLVKYTSQHEWIAAHQDGTAFVGITKYAADALGDATYIEL 87

>Ecym_2085 Chr2 complement(147345..153377) [6033 bp, 2010 aa] {ON}
            similar to Ashbya gossypii ACL143C
          Length = 2010

 Score = 29.3 bits (64), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 39/149 (26%), Positives = 58/149 (38%), Gaps = 30/149 (20%)

Query: 6    YGLKALLPLIKQETGNAEYDPAMTMGMD-LSSMLHSLG-IDS--NQEYKTRVLDTFPSPW 61
            YG      LIKQ     EY+P   +G+D     L+++G +D   + E    VL+   + W
Sbjct: 1852 YGCIKFSTLIKQIPLYTEYNPRDCLGIDEYVKWLYTVGKVDKFLDNERNVDVLEMIVTRW 1911

Query: 62   --------------VETSRSEVEPKFFTPESFVNIPNVLQSPSPPSFNSVQQDHPKIALF 107
                          V  SR  ++    TP S      ++   S PS+N +Q    ++   
Sbjct: 1912 KYVMHKRRKKDLPEVAASRGSMDKLVPTPSS-----PIVPISSDPSYNLLQLSETEVGTV 1966

Query: 108  QDETLFYLFYKHPGTVVQEITYLELRKRN 136
             D      F   PG  +QE  Y  L  RN
Sbjct: 1967 ND------FLWSPGD-IQEGLYDSLTHRN 1988

>YIL034C Chr9 complement(289226..290089) [864 bp, 287 aa] {ON}
          CAP2Beta subunit of the capping protein (CP)
          heterodimer (Cap1p and Cap2p) which binds to the barbed
          ends of actin filaments preventing further
          polymerization; localized predominantly to cortical
          actin patches
          Length = 287

 Score = 28.9 bits (63), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 35/86 (40%), Gaps = 10/86 (11%)

Query: 8  LKALLPLIKQETGNAEYDPAMTMGMDLSSML------HSLGIDSNQEY----KTRVLDTF 57
          L+ L P   QE  N   +    +  DL S +           DSN+EY      R +D+F
Sbjct: 13 LRRLNPTTLQENLNNLIELQPNLAQDLLSSVDVPLSTQKDSADSNREYLCCDYNRDIDSF 72

Query: 58 PSPWVETSRSEVEPKFFTPESFVNIP 83
           SPW  T   E+ PK      F + P
Sbjct: 73 RSPWSNTYYPELSPKDLQDSPFPSAP 98

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.135    0.414 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 21,900,395
Number of extensions: 926092
Number of successful extensions: 2592
Number of sequences better than 10.0: 67
Number of HSP's gapped: 2583
Number of HSP's successfully gapped: 68
Length of query: 191
Length of database: 53,481,399
Length adjustment: 103
Effective length of query: 88
Effective length of database: 41,670,801
Effective search space: 3667030488
Effective search space used: 3667030488
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 62 (28.5 bits)