Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0F11286g7.346ON42342321540.0
KLTH0H01342g7.346ON42240517880.0
Kwal_56.246317.346ON42240917570.0
TDEL0C020207.346ON42542617550.0
Skud_12.2667.346ON43640217090.0
Kpol_530.357.346ON42541517060.0
Smik_12.2617.346ON43640216970.0
YLR203C (MSS51)7.346ON43640216900.0
Suva_10.2977.346ON43640216890.0
NCAS0E028807.346ON42941816780.0
ZYRO0F11616g7.346ON41540416710.0
KLLA0D12430g7.346ON41840316670.0
Ecym_47277.346ON42943016540.0
TPHA0F029307.346ON43640416410.0
CAGL0A03927g7.346ON43741916170.0
KNAG0B026307.346ON43841215640.0
NDAI0E044807.346ON44341015580.0
ACL152W7.346ON42841015540.0
TBLA0E005007.346ON43741914770.0
NCAS0A141207.346ON42742414760.0
KAFR0B008407.346ON42640714710.0
NDAI0A019307.346ON45043314680.0
KNAG0C037507.346ON42440214040.0
KLTH0G11418g8.357ON89793790.38
TBLA0D00120singletonON66576722.4
Suva_6.1261.331ON82072704.3
KNAG0K005605.88ON110495679.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0F11286g
         (423 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0F11286g Chr6 (880536..881807) [1272 bp, 423 aa] {ON} simila...   834   0.0  
KLTH0H01342g Chr8 complement(125673..126941) [1269 bp, 422 aa] {...   693   0.0  
Kwal_56.24631 s56 (1080985..1082253) [1269 bp, 422 aa] {ON} YLR2...   681   0.0  
TDEL0C02020 Chr3 complement(349453..350730) [1278 bp, 425 aa] {O...   680   0.0  
Skud_12.266 Chr12 complement(497291..498601) [1311 bp, 436 aa] {...   662   0.0  
Kpol_530.35 s530 complement(83032..84309) [1278 bp, 425 aa] {ON}...   661   0.0  
Smik_12.261 Chr12 complement(497673..498983) [1311 bp, 436 aa] {...   658   0.0  
YLR203C Chr12 complement(550650..551960) [1311 bp, 436 aa] {ON} ...   655   0.0  
Suva_10.297 Chr10 complement(523465..524775) [1311 bp, 436 aa] {...   655   0.0  
NCAS0E02880 Chr5 complement(563006..564295) [1290 bp, 429 aa] {O...   650   0.0  
ZYRO0F11616g Chr6 (953577..954824) [1248 bp, 415 aa] {ON} simila...   648   0.0  
KLLA0D12430g Chr4 complement(1055878..1057134) [1257 bp, 418 aa]...   646   0.0  
Ecym_4727 Chr4 complement(1420885..1422174) [1290 bp, 429 aa] {O...   641   0.0  
TPHA0F02930 Chr6 (647081..648391) [1311 bp, 436 aa] {ON} Anc_7.3...   636   0.0  
CAGL0A03927g Chr1 (397179..398492) [1314 bp, 437 aa] {ON} highly...   627   0.0  
KNAG0B02630 Chr2 complement(508645..509961) [1317 bp, 438 aa] {O...   607   0.0  
NDAI0E04480 Chr5 complement(1007346..1008677) [1332 bp, 443 aa] ...   604   0.0  
ACL152W Chr3 (85701..86987) [1287 bp, 428 aa] {ON} Syntenic homo...   603   0.0  
TBLA0E00500 Chr5 (91769..93082) [1314 bp, 437 aa] {ON} Anc_7.346...   573   0.0  
NCAS0A14120 Chr1 (2777017..2778300) [1284 bp, 427 aa] {ON} Anc_7...   573   0.0  
KAFR0B00840 Chr2 (159480..160760) [1281 bp, 426 aa] {ON} Anc_7.3...   571   0.0  
NDAI0A01930 Chr1 complement(430531..431883) [1353 bp, 450 aa] {O...   570   0.0  
KNAG0C03750 Chr3 (740426..741700) [1275 bp, 424 aa] {ON} Anc_7.3...   545   0.0  
KLTH0G11418g Chr7 (962267..964960) [2694 bp, 897 aa] {ON} simila...    35   0.38 
TBLA0D00120 Chr4 complement(19863..21860) [1998 bp, 665 aa] {ON}       32   2.4  
Suva_6.126 Chr6 complement(209913..212375) [2463 bp, 820 aa] {ON...    32   4.3  
KNAG0K00560 Chr11 complement(96678..99992) [3315 bp, 1104 aa] {O...    30   9.9  

>SAKL0F11286g Chr6 (880536..881807) [1272 bp, 423 aa] {ON} similar
           to uniprot|P32335 Saccharomyces cerevisiae YLR203C MSS51
           Protein required for the maturation and translation of
           COX1 mRNA involved in maturation of COX1 and COB mRNA
          Length = 423

 Score =  834 bits (2154), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/423 (94%), Positives = 398/423 (94%)

Query: 1   MLLSAYKRCSIAPASATRIQKRHIIGFVRNALGLXXXXXXXXXXXXNRFHPWDQSPSPDX 60
           MLLSAYKRCSIAPASATRIQKRHIIGFVRNALGL            NRFHPWDQSPSPD 
Sbjct: 1   MLLSAYKRCSIAPASATRIQKRHIIGFVRNALGLDPPPSPDDPTPDNRFHPWDQSPSPDL 60

Query: 61  XXXXXXXXXXXXCPVTGKEINYTCPQSGIPTHHSREAWEQDTMYHATKKYEILKKVNIYE 120
                       CPVTGKEINYTCPQSGIPTHHSREAWEQDTMYHATKKYEILKKVNIYE
Sbjct: 61  RTRAATIRALARCPVTGKEINYTCPQSGIPTHHSREAWEQDTMYHATKKYEILKKVNIYE 120

Query: 121 HDLRSGRPFPEFDFPQDQDYDRMVNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYPTTV 180
           HDLRSGRPFPEFDFPQDQDYDRMVNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYPTTV
Sbjct: 121 HDLRSGRPFPEFDFPQDQDYDRMVNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYPTTV 180

Query: 181 GSVLHEFSPYALNPKGPITLEGLKSLAALRYTLYPQQHRKVSAATKDRPMRIFILGARAE 240
           GSVLHEFSPYALNPKGPITLEGLKSLAALRYTLYPQQHRKVSAATKDRPMRIFILGARAE
Sbjct: 181 GSVLHEFSPYALNPKGPITLEGLKSLAALRYTLYPQQHRKVSAATKDRPMRIFILGARAE 240

Query: 241 AQLPGHVWKQFQFLFPEINFELHFIGPESFYDREKREYITSSTPIVRRVDETLSFVYHTD 300
           AQLPGHVWKQFQFLFPEINFELHFIGPESFYDREKREYITSSTPIVRRVDETLSFVYHTD
Sbjct: 241 AQLPGHVWKQFQFLFPEINFELHFIGPESFYDREKREYITSSTPIVRRVDETLSFVYHTD 300

Query: 301 YFHVFHEAQDFFPYDPYLDIFFCFHPGFAAPESTEHWMGKTMEGLLETKCAIFTTGFNEQ 360
           YFHVFHEAQDFFPYDPYLDIFFCFHPGFAAPESTEHWMGKTMEGLLETKCAIFTTGFNEQ
Sbjct: 301 YFHVFHEAQDFFPYDPYLDIFFCFHPGFAAPESTEHWMGKTMEGLLETKCAIFTTGFNEQ 360

Query: 361 DLVRDMTAVREKYGNEMDMLMEPVRNLFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHA 420
           DLVRDMTAVREKYGNEMDMLMEPVRNLFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHA
Sbjct: 361 DLVRDMTAVREKYGNEMDMLMEPVRNLFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHA 420

Query: 421 IEV 423
           IEV
Sbjct: 421 IEV 423

>KLTH0H01342g Chr8 complement(125673..126941) [1269 bp, 422 aa] {ON}
           similar to uniprot|P32335 Saccharomyces cerevisiae
           YLR203C MSS51 Protein required for the maturation and
           translation of COX1 mRNA involved in maturation of COX1
           and COB mRNA
          Length = 422

 Score =  693 bits (1788), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/405 (79%), Positives = 352/405 (86%)

Query: 19  IQKRHIIGFVRNALGLXXXXXXXXXXXXNRFHPWDQSPSPDXXXXXXXXXXXXXCPVTGK 78
           +QKRHI+GFVRNALGL            NRFHPWDQSPSPD             CPVTG+
Sbjct: 18  VQKRHIMGFVRNALGLDPPPSPDEPTPENRFHPWDQSPSPDLRERAATIRALAKCPVTGR 77

Query: 79  EINYTCPQSGIPTHHSREAWEQDTMYHATKKYEILKKVNIYEHDLRSGRPFPEFDFPQDQ 138
           EINYTCP+SGIPTH+SREAWE D  Y  +K+ EILKKVNIYEHDLRSGRPFPEFDFP DQ
Sbjct: 78  EINYTCPKSGIPTHYSREAWENDLEYQQSKRPEILKKVNIYEHDLRSGRPFPEFDFPLDQ 137

Query: 139 DYDRMVNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYPTTVGSVLHEFSPYALNPKGPI 198
           D+DRMVN+TNWDLFFYTR FYSMDTEFQLAAVTKMLSYP T+GSVLH+FSPY+LNPKGP+
Sbjct: 138 DFDRMVNLTNWDLFFYTRGFYSMDTEFQLAAVTKMLSYPVTIGSVLHQFSPYSLNPKGPV 197

Query: 199 TLEGLKSLAALRYTLYPQQHRKVSAATKDRPMRIFILGARAEAQLPGHVWKQFQFLFPEI 258
           TLEGLKSLAALRYTLYP+Q+R+V++ TK+ P+RIFILGARAEAQLPGHVWKQ QF+FPE 
Sbjct: 198 TLEGLKSLAALRYTLYPEQNRRVTSITKNSPLRIFILGARAEAQLPGHVWKQLQFMFPET 257

Query: 259 NFELHFIGPESFYDREKREYITSSTPIVRRVDETLSFVYHTDYFHVFHEAQDFFPYDPYL 318
           N ELHF+GPES+YDR KREY+ SS+PIVRRVDETLSFVYHTDYFHVFHEAQDFFPYDPY 
Sbjct: 258 NIELHFVGPESYYDRNKREYVHSSSPIVRRVDETLSFVYHTDYFHVFHEAQDFFPYDPYT 317

Query: 319 DIFFCFHPGFAAPESTEHWMGKTMEGLLETKCAIFTTGFNEQDLVRDMTAVREKYGNEMD 378
           DIFFCFHPGFAAPES E+WMGKTME LLETKCA+FTTGFNE DL RD+  V  K+G E+D
Sbjct: 318 DIFFCFHPGFAAPESRENWMGKTMEALLETKCAVFTTGFNELDLRRDVGTVVGKHGKELD 377

Query: 379 MLMEPVRNLFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHAIEV 423
           MLMEPV N FGSTKWELNDMNPQEVYQFNM+IAGFRGKRYHAIEV
Sbjct: 378 MLMEPVHNAFGSTKWELNDMNPQEVYQFNMFIAGFRGKRYHAIEV 422

>Kwal_56.24631 s56 (1080985..1082253) [1269 bp, 422 aa] {ON} YLR203C
           (MSS51) - involved in maturation of COX1 and COB mRNA
           [contig 161] FULL
          Length = 422

 Score =  681 bits (1757), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/409 (76%), Positives = 351/409 (85%)

Query: 15  SATRIQKRHIIGFVRNALGLXXXXXXXXXXXXNRFHPWDQSPSPDXXXXXXXXXXXXXCP 74
           S   +QKRHI+GFVRNALGL            NRFHPWDQSPSPD             CP
Sbjct: 14  SHCSLQKRHIMGFVRNALGLDPPPSPDEPTPENRFHPWDQSPSPDLRERAATIRALAKCP 73

Query: 75  VTGKEINYTCPQSGIPTHHSREAWEQDTMYHATKKYEILKKVNIYEHDLRSGRPFPEFDF 134
           VTG+EINYTCP+SGIPTHHSREAWE+D  Y  +K+ EILKKVNIYEHDLRSGRPFPEFDF
Sbjct: 74  VTGREINYTCPKSGIPTHHSREAWEKDLDYQQSKRPEILKKVNIYEHDLRSGRPFPEFDF 133

Query: 135 PQDQDYDRMVNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYPTTVGSVLHEFSPYALNP 194
           P DQD+DRMVN+TNWDLFFYTR F+SMDTEFQLAAVTKMLSYP T+GSVLH+FSPY+LNP
Sbjct: 134 PLDQDFDRMVNLTNWDLFFYTRGFFSMDTEFQLAAVTKMLSYPITIGSVLHQFSPYSLNP 193

Query: 195 KGPITLEGLKSLAALRYTLYPQQHRKVSAATKDRPMRIFILGARAEAQLPGHVWKQFQFL 254
           KGPITLEGLKSLAALRYTLYP Q+R+V++  K+ P+RIF+LGARAEAQLPGHVWKQ QF+
Sbjct: 194 KGPITLEGLKSLAALRYTLYPDQNRRVTSIAKNSPLRIFVLGARAEAQLPGHVWKQLQFM 253

Query: 255 FPEINFELHFIGPESFYDREKREYITSSTPIVRRVDETLSFVYHTDYFHVFHEAQDFFPY 314
           FPE   E+HF+GPES+YDR KREY+ S+ PI+RRVDETL+FVYHTDYFHVFHEAQDFFPY
Sbjct: 254 FPETQMEIHFVGPESYYDRNKREYVHSAAPIIRRVDETLNFVYHTDYFHVFHEAQDFFPY 313

Query: 315 DPYLDIFFCFHPGFAAPESTEHWMGKTMEGLLETKCAIFTTGFNEQDLVRDMTAVREKYG 374
           DPY DIFFCFHPGFAAPES E+WMGKTME LLETKCAIFTTGFNE DL RD+ AV  +YG
Sbjct: 314 DPYTDIFFCFHPGFAAPESRENWMGKTMEALLETKCAIFTTGFNEVDLQRDLDAVVAEYG 373

Query: 375 NEMDMLMEPVRNLFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHAIEV 423
            E+D++M+P +N FGSTKWELND+NPQEVYQFNM++AGFRGKRYHAIEV
Sbjct: 374 KELDIIMDPAKNAFGSTKWELNDVNPQEVYQFNMFMAGFRGKRYHAIEV 422

>TDEL0C02020 Chr3 complement(349453..350730) [1278 bp, 425 aa] {ON}
           Anc_7.346 YLR203C
          Length = 425

 Score =  680 bits (1755), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/426 (74%), Positives = 360/426 (84%), Gaps = 4/426 (0%)

Query: 1   MLLSAYKRC-SIAPASATRI--QKRHIIGFVRNALGLXXXXXXXXXXXXNRFHPWDQSPS 57
           M+LSA  R  S+      ++  Q+R IIGFVRNALGL            NRFHPWDQSP 
Sbjct: 1   MMLSATSRFPSLRAQRCGKVFNQRRFIIGFVRNALGLDPPPSPDDPTPENRFHPWDQSPV 60

Query: 58  PDXXXXXXXXXXXXXCPVTGKEINYTCPQSGIPTHHSREAWEQDTMYHATKKYEILKKVN 117
            D             CPVTGKEINYTCP SGIPTHHSREAWEQD  YH +KKYEILKKVN
Sbjct: 61  GDLRERAARIRTLARCPVTGKEINYTCPLSGIPTHHSREAWEQDKQYHQSKKYEILKKVN 120

Query: 118 IYEHDLRSGRPFPEFDFPQDQDYDRMVNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYP 177
           IYEHDLRSGRPFPEFDFPQ QD+DR VNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYP
Sbjct: 121 IYEHDLRSGRPFPEFDFPQGQDFDRTVNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYP 180

Query: 178 TTVGSVLHEFSPYALNPKGPITLEGLKSLAALRYTLYPQQHRKVSAATKDRPMRIFILGA 237
            ++ SVLH+FSPY+LNPKGP+TLEGLKSLAALRYTLYP +++ +S+ TKDRPMRIFILGA
Sbjct: 181 ISIASVLHQFSPYSLNPKGPVTLEGLKSLAALRYTLYPLENKTISS-TKDRPMRIFILGA 239

Query: 238 RAEAQLPGHVWKQFQFLFPEINFELHFIGPESFYDREKREYITSSTPIVRRVDETLSFVY 297
           RAEAQLPGHVWKQ Q+LFPE  FELHF+GPE   ++EK +Y+TSSTP+V+RVDET+SFVY
Sbjct: 240 RAEAQLPGHVWKQLQYLFPEQMFELHFVGPECLLNKEKHQYVTSSTPVVKRVDETISFVY 299

Query: 298 HTDYFHVFHEAQDFFPYDPYLDIFFCFHPGFAAPESTEHWMGKTMEGLLETKCAIFTTGF 357
           HTD+FHV HEAQDFFPYDPYLD+FFCFHPGF APE++  W+ +TM+GLLETKCAIFTTGF
Sbjct: 300 HTDFFHVLHEAQDFFPYDPYLDVFFCFHPGFGAPETSASWLNETMKGLLETKCAIFTTGF 359

Query: 358 NEQDLVRDMTAVREKYGNEMDMLMEPVRNLFGSTKWELNDMNPQEVYQFNMYIAGFRGKR 417
           N+ DL+RD+ AV++KYG E+D+LMEPV+N+FGSTKWELNDMNPQEVYQFNMYIAGFRGKR
Sbjct: 360 NKADLLRDVDAVKDKYGKEVDVLMEPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKR 419

Query: 418 YHAIEV 423
           YHAIEV
Sbjct: 420 YHAIEV 425

>Skud_12.266 Chr12 complement(497291..498601) [1311 bp, 436 aa] {ON}
           YLR203C (REAL)
          Length = 436

 Score =  662 bits (1709), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/402 (75%), Positives = 342/402 (85%)

Query: 21  KRHIIGFVRNALGLXXXXXXXXXXXXNRFHPWDQSPSPDXXXXXXXXXXXXXCPVTGKEI 80
           +RH++GFVRNALGL            NRFHPWDQSPS D             CPVTGK+I
Sbjct: 33  RRHLMGFVRNALGLDPPPSPDDPTPENRFHPWDQSPSVDLRERAAKIRTLAHCPVTGKDI 92

Query: 81  NYTCPQSGIPTHHSREAWEQDTMYHATKKYEILKKVNIYEHDLRSGRPFPEFDFPQDQDY 140
           NYTCP SGIPTHHSREAWE D  YH +KKYEILKKVNIYEHDLRSGRPFPEFDFPQ Q Y
Sbjct: 93  NYTCPLSGIPTHHSREAWEMDKTYHDSKKYEILKKVNIYEHDLRSGRPFPEFDFPQQQGY 152

Query: 141 DRMVNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYPTTVGSVLHEFSPYALNPKGPITL 200
           D+ VN+TNWDLFFYTR FYSMDTEFQLAAVTKMLSYP T+GSVLH+FSPY+LNPKGPITL
Sbjct: 153 DKAVNLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSVLHKFSPYSLNPKGPITL 212

Query: 201 EGLKSLAALRYTLYPQQHRKVSAATKDRPMRIFILGARAEAQLPGHVWKQFQFLFPEINF 260
           EGLKSLAALRYTLYP ++R V A TK+R MRIFILGARAEAQLPGHVWKQ QFLFPE NF
Sbjct: 213 EGLKSLAALRYTLYPLENRSVLATTKNRAMRIFILGARAEAQLPGHVWKQLQFLFPEQNF 272

Query: 261 ELHFIGPESFYDREKREYITSSTPIVRRVDETLSFVYHTDYFHVFHEAQDFFPYDPYLDI 320
           E+HF+GPE  Y R+K+EY+ S+TP+V+RVDETL F++HTD+F VFHEAQDFFPYDPY+D+
Sbjct: 273 EIHFVGPECLYKRDKQEYVKSATPVVQRVDETLRFIHHTDFFDVFHEAQDFFPYDPYMDV 332

Query: 321 FFCFHPGFAAPESTEHWMGKTMEGLLETKCAIFTTGFNEQDLVRDMTAVREKYGNEMDML 380
           FF FHPG+A+PES   WMG+TM  LLETKCAIFTTGFN++DL+ D+ AV+ KYG EMD+L
Sbjct: 333 FFTFHPGYASPESHGSWMGETMRALLETKCAIFTTGFNKKDLMDDINAVKSKYGKEMDIL 392

Query: 381 MEPVRNLFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHAIE 422
           M+PVRN+FGSTKWELNDMNPQEVYQFNMYIAGFRGKRYH I+
Sbjct: 393 MDPVRNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHTIK 434

>Kpol_530.35 s530 complement(83032..84309) [1278 bp, 425 aa] {ON}
           complement(83032..84309) [1278 nt, 426 aa]
          Length = 425

 Score =  661 bits (1706), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/415 (73%), Positives = 350/415 (84%), Gaps = 2/415 (0%)

Query: 11  IAPASATRIQKRHIIGFVRNALGLXXXXXXXXXXXXNRFHPWDQSPSPDXXXXXXXXXXX 70
           +   S + IQKR ++GFVRNALGL            NRFHPWDQSP  D           
Sbjct: 11  LGAGSYSLIQKRSLMGFVRNALGLDPPPSPDDPTPENRFHPWDQSPCVDLRERAAKIRTL 70

Query: 71  XXCPVTGKEINYTCPQSGIPTHHSREAWEQDTMYHATKKYEILKKVNIYEHDLRSGRPFP 130
             CPVT K+INYTCP SGIPTHH +EAW  D  YH +K+YEILKKVNIYEHDLRSGRPFP
Sbjct: 71  AKCPVTHKDINYTCPLSGIPTHHDKEAWLMDKDYHESKRYEILKKVNIYEHDLRSGRPFP 130

Query: 131 EFDFPQDQDYDRMVNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYPTTVGSVLHEFSPY 190
           EFDFPQDQDYDR++N+TNWDLFFYTR FYSMDTEFQLAAVTKMLSYP T+GS+LH+FSPY
Sbjct: 131 EFDFPQDQDYDRLINLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLHQFSPY 190

Query: 191 ALNPKGPITLEGLKSLAALRYTLYPQQHR--KVSAATKDRPMRIFILGARAEAQLPGHVW 248
           +LNPKGP+TLEGLKSLAALRYTLYP Q++   V   T+DRPMRIFILGARAEAQLPGHVW
Sbjct: 191 SLNPKGPVTLEGLKSLAALRYTLYPYQNKSQNVKVNTRDRPMRIFILGARAEAQLPGHVW 250

Query: 249 KQFQFLFPEINFELHFIGPESFYDREKREYITSSTPIVRRVDETLSFVYHTDYFHVFHEA 308
           KQFQ+LFPE  FE+HFIGPE + ++EK +YITSSTPIV++VD+TL  V+H DYFHVFHEA
Sbjct: 251 KQFQYLFPEQEFEIHFIGPECYLNKEKNQYITSSTPIVKKVDDTLKLVFHPDYFHVFHEA 310

Query: 309 QDFFPYDPYLDIFFCFHPGFAAPESTEHWMGKTMEGLLETKCAIFTTGFNEQDLVRDMTA 368
           QDFFPYDP+LD+FF FHPG+A PE+TE W+G+TM+ LL+TKCAIFTTGF++QDL+RD+  
Sbjct: 311 QDFFPYDPFLDVFFTFHPGYAYPETTEIWLGETMKALLDTKCAIFTTGFSKQDLLRDIDV 370

Query: 369 VREKYGNEMDMLMEPVRNLFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHAIEV 423
           V+ +YGNE+DMLM+PV+N+FGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHAIEV
Sbjct: 371 VKNRYGNELDMLMDPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHAIEV 425

>Smik_12.261 Chr12 complement(497673..498983) [1311 bp, 436 aa] {ON}
           YLR203C (REAL)
          Length = 436

 Score =  658 bits (1697), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/402 (74%), Positives = 341/402 (84%)

Query: 21  KRHIIGFVRNALGLXXXXXXXXXXXXNRFHPWDQSPSPDXXXXXXXXXXXXXCPVTGKEI 80
           +RH++GFVRNALGL            NRFHPWDQSPS D             CPVTGK+I
Sbjct: 33  RRHLMGFVRNALGLDPPPSPDDPTPENRFHPWDQSPSVDLRERAAKIRTLAHCPVTGKDI 92

Query: 81  NYTCPQSGIPTHHSREAWEQDTMYHATKKYEILKKVNIYEHDLRSGRPFPEFDFPQDQDY 140
           NYTCP SGIPTHHSREAWE D  YH +KKYEILKKVNIYEHDLRSGRPFPEFDFPQ+Q Y
Sbjct: 93  NYTCPLSGIPTHHSREAWEMDKAYHDSKKYEILKKVNIYEHDLRSGRPFPEFDFPQNQGY 152

Query: 141 DRMVNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYPTTVGSVLHEFSPYALNPKGPITL 200
           D+ VN+TNWDLFFYTR FYSMDTEFQLAAVTKMLSYP T+GS+LH+FSPY+LNPKGPITL
Sbjct: 153 DKAVNLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLHKFSPYSLNPKGPITL 212

Query: 201 EGLKSLAALRYTLYPQQHRKVSAATKDRPMRIFILGARAEAQLPGHVWKQFQFLFPEINF 260
           EGLKSLAALRYTLYP ++R +  ATK+R MRIFILGARAEAQLPGHVWKQ QFLFPE NF
Sbjct: 213 EGLKSLAALRYTLYPLENRSLLTATKNRAMRIFILGARAEAQLPGHVWKQLQFLFPEQNF 272

Query: 261 ELHFIGPESFYDREKREYITSSTPIVRRVDETLSFVYHTDYFHVFHEAQDFFPYDPYLDI 320
           E+HFIGPE  Y R+K+EY+ S+TP+V+RVDETL F++ TD+F VFHEAQDFFPYDPY+D+
Sbjct: 273 EIHFIGPECLYKRDKQEYVKSTTPVVQRVDETLKFIHRTDFFEVFHEAQDFFPYDPYMDV 332

Query: 321 FFCFHPGFAAPESTEHWMGKTMEGLLETKCAIFTTGFNEQDLVRDMTAVREKYGNEMDML 380
           FF FHPG+A+PES   WMG+TM+ LLETKCAIFTTGFN++DL  D+  V+ KYG EMD+L
Sbjct: 333 FFTFHPGYASPESHGSWMGETMKALLETKCAIFTTGFNKKDLTDDLNLVKSKYGKEMDIL 392

Query: 381 MEPVRNLFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHAIE 422
           M+PV+N+FGSTKWELNDMNPQEVYQFNMYIAGFRGKRYH I+
Sbjct: 393 MDPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHTIK 434

>YLR203C Chr12 complement(550650..551960) [1311 bp, 436 aa] {ON}
           MSS51Specific translational activator for the
           mitochondrial COX1 mRNA; loosely associated with the
           matrix face of the mitochondrial inner membrane;
           influences both COX1 mRNA translation and Cox1p assembly
           into cytochrome c oxidase
          Length = 436

 Score =  655 bits (1690), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/402 (74%), Positives = 339/402 (84%)

Query: 21  KRHIIGFVRNALGLXXXXXXXXXXXXNRFHPWDQSPSPDXXXXXXXXXXXXXCPVTGKEI 80
           +RH++GFVRNALGL            NRFHPWDQSPS D             CPVTGK+I
Sbjct: 33  RRHLMGFVRNALGLDPPPSPEDPTPENRFHPWDQSPSVDLRERAAKIRTLAHCPVTGKDI 92

Query: 81  NYTCPQSGIPTHHSREAWEQDTMYHATKKYEILKKVNIYEHDLRSGRPFPEFDFPQDQDY 140
           NYTCP SGIPTHHSREAWE D  YH +KKYEILKKVNIYEHDLRSGRPFPEFDFPQ Q Y
Sbjct: 93  NYTCPLSGIPTHHSREAWEMDKAYHDSKKYEILKKVNIYEHDLRSGRPFPEFDFPQQQGY 152

Query: 141 DRMVNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYPTTVGSVLHEFSPYALNPKGPITL 200
           D+ VN+TNWDLFFYTR FYSMDTEFQLAAVTKMLSYP T+GS+LH+FSPY+LNPKGPITL
Sbjct: 153 DKAVNLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLHKFSPYSLNPKGPITL 212

Query: 201 EGLKSLAALRYTLYPQQHRKVSAATKDRPMRIFILGARAEAQLPGHVWKQFQFLFPEINF 260
           EGLKSLAALRYTLYP ++R +   TK+R MRIFILGARAEAQLPGHVWKQ QFLFPE +F
Sbjct: 213 EGLKSLAALRYTLYPLENRSLPTTTKNRAMRIFILGARAEAQLPGHVWKQLQFLFPEQSF 272

Query: 261 ELHFIGPESFYDREKREYITSSTPIVRRVDETLSFVYHTDYFHVFHEAQDFFPYDPYLDI 320
           E+HFIGPE  Y R+K+EY+ S+TP+V+RVDETL F+Y T++F VFHEAQDFFPYDPY+D+
Sbjct: 273 EIHFIGPECLYKRDKQEYVKSTTPVVQRVDETLKFIYRTNFFEVFHEAQDFFPYDPYMDV 332

Query: 321 FFCFHPGFAAPESTEHWMGKTMEGLLETKCAIFTTGFNEQDLVRDMTAVREKYGNEMDML 380
           FF FHPG+A+PES   WMG+TM+ LLETKCAIFTTGFN++DL  D+  V+ KYG EMD+L
Sbjct: 333 FFTFHPGYASPESHGSWMGETMKALLETKCAIFTTGFNKKDLTDDINLVKSKYGKEMDVL 392

Query: 381 MEPVRNLFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHAIE 422
           MEPVRN+FGSTKWELNDMNPQEVYQFNMYIAGFRGKRYH I+
Sbjct: 393 MEPVRNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHTIK 434

>Suva_10.297 Chr10 complement(523465..524775) [1311 bp, 436 aa] {ON}
           YLR203C (REAL)
          Length = 436

 Score =  655 bits (1689), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/402 (74%), Positives = 339/402 (84%)

Query: 21  KRHIIGFVRNALGLXXXXXXXXXXXXNRFHPWDQSPSPDXXXXXXXXXXXXXCPVTGKEI 80
           +RH++GFVRNALGL            NRFHPWDQSPS D             CPVTGK+I
Sbjct: 33  RRHLMGFVRNALGLDPPPSPDDPTPENRFHPWDQSPSVDLRERAAKIRTLAHCPVTGKDI 92

Query: 81  NYTCPQSGIPTHHSREAWEQDTMYHATKKYEILKKVNIYEHDLRSGRPFPEFDFPQDQDY 140
           NYTCP SGIPTHHSREAWE D  YH +KKYEILKKVNIYEHDLRSGRPFPEFDFPQ Q Y
Sbjct: 93  NYTCPLSGIPTHHSREAWEMDKAYHDSKKYEILKKVNIYEHDLRSGRPFPEFDFPQQQGY 152

Query: 141 DRMVNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYPTTVGSVLHEFSPYALNPKGPITL 200
           D+ VN+TNWDLF YTR FYSMDTEFQLAAVTKMLSYP T+GS+LH+FSPY+LNPKGPITL
Sbjct: 153 DKAVNLTNWDLFLYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLHKFSPYSLNPKGPITL 212

Query: 201 EGLKSLAALRYTLYPQQHRKVSAATKDRPMRIFILGARAEAQLPGHVWKQFQFLFPEINF 260
           EGLKSLAALRYTLYP ++R V A T++R MRIFILGARAEAQLPGHVWKQ QFLFPE NF
Sbjct: 213 EGLKSLAALRYTLYPLENRSVLATTRNRAMRIFILGARAEAQLPGHVWKQLQFLFPEQNF 272

Query: 261 ELHFIGPESFYDREKREYITSSTPIVRRVDETLSFVYHTDYFHVFHEAQDFFPYDPYLDI 320
           E+HFIGPE  Y R+K+EY+ S+TP+V+R+DETL F +HTD+F VFHEAQDFFPYDPY+D+
Sbjct: 273 EIHFIGPECLYKRDKQEYVKSATPVVQRIDETLKFFHHTDFFQVFHEAQDFFPYDPYMDV 332

Query: 321 FFCFHPGFAAPESTEHWMGKTMEGLLETKCAIFTTGFNEQDLVRDMTAVREKYGNEMDML 380
           FF FHPG+A+PES   WMG+TM  LLETKCAIFTTGFN++DL+ D+  V+ KYG EMD+L
Sbjct: 333 FFTFHPGYASPESHGSWMGETMTALLETKCAIFTTGFNKKDLMDDINLVKSKYGKEMDIL 392

Query: 381 MEPVRNLFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHAIE 422
           M+PV+N+FGSTKWELNDMNPQEVYQFNMYIAGFRGKRYH I+
Sbjct: 393 MDPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHTIK 434

>NCAS0E02880 Chr5 complement(563006..564295) [1290 bp, 429 aa] {ON}
           Anc_7.346 YLR203C
          Length = 429

 Score =  650 bits (1678), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/418 (71%), Positives = 343/418 (82%), Gaps = 3/418 (0%)

Query: 8   RCSIAPASATRI---QKRHIIGFVRNALGLXXXXXXXXXXXXNRFHPWDQSPSPDXXXXX 64
           R ++ P +A  +   Q RH++GFVRNALGL            NRFHPWDQSPSPD     
Sbjct: 11  RTTLLPRNAFNVAGNQTRHLMGFVRNALGLDPPTSPDDPTPENRFHPWDQSPSPDLRERA 70

Query: 65  XXXXXXXXCPVTGKEINYTCPQSGIPTHHSREAWEQDTMYHATKKYEILKKVNIYEHDLR 124
                   CPVTGKEINYTCP SGIPTHHSREAWEQD  YHA+K+YE+LKKVNIYEHDLR
Sbjct: 71  ARIRTLARCPVTGKEINYTCPISGIPTHHSREAWEQDKEYHASKRYELLKKVNIYEHDLR 130

Query: 125 SGRPFPEFDFPQDQDYDRMVNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYPTTVGSVL 184
           SGRPFPEFDFP+DQ  DRMVNMTNWDLF YTR FYSMDTEFQ+AAVTKMLSYP T+GSVL
Sbjct: 131 SGRPFPEFDFPRDQGQDRMVNMTNWDLFLYTRAFYSMDTEFQMAAVTKMLSYPITIGSVL 190

Query: 185 HEFSPYALNPKGPITLEGLKSLAALRYTLYPQQHRKVSAATKDRPMRIFILGARAEAQLP 244
           H+FSPY+L PKGPI+LEGLKSLAALRYTLYP Q+R V + TK RPMRIFILGARAE+QLP
Sbjct: 191 HQFSPYSLQPKGPISLEGLKSLAALRYTLYPMQNRLVISTTKARPMRIFILGARAESQLP 250

Query: 245 GHVWKQFQFLFPEINFELHFIGPESFYDREKREYITSSTPIVRRVDETLSFVYHTDYFHV 304
           GHVWKQ Q+LFPE  FE+HFIGPES+YD++K++YI  +TPI   VDETL  +YHT+YFH 
Sbjct: 251 GHVWKQLQYLFPEQTFEIHFIGPESYYDKDKKKYIQLTTPITESVDETLKLIYHTEYFHK 310

Query: 305 FHEAQDFFPYDPYLDIFFCFHPGFAAPESTEHWMGKTMEGLLETKCAIFTTGFNEQDLVR 364
            HEAQDFFPYDPY+D+FF FHPGFA+ E  EHWM  TM+GLL+TKCAIFTTGF + DL+ 
Sbjct: 311 LHEAQDFFPYDPYMDVFFIFHPGFASAEIGEHWMKDTMKGLLDTKCAIFTTGFTKNDLLE 370

Query: 365 DMTAVREKYGNEMDMLMEPVRNLFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHAIE 422
           D+  V++KYG E+D+LM+P +N+FGSTKWELNDMNPQEVYQFNMYIAGFRGKRY  I+
Sbjct: 371 DIAVVQDKYGKELDILMKPTKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYPTIK 428

>ZYRO0F11616g Chr6 (953577..954824) [1248 bp, 415 aa] {ON} similar
           to uniprot|P32335 Saccharomyces cerevisiae YLR203C MSS51
           Protein required for the maturation and translation of
           COX1 mRNA involved in maturation of COX1 and COB mRNA
          Length = 415

 Score =  648 bits (1671), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/404 (74%), Positives = 341/404 (84%), Gaps = 1/404 (0%)

Query: 20  QKRHIIGFVRNALGLXXXXXXXXXXXXNRFHPWDQSPSPDXXXXXXXXXXXXXCPVTGKE 79
           Q+R IIGFVRNALGL            NRFH WDQSP+ D             CPVTGKE
Sbjct: 13  QRRTIIGFVRNALGLDPPPSPDDPTPENRFHLWDQSPAGDLRERAARIRALAQCPVTGKE 72

Query: 80  INYTCPQSGIPTHHSREAWEQDTMYHATKKYEILKKVNIYEHDLRSGRPFPEFDFPQDQD 139
           INYTCP SGIPTHHS+EAWEQD  YH +KK+E+LKKVNIYEHDLRSGRPFPEFDFPQD +
Sbjct: 73  INYTCPLSGIPTHHSKEAWEQDKKYHESKKWELLKKVNIYEHDLRSGRPFPEFDFPQDLE 132

Query: 140 YDRMVNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYPTTVGSVLHEFSPYALNPKGPIT 199
           +DR VNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYP T+ SVL++FSPY+LNPKGPIT
Sbjct: 133 FDRTVNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYPITIASVLNQFSPYSLNPKGPIT 192

Query: 200 LEGLKSLAALRYTLYPQQHRKVSAATKDRPMRIFILGARAEAQLPGHVWKQFQFLFPEIN 259
           LEGLKSLAALRYTLYP +++ V AATKDRPMR+FILGARAEA LPGHVWKQ QFLFPE  
Sbjct: 193 LEGLKSLAALRYTLYPFENKTV-AATKDRPMRLFILGARAEALLPGHVWKQLQFLFPETA 251

Query: 260 FELHFIGPESFYDREKREYITSSTPIVRRVDETLSFVYHTDYFHVFHEAQDFFPYDPYLD 319
           FELHFIGPE   ++EK +Y++S  P+V+R+DETLSFVYHTDYFHV+H+AQDFFPYDPYLD
Sbjct: 252 FELHFIGPECLVNKEKHQYVSSPAPVVKRIDETLSFVYHTDYFHVYHDAQDFFPYDPYLD 311

Query: 320 IFFCFHPGFAAPESTEHWMGKTMEGLLETKCAIFTTGFNEQDLVRDMTAVREKYGNEMDM 379
            FFCFHPGF APEST+ W+ KT+ GLLETKCAIF TG N+  L+RD+ AV +K+  E+D+
Sbjct: 312 AFFCFHPGFGAPESTKLWLEKTIPGLLETKCAIFATGVNKSALLRDINAVMDKHSKEIDI 371

Query: 380 LMEPVRNLFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHAIEV 423
           LMEP +N++GSTKWELND+NPQEVYQFNMYIAGFRGKRYHAIE+
Sbjct: 372 LMEPTKNIYGSTKWELNDVNPQEVYQFNMYIAGFRGKRYHAIEI 415

>KLLA0D12430g Chr4 complement(1055878..1057134) [1257 bp, 418 aa]
           {ON} similar to uniprot|P32335 Saccharomyces cerevisiae
           YLR203C MSS51 Protein required for the maturation and
           translation of COX1 mRNA involved in maturation of COX1
           and COB mRNA
          Length = 418

 Score =  646 bits (1667), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/403 (73%), Positives = 342/403 (84%), Gaps = 2/403 (0%)

Query: 22  RHIIGFVRNALGLXXXXXXXXXXXXNRFHPWDQSPSPDXXXXXXXXXXXXXCPVTGKEIN 81
           R I+GFVRNALGL            NRFHPWDQSPSPD             CPVT K+I 
Sbjct: 17  RPIMGFVRNALGLDPPASPDDPTPENRFHPWDQSPSPDLRERAARIKAMATCPVTHKDIQ 76

Query: 82  YTCPQSGIPTHHSREAWEQDTMYHATKKYEILKKVNIYEHDLRSGRPFPEFDFPQDQDYD 141
           +TCP SGIPTHHSREAWE+DT YH +K+YE+LKKVNIYEHDLRSGRPFPEFDFPQDQDYD
Sbjct: 77  FTCPLSGIPTHHSREAWEKDTEYHKSKRYELLKKVNIYEHDLRSGRPFPEFDFPQDQDYD 136

Query: 142 RMVNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYPTTVGSVLHEFSPYALNPKGPITLE 201
           RMVNM+NWDLFFYTR FYSMDTEFQLAAVTKMLSYP T+GSVLH++SPY+LNPKGPITLE
Sbjct: 137 RMVNMSNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSVLHQYSPYSLNPKGPITLE 196

Query: 202 GLKSLAALRYTLYPQQHRKVSAATKDRPMRIFILGARAEAQLPGHVWKQFQFLFPEINFE 261
           GLKSLAALRYTLYP+Q  +  A  +D P+RIFILG RAEAQLPGHVWKQ Q+L P+ + E
Sbjct: 197 GLKSLAALRYTLYPEQSGRFRAG-QDTPIRIFILGTRAEAQLPGHVWKQLQYLIPDTSIE 255

Query: 262 LHFIGPESFYDREKREYITSST-PIVRRVDETLSFVYHTDYFHVFHEAQDFFPYDPYLDI 320
           LHF+GPESFYDREKR Y+ SST  IV+R+DE +   YHTD+FHVFHEAQDFFPYDPY D+
Sbjct: 256 LHFVGPESFYDREKRSYVQSSTETIVKRIDEKMQLFYHTDFFHVFHEAQDFFPYDPYNDV 315

Query: 321 FFCFHPGFAAPESTEHWMGKTMEGLLETKCAIFTTGFNEQDLVRDMTAVREKYGNEMDML 380
           FFCFHPGFAAPE+ E+WMG TM+ L++TKCA+FTTGF+++DL+RD++ V++KYG+E+DML
Sbjct: 316 FFCFHPGFAAPETEEYWMGDTMKALMQTKCAVFTTGFSKEDLLRDISIVQDKYGSELDML 375

Query: 381 MEPVRNLFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHAIEV 423
           MEPV N+FGSTKWELND NP EVYQFNMYIAGFRGKRYHAIE+
Sbjct: 376 MEPVPNVFGSTKWELNDTNPHEVYQFNMYIAGFRGKRYHAIEL 418

>Ecym_4727 Chr4 complement(1420885..1422174) [1290 bp, 429 aa] {ON}
           similar to Ashbya gossypii ACL152W
          Length = 429

 Score =  641 bits (1654), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/430 (68%), Positives = 352/430 (81%), Gaps = 8/430 (1%)

Query: 1   MLLSAYKRCS---IAPASATRI----QKRHIIGFVRNALGLXXXXXXXXXXXXNRFHPWD 53
           MLL   KR        +S++R+    Q+R I+GFVRNALGL            NRFHPWD
Sbjct: 1   MLLPVTKRLGRPGFISSSSSRVCGKQQRRQIMGFVRNALGLDPPTSPDEPTVDNRFHPWD 60

Query: 54  QSPSPDXXXXXXXXXXXXXCPVTGKEINYTCPQSGIPTHHSREAWEQDTMYHATKKYEIL 113
           QSPSP+             CPVTGK I ++C  SGIPTHHS EAW+ D+ YH +K+Y +L
Sbjct: 61  QSPSPELRERAARIKALAKCPVTGKNIQFSCKYSGIPTHHSEEAWKNDSEYHESKRYRLL 120

Query: 114 KKVNIYEHDLRSGRPFPEFDFPQDQDYDRMVNMTNWDLFFYTRQFYSMDTEFQLAAVTKM 173
           KKVNIYEHDLRSGRPF EFDFP+ QDYDRMVNM NWDL+FYTR F+SMDTEFQLAAVTKM
Sbjct: 121 KKVNIYEHDLRSGRPFLEFDFPEQQDYDRMVNMMNWDLYFYTRSFFSMDTEFQLAAVTKM 180

Query: 174 LSYPTTVGSVLHEFSPYALNPKGPITLEGLKSLAALRYTLYPQQHRKVSAATKDRPMRIF 233
           LSYP T+GS+LH++SPY+LNPKGPITLEGLKSLAALRYTLYP+Q+R+V +  +D+P+R+F
Sbjct: 181 LSYPITIGSILHQYSPYSLNPKGPITLEGLKSLAALRYTLYPEQNRRVRS-IQDKPLRVF 239

Query: 234 ILGARAEAQLPGHVWKQFQFLFPEINFELHFIGPESFYDREKREYITSSTPIVRRVDETL 293
           ILGARAEAQLPGHVWKQ Q+LFPE   ELHF+GPES YDREKREY+TSS P+V+R+D+T+
Sbjct: 240 ILGARAEAQLPGHVWKQLQYLFPESLIELHFVGPESNYDREKREYVTSSIPVVKRIDDTM 299

Query: 294 SFVYHTDYFHVFHEAQDFFPYDPYLDIFFCFHPGFAAPESTEHWMGKTMEGLLETKCAIF 353
              YHTDYFHVFHEAQDFFPYDPY DIFFCFHPGF +PE+ + WM  T++ LL+TKCAIF
Sbjct: 300 KMHYHTDYFHVFHEAQDFFPYDPYNDIFFCFHPGFGSPETRDTWMNSTLQALLQTKCAIF 359

Query: 354 TTGFNEQDLVRDMTAVREKYGNEMDMLMEPVRNLFGSTKWELNDMNPQEVYQFNMYIAGF 413
           TTGFN++DL+ D+ AV+EKYG+E+DML++P +N+FGSTKWELND+NP EVYQFNMYIAGF
Sbjct: 360 TTGFNKKDLMDDLQAVKEKYGDELDMLVDPTKNVFGSTKWELNDLNPHEVYQFNMYIAGF 419

Query: 414 RGKRYHAIEV 423
           RGKRYHAIE+
Sbjct: 420 RGKRYHAIEL 429

>TPHA0F02930 Chr6 (647081..648391) [1311 bp, 436 aa] {ON} Anc_7.346
           YLR203C
          Length = 436

 Score =  636 bits (1641), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/404 (71%), Positives = 333/404 (82%), Gaps = 1/404 (0%)

Query: 20  QKRHIIGFVRNALGLXXXXXXXXXXXXNRFHPWDQSPSPDXXXXXXXXXXXXXCPVTGKE 79
           QKR ++GFV+NALGL            NRFHPWDQSPSPD             CPVT KE
Sbjct: 32  QKRSLMGFVKNALGLDPSPSPDDPTPENRFHPWDQSPSPDLRERAARIRTLAKCPVTKKE 91

Query: 80  INYTCPQSGIPTHHSREAWEQDTMYHATKKYEILKKVNIYEHDLRSGRPFPEFDFPQDQD 139
           INYTCP SGIPTHHSREAWE D  YH +K+YEILKKVNIYEHDLRSGRPFPEFDFP DQ 
Sbjct: 92  INYTCPLSGIPTHHSREAWEADKDYHQSKRYEILKKVNIYEHDLRSGRPFPEFDFPLDQI 151

Query: 140 YDRMVNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYPTTVGSVLHEFSPYALNPKGPIT 199
           +DR+VN+TNWDLFFYTR FYSMDTEFQLAAVTKMLSYP T+GS+LH+FSPY+LNPKGPIT
Sbjct: 152 HDRVVNLTNWDLFFYTRNFYSMDTEFQLAAVTKMLSYPMTIGSILHQFSPYSLNPKGPIT 211

Query: 200 LEGLKSLAALRYTLYP-QQHRKVSAATKDRPMRIFILGARAEAQLPGHVWKQFQFLFPEI 258
           LEGLKSLAALRY+LYP Q+   +S    DRPMRIFILGARAEAQLPGHVWKQ QFLFP+ 
Sbjct: 212 LEGLKSLAALRYSLYPFQRKSNISLKLHDRPMRIFILGARAEAQLPGHVWKQLQFLFPDQ 271

Query: 259 NFELHFIGPESFYDREKREYITSSTPIVRRVDETLSFVYHTDYFHVFHEAQDFFPYDPYL 318
            FE+HFIG E   + EK +YI S+ P+V+++DET+  +YH+DYFHV+HEAQDF PYDPYL
Sbjct: 272 TFEIHFIGTECLLNNEKNKYIKSAIPVVKKIDETMKLIYHSDYFHVYHEAQDFVPYDPYL 331

Query: 319 DIFFCFHPGFAAPESTEHWMGKTMEGLLETKCAIFTTGFNEQDLVRDMTAVREKYGNEMD 378
           D+FF FHPGFAAPE+++ WMG TM+ LLETKCAIFTTGFN+QD+  D+  V+ +YG EMD
Sbjct: 332 DVFFTFHPGFAAPETSDLWMGDTMKALLETKCAIFTTGFNKQDITNDVEIVKARYGKEMD 391

Query: 379 MLMEPVRNLFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHAIE 422
            LM+P++N +GSTKWELNDMNPQE++QFNMY+AGFRGKRYH I+
Sbjct: 392 TLMDPIKNSYGSTKWELNDMNPQEIFQFNMYVAGFRGKRYHTIK 435

>CAGL0A03927g Chr1 (397179..398492) [1314 bp, 437 aa] {ON} highly
           similar to uniprot|P32335 Saccharomyces cerevisiae
           YLR203c MSS51
          Length = 437

 Score =  627 bits (1617), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/419 (69%), Positives = 331/419 (78%), Gaps = 14/419 (3%)

Query: 19  IQKRHIIGFVRNALGLXXXXXXXXXXXXNRFHPWDQSPSPDXXXXXXXXXXXXXCPVTGK 78
           + KR ++GFVRNALGL            NRFHPWDQSP+ D             CPVT K
Sbjct: 19  VSKRQLMGFVRNALGLDPPPSPDEPTEQNRFHPWDQSPAVDLRERAARIKTLAKCPVTHK 78

Query: 79  EINYTCPQSGIPTHHSREAWEQDTMYHATKKYEILKKVNIYEHDLRSGRPFPEFDFPQDQ 138
            I YTCP SGIPTHHSREAWEQD  YHA+KKYEILKKVNIYEHDLRSGRPFPEFDFP+DQ
Sbjct: 79  PIQYTCPISGIPTHHSREAWEQDKEYHASKKYEILKKVNIYEHDLRSGRPFPEFDFPRDQ 138

Query: 139 DYDRMVNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYPTTVGSVLHEFSPYALNPKGPI 198
             DR VN+TNWDLF YTR FYSMDTEFQLAAVTKMLSYP T+GSVLH+FSPY+LNPKGPI
Sbjct: 139 GPDRTVNLTNWDLFLYTRSFYSMDTEFQLAAVTKMLSYPITIGSVLHQFSPYSLNPKGPI 198

Query: 199 TLEGLKSLAALRYTLYPQQHRKVSAATKDRPMRIFILGARAEAQLPGHVWKQFQFLFPEI 258
           TLEGLKSLAALRYTLYP Q+R V+   K++PMRIFILGARAEAQLPGHVWKQ QFLFP+ 
Sbjct: 199 TLEGLKSLAALRYTLYPLQNRAVTTTAKNKPMRIFILGARAEAQLPGHVWKQLQFLFPQQ 258

Query: 259 NFELHFIGPESFYDREKREYI--------------TSSTPIVRRVDETLSFVYHTDYFHV 304
           NFE+HFIGPES YDRE+ EYI              TSS P+ +R+DET+ F YHTDYFH 
Sbjct: 259 NFEIHFIGPESLYDRERNEYIRSATANGETAADGTTSSIPVTKRIDETMKFFYHTDYFHT 318

Query: 305 FHEAQDFFPYDPYLDIFFCFHPGFAAPESTEHWMGKTMEGLLETKCAIFTTGFNEQDLVR 364
            H AQDFFPYDPY D+FF FHPG A+PES + WM  T++GLL+TKCAIFTTGFN++D+  
Sbjct: 319 LHTAQDFFPYDPYQDVFFMFHPGLASPESKDTWMKDTVKGLLDTKCAIFTTGFNKKDMAD 378

Query: 365 DMTAVREKYGNEMDMLMEPVRNLFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHAIEV 423
           D+  +++ YG EMDMLM PV+N+FGSTKWEL+D +P  VYQFNMYIAGFRGKRYH I+V
Sbjct: 379 DIQILQDTYGKEMDMLMNPVKNVFGSTKWELDDSDPHSVYQFNMYIAGFRGKRYHPIKV 437

>KNAG0B02630 Chr2 complement(508645..509961) [1317 bp, 438 aa] {ON}
           Anc_7.346 YLR203C
          Length = 438

 Score =  607 bits (1564), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/412 (67%), Positives = 325/412 (78%), Gaps = 8/412 (1%)

Query: 19  IQKRHIIGFVRNALGLXXXXXXXXXXXXNRFHPWDQSPSPDXXXXXXXXXXXXXCPVTGK 78
           I +R ++GFVRNALGL            NRFHPWDQSP                CPVTG 
Sbjct: 26  IARRQLMGFVRNALGLEPPPSPMDPTPENRFHPWDQSPVDALRERAARIKTLAKCPVTGL 85

Query: 79  EINYTCPQSGIPTHHSREAWEQDTMYHATKKYEILKKVNIYEHDLRSGRPFPEFDFPQDQ 138
            + YTCP SGIPTHHSREAWEQDT YHATK+YE LKKVNIYEHDLRSGRPFPEFDFPQ+Q
Sbjct: 86  NVEYTCPLSGIPTHHSREAWEQDTQYHATKRYETLKKVNIYEHDLRSGRPFPEFDFPQEQ 145

Query: 139 DYDRMVNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYPTTVGSVLHEFSPYALNPKGPI 198
            YD++VNMTNWDLFFYTR FYSMDTEFQLAAVTKMLSYP T+ S+L +FSPY+LNPKGPI
Sbjct: 146 GYDKVVNMTNWDLFFYTRGFYSMDTEFQLAAVTKMLSYPVTIASLLAQFSPYSLNPKGPI 205

Query: 199 TLEGLKSLAALRYTLYPQQHRK--------VSAATKDRPMRIFILGARAEAQLPGHVWKQ 250
           TLEGLKSLAA+RYTLY Q               A K+RPMR+F+LGARAEAQLPGHVWKQ
Sbjct: 206 TLEGLKSLAAVRYTLYSQSFNNSARAGGVTTGGALKNRPMRLFVLGARAEAQLPGHVWKQ 265

Query: 251 FQFLFPEINFELHFIGPESFYDREKREYITSSTPIVRRVDETLSFVYHTDYFHVFHEAQD 310
             +LFPE +FE+ FIGPES+YDR + +Y+ S TP+V +VDETL F+++TDYFHV HE+QD
Sbjct: 266 LSYLFPEQSFEMVFIGPESYYDRARGQYVRSPTPVVEKVDETLKFIHYTDYFHVLHESQD 325

Query: 311 FFPYDPYLDIFFCFHPGFAAPESTEHWMGKTMEGLLETKCAIFTTGFNEQDLVRDMTAVR 370
           FFPYDPY D FF FHPGFA+PE+ + W+  T+  LL+TKCAIFTTGF+  DL+ D+  + 
Sbjct: 326 FFPYDPYFDCFFTFHPGFASPENRDTWLSNTLPALLDTKCAIFTTGFDRDDLMNDVALLN 385

Query: 371 EKYGNEMDMLMEPVRNLFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHAIE 422
           EK+G+EMD+LMEP +N+FGSTKWELND+NP EVYQFNMYIAGFRGKRYH I+
Sbjct: 386 EKFGSEMDILMEPTKNVFGSTKWELNDLNPHEVYQFNMYIAGFRGKRYHTIK 437

>NDAI0E04480 Chr5 complement(1007346..1008677) [1332 bp, 443 aa]
           {ON} Anc_7.346 YLR203C
          Length = 443

 Score =  604 bits (1558), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 272/410 (66%), Positives = 325/410 (79%)

Query: 14  ASATRIQKRHIIGFVRNALGLXXXXXXXXXXXXNRFHPWDQSPSPDXXXXXXXXXXXXXC 73
           A  +    R ++GFVRNALGL            NRFHPWDQSP  D             C
Sbjct: 34  AHVSHHSSRSLMGFVRNALGLDPKSSPDDPTPENRFHPWDQSPCQDLRERAAKIRTLAHC 93

Query: 74  PVTGKEINYTCPQSGIPTHHSREAWEQDTMYHATKKYEILKKVNIYEHDLRSGRPFPEFD 133
           PVT KEINYTCP SGIPTHHS+ AWE D  YH+ K YEILKKVNIYEHDLRSGRPFPEF 
Sbjct: 94  PVTNKEINYTCPISGIPTHHSKNAWEMDENYHSNKIYEILKKVNIYEHDLRSGRPFPEFV 153

Query: 134 FPQDQDYDRMVNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYPTTVGSVLHEFSPYALN 193
           FPQDQD+DRM+NMTNWDLF YTR FYSMDTEFQ+AAVTKMLSYP T+GS+LH+FSPY+L 
Sbjct: 154 FPQDQDFDRMINMTNWDLFLYTRSFYSMDTEFQMAAVTKMLSYPITIGSILHQFSPYSLQ 213

Query: 194 PKGPITLEGLKSLAALRYTLYPQQHRKVSAATKDRPMRIFILGARAEAQLPGHVWKQFQF 253
           PKGPITLEGLKS+AALRYTLYP  ++     TK+RPMRIF+LGARAEAQLPGH+WKQ Q+
Sbjct: 214 PKGPITLEGLKSMAALRYTLYPFHNKSFMTLTKNRPMRIFLLGARAEAQLPGHIWKQLQY 273

Query: 254 LFPEINFELHFIGPESFYDREKREYITSSTPIVRRVDETLSFVYHTDYFHVFHEAQDFFP 313
           LFPE  FEL FIGPE++YD+EK++Y+    P+++ +D+TL   + T+YFH  HE+QD FP
Sbjct: 274 LFPEQKFELFFIGPEAYYDKEKKQYLKLDKPLIQTIDDTLKLTFITEYFHTLHESQDLFP 333

Query: 314 YDPYLDIFFCFHPGFAAPESTEHWMGKTMEGLLETKCAIFTTGFNEQDLVRDMTAVREKY 373
           YDPY+D+FF FHPGF+A E+TEHWM  TM+ LLET+CAIF TGF+  D++ DM  + EKY
Sbjct: 334 YDPYMDVFFIFHPGFSAIETTEHWMNDTMKSLLETQCAIFNTGFSRNDMLNDMNILDEKY 393

Query: 374 GNEMDMLMEPVRNLFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHAIEV 423
            N++D+LM+PV+N+FGSTKWELND+NPQ+VYQFNMYIAGFRGKRY  +E+
Sbjct: 394 KNDLDILMKPVKNVFGSTKWELNDLNPQDVYQFNMYIAGFRGKRYPTVEL 443

>ACL152W Chr3 (85701..86987) [1287 bp, 428 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YLR203C (MSS51)
          Length = 428

 Score =  603 bits (1554), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/410 (68%), Positives = 324/410 (79%), Gaps = 2/410 (0%)

Query: 14  ASATRIQKRHIIGFVRNALGLXXXXXXXXXXXXNRFHPWDQSPSPDXXXXXXXXXXXXXC 73
           A+    Q+R I+GFVRNALGL            NRFH W+QSPSPD             C
Sbjct: 21  AAGACGQRRPIMGFVRNALGLDPPASPDEPTDENRFHVWEQSPSPDLRERAARIRALARC 80

Query: 74  PVTGKEINYTCPQSGIPTHHSREAWEQDTMYHATKKYEILKKVNIYEHDLRSGRPFPEFD 133
           PVTGK+I Y+C +SGIPTHHSREAWEQD  YH +K++  L+KVN+YEHDLRSGRPF EFD
Sbjct: 81  PVTGKDIRYSCERSGIPTHHSREAWEQDEEYHRSKRWATLRKVNVYEHDLRSGRPFAEFD 140

Query: 134 FPQDQDYDRMVNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYPTTVGSVLHEFSPYALN 193
           FPQ+Q  DRMVNM NWDLF YTRQFYSMDT+FQLAAVTKMLSYP T+GS+LH+FSPYAL 
Sbjct: 141 FPQEQGRDRMVNMLNWDLFLYTRQFYSMDTDFQLAAVTKMLSYPITIGSLLHQFSPYALE 200

Query: 194 PKGPITLEGLKSLAALRYTLYPQQHRKVSAATKDRPMRIFILGARAEAQLPGHVWKQFQF 253
           P+GPITLEGLKSLAALRYTLYP+   + + A + +PMRIFILGARAEAQLPGHVWKQ Q+
Sbjct: 201 PRGPITLEGLKSLAALRYTLYPES--ESARAVRSKPMRIFILGARAEAQLPGHVWKQLQY 258

Query: 254 LFPEINFELHFIGPESFYDREKREYITSSTPIVRRVDETLSFVYHTDYFHVFHEAQDFFP 313
           LFP  N E+HFIGPE+ YDR+++EY+ SSTP+ +RVD TL  V+HTDY HVFHEAQDFFP
Sbjct: 259 LFPGSNMEIHFIGPEALYDRQRKEYVHSSTPVSKRVDGTLKLVHHTDYLHVFHEAQDFFP 318

Query: 314 YDPYLDIFFCFHPGFAAPESTEHWMGKTMEGLLETKCAIFTTGFNEQDLVRDMTAVREKY 373
           YDPY D+FFCFHPGFA+ E    WM KT+  LLETKCAIF TGF+  D+  D  A+R  +
Sbjct: 319 YDPYNDVFFCFHPGFASAEGRSSWMDKTVPALLETKCAIFVTGFHRDDMFGDFEALRASH 378

Query: 374 GNEMDMLMEPVRNLFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHAIEV 423
             EMD+LM P +N+FGSTKWELNDMNP EVYQFNMYIAGFRGKRYHAI+V
Sbjct: 379 DAEMDVLMHPTKNIFGSTKWELNDMNPHEVYQFNMYIAGFRGKRYHAIQV 428

>TBLA0E00500 Chr5 (91769..93082) [1314 bp, 437 aa] {ON} Anc_7.346
           YLR203C
          Length = 437

 Score =  573 bits (1477), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 259/419 (61%), Positives = 320/419 (76%), Gaps = 12/419 (2%)

Query: 15  SATRIQKRHIIGFVRNALGLXXXXXXXXXXXXNRFHPWDQSPSPDXXXXXXXXXXXXXCP 74
           + +   KR+++GFVR+ LGL            NRFHPW+ SP  D             CP
Sbjct: 18  ACSNYSKRNLMGFVRSTLGLDPPPSPNDPTPENRFHPWETSPCDDLRERAARIKTMAKCP 77

Query: 75  VTGKEINYTCPQSGIPTHHSREAWEQDTMYHATKKYEILKKVNIYEHDLRSGRPFPEFDF 134
           V+  +INYTCP SGIPTHHSR+ WE DT YH     +ILKKVNIYEHDLRSGRPFPEFDF
Sbjct: 78  VSNLDINYTCPISGIPTHHSRKEWEMDTNYHKNHIADILKKVNIYEHDLRSGRPFPEFDF 137

Query: 135 PQDQDYDRMVNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYPTTVGSVLHEFSPYALNP 194
           P++Q+YD ++N+ NWDL+FYTR F+SMDTEFQLAAVTKMLSYP T+ SVLH+FSPY+L P
Sbjct: 138 PREQEYDTVINLINWDLYFYTRNFFSMDTEFQLAAVTKMLSYPMTIASVLHQFSPYSLTP 197

Query: 195 KGPITLEGLKSLAALRYTLYPQQ----------HRKVSAATKDRPMRIFILGARAEAQLP 244
           KGP+TLEGLKSLAALRYTL                 ++A +K+RPMRIFILGARAEAQLP
Sbjct: 198 KGPVTLEGLKSLAALRYTLNNNSLSDTSSGNSDSTTITATSKNRPMRIFILGARAEAQLP 257

Query: 245 GHVWKQFQFLFPEINFELHFIGPESFYDREKREYITSSTPIVRRVDETLSFVYHTDYFHV 304
            HVWKQ Q+LFP  NFE+HFIGPES   ++K  Y+TS+TPI +R+D+++S VYHTDYFHV
Sbjct: 258 PHVWKQLQYLFPNSNFEIHFIGPESLLSKDKSHYVTSTTPITKRIDDSMSLVYHTDYFHV 317

Query: 305 FHEAQDFFPYDPYLDIFFCFHPGFAAPESTEHWMGKTMEGLLETKCAIFTTGFNEQDLVR 364
           +H+AQDF+PYDPY DIFF FHPG AA + T  W+ +TM+GLL++KC IF TGF+E+D+  
Sbjct: 318 YHKAQDFYPYDPYFDIFFMFHPGLAATKET--WLNETMQGLLDSKCPIFMTGFHEKDITA 375

Query: 365 DMTAVREKYGNEMDMLMEPVRNLFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHAIEV 423
           D++ + + +  +MD+LM+PV+N+FGSTKWELND NPQEVYQFNMYIAG+RGKRYHA E 
Sbjct: 376 DISVLNKNFSKDMDILMKPVKNVFGSTKWELNDSNPQEVYQFNMYIAGYRGKRYHATET 434

>NCAS0A14120 Chr1 (2777017..2778300) [1284 bp, 427 aa] {ON}
           Anc_7.346 YLR203C
          Length = 427

 Score =  573 bits (1476), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/424 (63%), Positives = 325/424 (76%), Gaps = 9/424 (2%)

Query: 5   AYKRCSIAPASA----TRIQK-RHIIGFVRNALGLXXXXXXXXXXXXNRFHPWDQSPSPD 59
           A  + S+ P S     +RI   R ++GFV+NALG+            NRF+PWD+SPSP 
Sbjct: 8   AATQLSLHPVSLFAIDSRISSHRTLVGFVKNALGIDPPPLPTEPVFANRFYPWDESPSPA 67

Query: 60  XXXXXXXXXXXXXCPVTGKEINYTCPQSGIPTHHSREAWEQDTMYHATKKYEILKKVNIY 119
                        CPVTGKEI +TCP SGIPTH+S+EAWE DT YH  K YE L+KVNIY
Sbjct: 68  IRERAARIKAQAKCPVTGKEIRFTCPLSGIPTHYSKEAWENDTNYHKNKIYEKLRKVNIY 127

Query: 120 EHDLRSGRPFPEFDFPQDQDYDRMVNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYPTT 179
           EHDLRSGRPFPEFDFP +Q  D  VNMTNWDLFFYTRQFYSMDTEFQLA VTKMLSYP T
Sbjct: 128 EHDLRSGRPFPEFDFPGEQARDSTVNMTNWDLFFYTRQFYSMDTEFQLATVTKMLSYPIT 187

Query: 180 VGSVLHEFSPYALNPKGPITLEGLKSLAALRYTLYPQQHRKVSAATKDRPMRIFILGARA 239
           +GS+L+++SPY L PKGP+TLEGLKSLAALRYTL         A TK RPMRIFILGARA
Sbjct: 188 IGSILYKYSPYNLIPKGPVTLEGLKSLAALRYTL----RNNAFATTKTRPMRIFILGARA 243

Query: 240 EAQLPGHVWKQFQFLFPEINFELHFIGPESFYDREKREYITSSTPIVRRVDETLSFVYHT 299
           E+QLP H+WKQ QFLFP   FE++FIGPE     +   Y++S + IV+RVDE+L+  Y+ 
Sbjct: 244 ESQLPIHIWKQLQFLFPAQAFEINFIGPECSLLEQDSNYLSSDSRIVKRVDESLTLAYYP 303

Query: 300 DYFHVFHEAQDFFPYDPYLDIFFCFHPGFAAPESTEHWMGKTMEGLLETKCAIFTTGFNE 359
           DYF  FH+AQDFFPYDPY DIFF FHPGFA+PES++ WMG TM+ LL+TKCAIFTTGF++
Sbjct: 304 DYFDKFHKAQDFFPYDPYNDIFFTFHPGFASPESSKTWMGDTMKALLDTKCAIFTTGFSQ 363

Query: 360 QDLVRDMTAVREKYGNEMDMLMEPVRNLFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYH 419
            D+++D+T+V++ YG E+DMLM P++N+FGSTKWELND+NPQ+VYQFNMYIAGFRGKRYH
Sbjct: 364 DDIMKDITSVQDTYGEEVDMLMNPIKNVFGSTKWELNDLNPQQVYQFNMYIAGFRGKRYH 423

Query: 420 AIEV 423
            ++ 
Sbjct: 424 TVKA 427

>KAFR0B00840 Chr2 (159480..160760) [1281 bp, 426 aa] {ON} Anc_7.346
           YLR203C
          Length = 426

 Score =  571 bits (1471), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 266/407 (65%), Positives = 313/407 (76%), Gaps = 2/407 (0%)

Query: 18  RIQKRHIIGFVRNALGLXXXXXXXXXXXXNRFHPWDQSPSPDXXXXXXXXXXXXXCPVTG 77
           R+  R ++GFVRNALGL            NRF+PWDQSPSP+             CP+TG
Sbjct: 21  RVLSRTLVGFVRNALGLEPPPTPDEPRVSNRFYPWDQSPSPELRERAAKIKAMARCPITG 80

Query: 78  KEINYTCPQSGIPTHHSREAWEQDTMYHATKKYEILKKVNIYEHDLRSGRPFPEFDFPQD 137
           KEINYTCP SGIPTHHSREAWEQD  YH  K  +ILKKVNIYEHDLRSGR FPEFDFP D
Sbjct: 81  KEINYTCPISGIPTHHSREAWEQDEAYHRNKIPDILKKVNIYEHDLRSGRSFPEFDFPSD 140

Query: 138 QDYDRMVNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYPTTVGSVLHEFSPYALNPKGP 197
           Q +DR VN+ NWDL+FYTR FYSMDTEFQLA VTKMLSYP T+ SVLH++SPY+L P GP
Sbjct: 141 QTFDRAVNLANWDLYFYTRSFYSMDTEFQLATVTKMLSYPITIASVLHQYSPYSLYPHGP 200

Query: 198 ITLEGLKSLAALRYTLYPQQHRKV-SAATKDRPMRIFILGARAEAQLPGHVWKQFQFLFP 256
           ITLEGLKS+AALRY+LYP QH+   S   K RPMRIFILGARAE+QLPGHVWKQFQ+LFP
Sbjct: 201 ITLEGLKSIAALRYSLYPSQHKSSRSVLNKTRPMRIFILGARAESQLPGHVWKQFQYLFP 260

Query: 257 EINFELHFIGPESFYDREKREYITSSTPIVRRVDETLSFVYHTDYFHVFHEAQDFFPYDP 316
              FE+ FIGPE    RE    +  +  IV+R+D+T+S VYH   FH  H+AQDFFPYDP
Sbjct: 261 LQTFEIIFIGPECQL-REPSNSVGGANNIVKRIDDTISLVYHPKLFHDIHKAQDFFPYDP 319

Query: 317 YLDIFFCFHPGFAAPESTEHWMGKTMEGLLETKCAIFTTGFNEQDLVRDMTAVREKYGNE 376
           Y D+FF FHPGFA+PE+ E WM  T++ LL+TKCA+F TGF+++DL  D+  + + YG++
Sbjct: 320 YNDVFFVFHPGFASPETKELWMNDTVKALLDTKCAVFHTGFSKKDLSNDVKLLNKMYGDK 379

Query: 377 MDMLMEPVRNLFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHAIEV 423
           +D LM PV+NLFGSTKWELND+NPQEVYQFNMYI+ FRGKRYH IE+
Sbjct: 380 LDTLMTPVKNLFGSTKWELNDLNPQEVYQFNMYISAFRGKRYHPIEI 426

>NDAI0A01930 Chr1 complement(430531..431883) [1353 bp, 450 aa] {ON}
           Anc_7.346 YLR203C
          Length = 450

 Score =  570 bits (1468), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 269/433 (62%), Positives = 328/433 (75%), Gaps = 20/433 (4%)

Query: 7   KRCSIA--PASATRIQKRHIIGFVRNALGLXXXXXXXXXXXXNRFHPWDQSPSPDXXXXX 64
           + CSI+    +  +   RH +GFV+NALG+            NRFHPWDQSPSPD     
Sbjct: 22  QECSISYFKNNYQKFSNRHFVGFVKNALGMEPPPSPNEPAFENRFHPWDQSPSPDLRERA 81

Query: 65  XXXXXXXXCPVTGKEINYTCPQSGIPTHHSREAWEQDTMYHATKKYEILKKVNIYEHDLR 124
                   CPVTGKEINYTCP SGIPTHHS+EAWE DT YH  K Y+ILKKVN++EHDLR
Sbjct: 82  ARIRALAKCPVTGKEINYTCPISGIPTHHSKEAWENDTNYHQNKIYDILKKVNVFEHDLR 141

Query: 125 SGRPFPEFDFPQDQDYDRMVNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYPTTVGSVL 184
           SGR FPEF+FPQ QD+D  V+M NWD+FFYTRQF SMD+EFQLA VTKMLSYP T+ S+L
Sbjct: 142 SGRSFPEFEFPQSQDHDCAVSMNNWDMFFYTRQFVSMDSEFQLATVTKMLSYPITIASIL 201

Query: 185 HEFSPYALNPKGPITLEGLKSLAALRYTLYPQQHRKVSAATKDRPMRIFILGARAEAQLP 244
           H++ PYAL P GPITLEGLKS+AAL+Y+L   +H +    TK+RPMRIFILGARAE+QLP
Sbjct: 202 HKYCPYALEPNGPITLEGLKSIAALKYSL---RHNEFE-TTKERPMRIFILGARAESQLP 257

Query: 245 GHVWKQFQFLFPEINFELHFIGPES-------FYDREKREYITSST-------PIVRRVD 290
            H+WKQF +LFP  NFE++FIGPE          + E+    TS +        IV+R+D
Sbjct: 258 EHIWKQFSYLFPFQNFEINFIGPECSVLMNNNNMNAEETNTTTSGSMTEIRPNRIVKRID 317

Query: 291 ETLSFVYHTDYFHVFHEAQDFFPYDPYLDIFFCFHPGFAAPESTEHWMGKTMEGLLETKC 350
           E L+ VYHTD+FH  H A+DFFPYD Y D+FF FHPGFA+PE+T+ WMG+TM+ LL+TKC
Sbjct: 318 ERLNLVYHTDFFHTLHNARDFFPYDSYNDVFFTFHPGFASPENTKSWMGETMKALLDTKC 377

Query: 351 AIFTTGFNEQDLVRDMTAVREKYGNEMDMLMEPVRNLFGSTKWELNDMNPQEVYQFNMYI 410
           AIFTTGFN+QDL++D+  V+E YG E+DMLM+P +N+FGSTKWELNDM+PQEVYQ+NMYI
Sbjct: 378 AIFTTGFNKQDLLKDIDIVQETYGKEVDMLMKPTKNVFGSTKWELNDMDPQEVYQYNMYI 437

Query: 411 AGFRGKRYHAIEV 423
           AGFRGKRYHA++V
Sbjct: 438 AGFRGKRYHAVKV 450

>KNAG0C03750 Chr3 (740426..741700) [1275 bp, 424 aa] {ON} Anc_7.346
           YLR203C
          Length = 424

 Score =  545 bits (1404), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 253/402 (62%), Positives = 306/402 (76%), Gaps = 6/402 (1%)

Query: 22  RHIIGFVRNALGLXXXXXXXXXXXXNRFHPWDQSPSPDXXXXXXXXXXXXXCPVTGKEIN 81
           R I+G+VRNA GL            NRFHPW++SP  D             CPVTGK IN
Sbjct: 29  RTIMGYVRNAFGLEPRDSPDTPQISNRFHPWEESPCADLRDRAARIKTLARCPVTGKNIN 88

Query: 82  YTCPQSGIPTHHSREAWEQDTMYHATKKYEILKKVNIYEHDLRSGRPFPEFDFPQDQDYD 141
           YTCP SGIPTHHSR+AWE DT YH  K YE LKKVNIYEHDLRSGR FPEFDFP +Q  D
Sbjct: 89  YTCPISGIPTHHSRKAWEDDTDYHKNKTYEKLKKVNIYEHDLRSGRSFPEFDFPAEQGRD 148

Query: 142 RMVNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYPTTVGSVLHEFSPYALNPKGPITLE 201
           R VN+ NWDLF YTRQFYSMDTEF LA VTKMLSYP T+ SVLHEFSPY L P+GP+TLE
Sbjct: 149 RAVNLQNWDLFLYTRQFYSMDTEFHLATVTKMLSYPITIASVLHEFSPYKLQPRGPVTLE 208

Query: 202 GLKSLAALRYTLYPQQHRKVSAATKDRPMRIFILGARAEAQLPGHVWKQFQFLFPEINFE 261
           GLKS+AALRYTLYP+  +  ++ + + PMRIFI+G RAE+QLPGHVWKQ Q+LF E  FE
Sbjct: 209 GLKSIAALRYTLYPKLGK--TSLSNNSPMRIFIVGTRAESQLPGHVWKQLQYLFSERIFE 266

Query: 262 LHFIGPESFYDREKREYITSSTPIVRRVDETLSFVYHTDYFHVFHEAQDFFPYDPYLDIF 321
           +HFIGPE     + +E   +STP++++VD+TLS +YH  YFH  H++ D FPY+PY D+F
Sbjct: 267 IHFIGPEC----QLKEPKNTSTPLIKKVDDTLSLIYHPQYFHELHKSGDLFPYNPYKDVF 322

Query: 322 FCFHPGFAAPESTEHWMGKTMEGLLETKCAIFTTGFNEQDLVRDMTAVREKYGNEMDMLM 381
           F FHPGFA P++ + W+ +T+  LLETKCAIF TGFNE D+  D+T + + Y NE+D+LM
Sbjct: 323 FIFHPGFAYPDTRKLWLDETIPNLLETKCAIFHTGFNEGDITNDVTLIDKCYRNEIDVLM 382

Query: 382 EPVRNLFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHAIEV 423
           +P++N+FGS KWELND+NPQEVYQFNMYIAGFRGKRYH I++
Sbjct: 383 KPIKNVFGSVKWELNDINPQEVYQFNMYIAGFRGKRYHPIKI 424

>KLTH0G11418g Chr7 (962267..964960) [2694 bp, 897 aa] {ON} similar
           to uniprot|P89102 Saccharomyces cerevisiae YDR166C SEC5
           Essential 107kDa subunit of the exocyst complex (Sec3p
           Sec5p Sec6p Sec8p Sec10p Sec15p Exo70p and Exo84p) which
           has the essential function of mediating polarized
           targeting of secretory vesicles to active sites of
           exocytosis
          Length = 897

 Score = 35.0 bits (79), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 21/93 (22%), Positives = 42/93 (45%), Gaps = 4/93 (4%)

Query: 170 VTKMLSYPTTVGSVLHEFSPYALNPKGPITLEGLKSLAALRYTLYPQQHR----KVSAAT 225
           V +++S    + S+L E +    NP+ P T+  L +L  ++ +++PQ  R          
Sbjct: 661 VQQIVSMEAVLESILKEAAKEKENPRNPRTILTLTNLQYIKGSVFPQVLRYFDESFETQL 720

Query: 226 KDRPMRIFILGARAEAQLPGHVWKQFQFLFPEI 258
             + + IF L A+ E  + G+     +    +I
Sbjct: 721 SRKNLEIFTLLAKMETSILGNYLSDLKVTLRDI 753

>TBLA0D00120 Chr4 complement(19863..21860) [1998 bp, 665 aa] {ON} 
          Length = 665

 Score = 32.3 bits (72), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 38/76 (50%), Gaps = 9/76 (11%)

Query: 97  AWEQDTMYHATKKYEILKKVNIYEHDLRS---GRPFPEFDFPQDQDYDRMVNMTNWDLFF 153
           +W+Q T Y   +  +I  K  + + DL +   GRP  +F  PQD D      + N+D F 
Sbjct: 57  SWQQTTSYLGFQNKKIHSKKELSKLDLTNILLGRPINKFPIPQDDD------IANYDEFK 110

Query: 154 YTRQFYSMDTEFQLAA 169
           +T    +++ +  +A+
Sbjct: 111 FTGFITNLNVKNLIAS 126

>Suva_6.126 Chr6 complement(209913..212375) [2463 bp, 820 aa] {ON}
           YJL051W (REAL)
          Length = 820

 Score = 31.6 bits (70), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 33/72 (45%), Gaps = 10/72 (13%)

Query: 89  IPTHHSREAWEQDTMYHATKKYEILKKVNIYEHDLRSGRPFPEFDFPQDQDYDRMVNMTN 148
           +P H + E WE+D       +  IL+KV     +L   +  P F F    D DR  + T 
Sbjct: 455 LPAHVTLEMWEKD-------QENILRKVTT---NLADSKLLPPFRFTSKSDIDRNSSPTE 504

Query: 149 WDLFFYTRQFYS 160
            ++  +T+  +S
Sbjct: 505 LEVELHTQNNFS 516

>KNAG0K00560 Chr11 complement(96678..99992) [3315 bp, 1104 aa] {ON}
           Anc_5.88 YGR238C
          Length = 1104

 Score = 30.4 bits (67), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 47/95 (49%), Gaps = 8/95 (8%)

Query: 156 RQFYSMDTEFQLAAVTKMLSYPTTVGSVLHEFSPY-ALNPKGPITLEGLKSLAALRYTLY 214
           +Q  S+  E QL  V +  +  T V    + FSP   L PKG +    +K    L+ + +
Sbjct: 152 QQLQSVQHEQQLPNVQQEQTIRTPVPPEPNVFSPSPELVPKGNVVWNRIK----LKDSPF 207

Query: 215 PQ-QHRKVSAATKDRPMRIFILGARAEAQLPGHVW 248
           P+ +H   S AT+D   R+F++G   +  + G VW
Sbjct: 208 PRYRHVTSSYATEDD--RVFVIGGLHDQSVFGDVW 240

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.323    0.138    0.436 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 44,003,837
Number of extensions: 1873899
Number of successful extensions: 3837
Number of sequences better than 10.0: 28
Number of HSP's gapped: 3905
Number of HSP's successfully gapped: 28
Length of query: 423
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 311
Effective length of database: 40,638,807
Effective search space: 12638668977
Effective search space used: 12638668977
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 67 (30.4 bits)