Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0F11242g7.344ON30930916540.0
TDEL0C020307.344ON31130511471e-158
KLTH0H01386g7.344ON30730611091e-153
Kwal_56.246247.344ON30730410961e-151
ZYRO0F11594g7.344ON30930710931e-150
KLLA0D12474g7.344ON31230610671e-146
Suva_10.2997.344ON3203109621e-130
Ecym_47297.344ON3263049441e-127
YLR205C (HMX1)7.344ON3173079421e-127
Skud_12.2687.344ON3183119371e-126
Smik_12.2637.344ON3182759241e-124
NCAS0E028907.344ON3153098461e-112
TPHA0F029207.344ON3202908301e-110
Kpol_530.367.344ON3113118031e-106
NDAI0E045007.344ON3273247505e-98
CAGL0A03905g7.344ON2822577457e-98
ACL154W7.344ON3192836941e-89
KAFR0L014707.344ON3002986103e-77
KNAG0B026407.344ON3022875712e-71
CAGL0K09988g8.216ON196131770.20
CAGL0G08492g8.415ON528247703.1
Smik_3.291.27ON275134667.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0F11242g
         (309 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0F11242g Chr6 (878709..879638) [930 bp, 309 aa] {ON} similar...   641   0.0  
TDEL0C02030 Chr3 complement(351368..352303) [936 bp, 311 aa] {ON...   446   e-158
KLTH0H01386g Chr8 complement(128402..129325) [924 bp, 307 aa] {O...   431   e-153
Kwal_56.24624 s56 (1078618..1079541) [924 bp, 307 aa] {ON} YLR20...   426   e-151
ZYRO0F11594g Chr6 (951726..952655) [930 bp, 309 aa] {ON} similar...   425   e-150
KLLA0D12474g Chr4 complement(1058158..1059096) [939 bp, 312 aa] ...   415   e-146
Suva_10.299 Chr10 complement(525524..526486) [963 bp, 320 aa] {O...   375   e-130
Ecym_4729 Chr4 complement(1423384..1424364) [981 bp, 326 aa] {ON...   368   e-127
YLR205C Chr12 complement(552724..553677) [954 bp, 317 aa] {ON}  ...   367   e-127
Skud_12.268 Chr12 complement(499347..500303) [957 bp, 318 aa] {O...   365   e-126
Smik_12.263 Chr12 complement(499758..500714) [957 bp, 318 aa] {O...   360   e-124
NCAS0E02890 Chr5 complement(565154..566101) [948 bp, 315 aa] {ON...   330   e-112
TPHA0F02920 Chr6 (645567..646529) [963 bp, 320 aa] {ON} Anc_7.34...   324   e-110
Kpol_530.36 s530 complement(84853..85788) [936 bp, 311 aa] {ON} ...   313   e-106
NDAI0E04500 Chr5 complement(1009814..1010797) [984 bp, 327 aa] {...   293   5e-98
CAGL0A03905g Chr1 complement(395219..396067) [849 bp, 282 aa] {O...   291   7e-98
ACL154W Chr3 (83962..84921) [960 bp, 319 aa] {ON} Syntenic homol...   271   1e-89
KAFR0L01470 Chr12 (272767..273669) [903 bp, 300 aa] {ON} Anc_7.3...   239   3e-77
KNAG0B02640 Chr2 complement(510618..511526) [909 bp, 302 aa] {ON...   224   2e-71
CAGL0K09988g Chr11 (977846..978436) [591 bp, 196 aa] {ON} simila...    34   0.20 
CAGL0G08492g Chr7 (802604..804190) [1587 bp, 528 aa] {ON} some s...    32   3.1  
Smik_3.29 Chr3 complement(45086..45913) [828 bp, 275 aa] {ON} YC...    30   7.5  

>SAKL0F11242g Chr6 (878709..879638) [930 bp, 309 aa] {ON} similar to
           uniprot|P32339 Saccharomyces cerevisiae YLR205C HMX1 ER
           localized, heme-binding peroxidase involved in the
           degradation of heme
          Length = 309

 Score =  641 bits (1654), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/309 (100%), Positives = 309/309 (100%)

Query: 1   MSATTIPSPTDVGALANRINFHTRDSHNKINADMSVKLAFAMKHGHIYRQGILAFYYIFA 60
           MSATTIPSPTDVGALANRINFHTRDSHNKINADMSVKLAFAMKHGHIYRQGILAFYYIFA
Sbjct: 1   MSATTIPSPTDVGALANRINFHTRDSHNKINADMSVKLAFAMKHGHIYRQGILAFYYIFA 60

Query: 61  AVEQEIDNLLQNASTPLELQTQKILNQFWCEEFRRSNMIFQDLELLYSKEYSTRTELHAF 120
           AVEQEIDNLLQNASTPLELQTQKILNQFWCEEFRRSNMIFQDLELLYSKEYSTRTELHAF
Sbjct: 61  AVEQEIDNLLQNASTPLELQTQKILNQFWCEEFRRSNMIFQDLELLYSKEYSTRTELHAF 120

Query: 121 LDDNVLPPQQQAFVEYIHQTVREKPYTILAYCHVLYLALFAGGKLMKSNIYRHTGLFPKF 180
           LDDNVLPPQQQAFVEYIHQTVREKPYTILAYCHVLYLALFAGGKLMKSNIYRHTGLFPKF
Sbjct: 121 LDDNVLPPQQQAFVEYIHQTVREKPYTILAYCHVLYLALFAGGKLMKSNIYRHTGLFPKF 180

Query: 181 QHLTPEQIVRRGTNFFTFSEEGADAEGKLRWEYKKGYELATRKELTEEQKQEIIKVSSEI 240
           QHLTPEQIVRRGTNFFTFSEEGADAEGKLRWEYKKGYELATRKELTEEQKQEIIKVSSEI
Sbjct: 181 QHLTPEQIVRRGTNFFTFSEEGADAEGKLRWEYKKGYELATRKELTEEQKQEIIKVSSEI 240

Query: 241 FDWNMDVIGELGEINRNELMGKFSFKLVSFILEEWKYSEKLSKENKITILVIFAILQFLL 300
           FDWNMDVIGELGEINRNELMGKFSFKLVSFILEEWKYSEKLSKENKITILVIFAILQFLL
Sbjct: 241 FDWNMDVIGELGEINRNELMGKFSFKLVSFILEEWKYSEKLSKENKITILVIFAILQFLL 300

Query: 301 AYWLLRKLF 309
           AYWLLRKLF
Sbjct: 301 AYWLLRKLF 309

>TDEL0C02030 Chr3 complement(351368..352303) [936 bp, 311 aa] {ON}
           Anc_7.344 YLR205C
          Length = 311

 Score =  446 bits (1147), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 208/305 (68%), Positives = 257/305 (84%)

Query: 3   ATTIPSPTDVGALANRINFHTRDSHNKINADMSVKLAFAMKHGHIYRQGILAFYYIFAAV 62
           A TIP+PTDVGALANRINFHTRD+HNK+NA MSV+LAFA+KHG IYRQGILAFY+IF AV
Sbjct: 5   AKTIPAPTDVGALANRINFHTRDAHNKVNAYMSVRLAFALKHGFIYRQGILAFYHIFDAV 64

Query: 63  EQEIDNLLQNASTPLELQTQKILNQFWCEEFRRSNMIFQDLELLYSKEYSTRTELHAFLD 122
           EQE+D LL +     E Q Q +L QFW EEFRR+N IF+DLE+LYS EYS    L  F++
Sbjct: 65  EQELDRLLNDPQNDEERQMQHVLRQFWLEEFRRTNRIFKDLEVLYSPEYSDSESLRNFVE 124

Query: 123 DNVLPPQQQAFVEYIHQTVREKPYTILAYCHVLYLALFAGGKLMKSNIYRHTGLFPKFQH 182
              L PQ Q+FV+ IH TV++   TILAYCHVLYLALFAGGK+M+SN+YRHTGLFPKF++
Sbjct: 125 HQPLAPQLQSFVDSIHSTVQQDSCTILAYCHVLYLALFAGGKVMRSNLYRHTGLFPKFEY 184

Query: 183 LTPEQIVRRGTNFFTFSEEGADAEGKLRWEYKKGYELATRKELTEEQKQEIIKVSSEIFD 242
           LTP+++V RGTNFFTFS+EG+DAE KLRW+YK+GYELATR+EL+E QK  I++VSS+IFD
Sbjct: 185 LTPKELVIRGTNFFTFSDEGSDAENKLRWKYKEGYELATRQELSESQKTRILQVSSQIFD 244

Query: 243 WNMDVIGELGEINRNELMGKFSFKLVSFILEEWKYSEKLSKENKITILVIFAILQFLLAY 302
           WNMDVIGE+GE+NRNELM KFSFKL++++ EEWKYS  LSK +K +I+V+  ++QFL+AY
Sbjct: 245 WNMDVIGEIGEMNRNELMSKFSFKLLTYLSEEWKYSTILSKRSKDSIIVMAILIQFLVAY 304

Query: 303 WLLRK 307
            +LRK
Sbjct: 305 IVLRK 309

>KLTH0H01386g Chr8 complement(128402..129325) [924 bp, 307 aa] {ON}
           similar to uniprot|P32339 Saccharomyces cerevisiae
           YLR205C HMX1 ER localized, heme-binding peroxidase
           involved in the degradation of heme
          Length = 307

 Score =  431 bits (1109), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 196/306 (64%), Positives = 243/306 (79%)

Query: 4   TTIPSPTDVGALANRINFHTRDSHNKINADMSVKLAFAMKHGHIYRQGILAFYYIFAAVE 63
           TTIPSPTDVGALANRINFHTRD HNKI+  MS K AFAMKHG IYRQG+LAF+Y+F A+E
Sbjct: 2   TTIPSPTDVGALANRINFHTRDQHNKIDKQMSAKFAFAMKHGFIYRQGVLAFFYVFQAIE 61

Query: 64  QEIDNLLQNASTPLELQTQKILNQFWCEEFRRSNMIFQDLELLYSKEYSTRTELHAFLDD 123
           QE+D L Q A TP E QT+ ILNQFW EEFRR+  I QDLELLY+KE+ T   L  FL++
Sbjct: 62  QELDRLRQEAQTPEEEQTRDILNQFWTEEFRRAPRILQDLELLYAKEFPTSASLRTFLEE 121

Query: 124 NVLPPQQQAFVEYIHQTVREKPYTILAYCHVLYLALFAGGKLMKSNIYRHTGLFPKFQHL 183
             L P+ Q FV+Y+H ++R +P  ILAYCHVLYLALFAGG++M+S IYR TGLFPKF +L
Sbjct: 122 TTLAPELQGFVDYVHASIRSRPTAILAYCHVLYLALFAGGRVMRSTIYRSTGLFPKFPNL 181

Query: 184 TPEQIVRRGTNFFTFSEEGADAEGKLRWEYKKGYELATRKELTEEQKQEIIKVSSEIFDW 243
           T E++VRRGTNFFTFS+ G  AE +LR  YK+GYELATR+ LTEEQK  I+ VS+ IF+W
Sbjct: 182 TTEEVVRRGTNFFTFSDAGVQAENQLRKNYKRGYELATRQGLTEEQKLNILDVSNAIFEW 241

Query: 244 NMDVIGELGEINRNELMGKFSFKLVSFILEEWKYSEKLSKENKITILVIFAILQFLLAYW 303
           N  V+ E+GEINR ELMGK SF+L++F++EEW+YS+KL+++ K  +L    +LQ L+ YW
Sbjct: 242 NTRVVTEIGEINRQELMGKLSFRLLTFVIEEWQYSDKLTRKQKSLVLATGVVLQILMMYW 301

Query: 304 LLRKLF 309
           +LRK F
Sbjct: 302 VLRKFF 307

>Kwal_56.24624 s56 (1078618..1079541) [924 bp, 307 aa] {ON} YLR205C
           (HMX1) - Putative heme oxygenase [contig 161] FULL
          Length = 307

 Score =  426 bits (1096), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 193/304 (63%), Positives = 247/304 (81%)

Query: 4   TTIPSPTDVGALANRINFHTRDSHNKINADMSVKLAFAMKHGHIYRQGILAFYYIFAAVE 63
           +TIPSPTDVGALANRINF+TRD HNKI+  MSVK AFAMKHG IYRQG+LAF+Y+F A+E
Sbjct: 2   STIPSPTDVGALANRINFYTRDEHNKIDKQMSVKFAFAMKHGFIYRQGLLAFFYVFQAIE 61

Query: 64  QEIDNLLQNASTPLELQTQKILNQFWCEEFRRSNMIFQDLELLYSKEYSTRTELHAFLDD 123
           QEID LLQNA T  E+QT+ IL QFW   F R+  I+QDL+LLY+KE+ +  +L  FL  
Sbjct: 62  QEIDRLLQNAQTAEEVQTRDILLQFWVSSFSRTPRIYQDLKLLYAKEFPSDEQLSLFLQQ 121

Query: 124 NVLPPQQQAFVEYIHQTVREKPYTILAYCHVLYLALFAGGKLMKSNIYRHTGLFPKFQHL 183
           N LPP+QQ FV+++H++VR +P +ILA+CHVLYLALFAGG++M+S IYR TGLFPKF  L
Sbjct: 122 NTLPPEQQGFVDFVHESVRARPTSILAFCHVLYLALFAGGRVMRSTIYRSTGLFPKFPDL 181

Query: 184 TPEQIVRRGTNFFTFSEEGADAEGKLRWEYKKGYELATRKELTEEQKQEIIKVSSEIFDW 243
           TPE++VR+GTNFFTFS++G  AE +LR EYK+GYELATR+ LTE+QK  I++V++  F+W
Sbjct: 182 TPEEVVRKGTNFFTFSDDGVQAENQLRKEYKRGYELATREGLTEDQKLNILEVAAATFEW 241

Query: 244 NMDVIGELGEINRNELMGKFSFKLVSFILEEWKYSEKLSKENKITILVIFAILQFLLAYW 303
           N  VI E+GEINR ELMGK SFKLVSF ++EWK++EKL++  K  +L   A++Q L+ YW
Sbjct: 242 NTRVISEIGEINRQELMGKLSFKLVSFAIDEWKHTEKLTRRQKSIVLATGAVIQILVMYW 301

Query: 304 LLRK 307
           +LRK
Sbjct: 302 MLRK 305

>ZYRO0F11594g Chr6 (951726..952655) [930 bp, 309 aa] {ON} similar to
           uniprot|P32339 Saccharomyces cerevisiae YLR205C HMX1 ER
           localized, heme-binding peroxidase involved in the
           degradation of heme
          Length = 309

 Score =  425 bits (1093), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 198/307 (64%), Positives = 252/307 (82%), Gaps = 1/307 (0%)

Query: 4   TTIPSPTDVGALANRINFHTRDSHNKINADMSVKLAFAMKHGHIYRQGILAFYYIFAAVE 63
            TIP+PTDVGALANRINFHTRD+HNKINA MSV+LAFA+KHG I+RQGILA+YYIF A+E
Sbjct: 2   ATIPAPTDVGALANRINFHTRDAHNKINAYMSVRLAFALKHGWIFRQGILAYYYIFQAIE 61

Query: 64  QEIDNLLQNASTPLELQTQKILNQFWCEEFRRSNMIFQDLELLYSKEYSTRTELHAFL-D 122
           QE+D ++ +A    E+Q Q +L +FW  +FRR++ IFQDL LLYS E+ T + L  FL  
Sbjct: 62  QELDRIMDHARNEKEMQMQNVLGKFWMNDFRRTDRIFQDLTLLYSPEFPTESSLEQFLTS 121

Query: 123 DNVLPPQQQAFVEYIHQTVREKPYTILAYCHVLYLALFAGGKLMKSNIYRHTGLFPKFQH 182
            N L P  QAFV+ IH+ V+E+P TILAYCHVLYLALFAGGK+M+SN+YRHTGLFPKFQH
Sbjct: 122 GNHLAPTLQAFVDSIHKNVQEEPCTILAYCHVLYLALFAGGKVMRSNLYRHTGLFPKFQH 181

Query: 183 LTPEQIVRRGTNFFTFSEEGADAEGKLRWEYKKGYELATRKELTEEQKQEIIKVSSEIFD 242
           L+P ++V+RGTNFFTFSEEG++AE KLRW YK+GYELATR ELTEEQKQ+II VSSEIF 
Sbjct: 182 LSPRELVQRGTNFFTFSEEGSEAENKLRWRYKRGYELATRDELTEEQKQKIISVSSEIFQ 241

Query: 243 WNMDVIGELGEINRNELMGKFSFKLVSFILEEWKYSEKLSKENKITILVIFAILQFLLAY 302
           WNM+ I E+GE+NR ELMG  SF+L++++ EEWK+++KLSK  K  +++   ++QFL+ Y
Sbjct: 242 WNMETIAEIGELNRQELMGSVSFRLLTYLHEEWKHTDKLSKNQKDLLVLAVLVVQFLIVY 301

Query: 303 WLLRKLF 309
            +LR++ 
Sbjct: 302 LVLRRIL 308

>KLLA0D12474g Chr4 complement(1058158..1059096) [939 bp, 312 aa]
           {ON} similar to uniprot|P32339 Saccharomyces cerevisiae
           YLR205C HMX1 ER localized, heme-binding peroxidase
           involved in the degradation of heme
          Length = 312

 Score =  415 bits (1067), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 195/306 (63%), Positives = 242/306 (79%)

Query: 3   ATTIPSPTDVGALANRINFHTRDSHNKINADMSVKLAFAMKHGHIYRQGILAFYYIFAAV 62
           ATTIPSPTDVGALANRINF TRD HNKINA MS+K+AFAM+HG IYRQGI+A+YY+F A+
Sbjct: 6   ATTIPSPTDVGALANRINFQTRDMHNKINAYMSMKMAFAMRHGFIYRQGIVAYYYVFHAI 65

Query: 63  EQEIDNLLQNASTPLELQTQKILNQFWCEEFRRSNMIFQDLELLYSKEYSTRTELHAFLD 122
           EQEID LL++  T  + + + IL QFWCEEFRRS+ +  DL++LY+ EY    +L  FLD
Sbjct: 66  EQEIDRLLEHPVTVQDEKVKGILQQFWCEEFRRSDKLVLDLQVLYNDEYPGSEQLQEFLD 125

Query: 123 DNVLPPQQQAFVEYIHQTVREKPYTILAYCHVLYLALFAGGKLMKSNIYRHTGLFPKFQH 182
              LP + Q FV+ IH  V+++P+TILAYCHVLYLALFAGG++MKSN+YRH GLFPKF H
Sbjct: 126 GFQLPAKLQEFVDEIHSNVQKEPHTILAYCHVLYLALFAGGRVMKSNLYRHIGLFPKFGH 185

Query: 183 LTPEQIVRRGTNFFTFSEEGADAEGKLRWEYKKGYELATRKELTEEQKQEIIKVSSEIFD 242
           L+P+++VRR TNFFTFSEEG D E +LRW+YKKGYELATR ELTE +K  II+VS  IF 
Sbjct: 186 LSPKELVRRATNFFTFSEEGVDDENRLRWQYKKGYELATRTELTEAEKLRIIEVSQTIFQ 245

Query: 243 WNMDVIGELGEINRNELMGKFSFKLVSFILEEWKYSEKLSKENKITILVIFAILQFLLAY 302
            NM+V+ E+GEINR ELMGKFS+KL+SF+ EEWKYSEKL+ E K  I+    +   +  Y
Sbjct: 246 RNMEVVAEIGEINRAELMGKFSYKLISFLSEEWKYSEKLTPEVKKLIVFALIVFNMVFVY 305

Query: 303 WLLRKL 308
            +LR+L
Sbjct: 306 TILRRL 311

>Suva_10.299 Chr10 complement(525524..526486) [963 bp, 320 aa] {ON}
           YLR205C (REAL)
          Length = 320

 Score =  375 bits (962), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 176/310 (56%), Positives = 232/310 (74%), Gaps = 2/310 (0%)

Query: 2   SATTIPSPTDVGALANRINFHTRDSHNKINADMSVKLAFAMKHGHIYRQGILAFYYIFAA 61
           ++T IPSPTD+GALANRINFHTRD+HNKIN  M +K+A AM+HG IYRQGILA+YY+F A
Sbjct: 7   TSTIIPSPTDIGALANRINFHTRDAHNKINTFMGIKMAIAMRHGFIYRQGILAYYYVFDA 66

Query: 62  VEQEIDNLLQNASTPLELQTQKILNQFWCEEFRRSNMIFQDLELLYSKEYSTRTELHAFL 121
           +EQEID LL +A +  ELQ   IL QFW E+FRRS  I++DL+LLYS  + +   L+ FL
Sbjct: 67  IEQEIDRLLNDAVSEKELQACGILKQFWLEDFRRSTQIYKDLKLLYSNTFKSTESLNEFL 126

Query: 122 DDNVLPPQQQAFVEYIHQTVREKPYTILAYCHVLYLALFAGGKLMKSNIYRHTGLFPKFQ 181
                PP  Q FV+ IH  +R++P TIL+YCHVLYLALFAGGKL++SN+YR  GLFP F+
Sbjct: 127 ATFEKPPLLQQFVDDIHDNIRQEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLFPNFE 186

Query: 182 HLTPEQIVRRGTNFFTFSEEGADAEGKLRWEYKKGYELATRKELTEEQKQEIIKVSSEIF 241
            LT +++V++GTNFFTFSE G   E +L+WEYKK YELATR ELTE QK +II V+  IF
Sbjct: 187 KLTQKELVKKGTNFFTFSELGPTEETRLKWEYKKNYELATRTELTEAQKLKIISVAEGIF 246

Query: 242 DWNMDVIGELGEINRNELMGKFSFKLVSFILEEWKYSEKLS--KENKITILVIFAILQFL 299
           DWN +++ E+GE+NR ELM KFSFK V+++ EEW +S+  +  K    T+L++ +I    
Sbjct: 247 DWNFNIVAEIGELNRRELMSKFSFKCVTYVYEEWMFSKGSASRKAFSTTMLLMLSITAVW 306

Query: 300 LAYWLLRKLF 309
           + Y+ +R+ F
Sbjct: 307 ILYYFVRQNF 316

>Ecym_4729 Chr4 complement(1423384..1424364) [981 bp, 326 aa] {ON}
           similar to Ashbya gossypii ACL154W
          Length = 326

 Score =  368 bits (944), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 180/304 (59%), Positives = 220/304 (72%)

Query: 6   IPSPTDVGALANRINFHTRDSHNKINADMSVKLAFAMKHGHIYRQGILAFYYIFAAVEQE 65
           IPSPTDVGALANRINF TRD H K +A +  K+A AM+HG IYRQGILAFYYIF AVEQ+
Sbjct: 22  IPSPTDVGALANRINFCTRDMHTKADAFVMGKMALAMRHGFIYRQGILAFYYIFHAVEQQ 81

Query: 66  IDNLLQNASTPLELQTQKILNQFWCEEFRRSNMIFQDLELLYSKEYSTRTELHAFLDDNV 125
           ID LL+  ST  ELQ   IL QFWCEEFRRS  + +DLE  Y  EY T+ EL  FL+D  
Sbjct: 82  IDRLLETPSTKEELQISAILRQFWCEEFRRSGRLLRDLEFFYHHEYPTQNELQQFLNDFE 141

Query: 126 LPPQQQAFVEYIHQTVREKPYTILAYCHVLYLALFAGGKLMKSNIYRHTGLFPKFQHLTP 185
           LPP+ Q FV++I     E P TILAYCHVLY ALFAGGK+M+SNIYR+ GLFPK + ++ 
Sbjct: 142 LPPKLQRFVDFIRDKTMENPSTILAYCHVLYNALFAGGKVMRSNIYRNIGLFPKPKGISA 201

Query: 186 EQIVRRGTNFFTFSEEGADAEGKLRWEYKKGYELATRKELTEEQKQEIIKVSSEIFDWNM 245
            +  R GTNFFTFS++G D E KLRW+YKK YELATR+ L E QK EII VS   F   M
Sbjct: 202 AESSRNGTNFFTFSDDGVDEENKLRWQYKKNYELATREGLDENQKLEIIDVSIANFQAVM 261

Query: 246 DVIGELGEINRNELMGKFSFKLVSFILEEWKYSEKLSKENKITILVIFAILQFLLAYWLL 305
           D++GE+GE N+ ELM  FSFKL++F+  EW+Y++KLS E K  + +    + FL+ Y+ L
Sbjct: 262 DILGEIGETNKKELMNIFSFKLLTFLSNEWRYNQKLSSEVKQALAIAVFFINFLMIYFTL 321

Query: 306 RKLF 309
           R +F
Sbjct: 322 RTIF 325

>YLR205C Chr12 complement(552724..553677) [954 bp, 317 aa] {ON}
           HMX1ER localized heme oxygenase, involved in heme
           degradation during iron starvation and in the oxidative
           stress response; expression is regulated by AFT1 and
           oxidative stress; relocates to the perinuclear region in
           the presence of oxidants
          Length = 317

 Score =  367 bits (942), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 170/307 (55%), Positives = 229/307 (74%), Gaps = 2/307 (0%)

Query: 2   SATTIPSPTDVGALANRINFHTRDSHNKINADMSVKLAFAMKHGHIYRQGILAFYYIFAA 61
           S T IPSPTDVGALANRINF TRD+HNKIN  M +K+A AM+HG IYRQGILA+YY+F A
Sbjct: 5   SNTIIPSPTDVGALANRINFQTRDAHNKINTFMGIKMAIAMRHGFIYRQGILAYYYVFDA 64

Query: 62  VEQEIDNLLQNASTPLELQTQKILNQFWCEEFRRSNMIFQDLELLYSKEYSTRTELHAFL 121
           +EQEID LL +  T  ELQT  IL QFW E+FRRS  I++DL+LLYS  + +   L+ FL
Sbjct: 65  IEQEIDRLLNDPVTEEELQTSTILKQFWLEDFRRSTQIYKDLKLLYSNTFKSTESLNEFL 124

Query: 122 DDNVLPPQQQAFVEYIHQTVREKPYTILAYCHVLYLALFAGGKLMKSNIYRHTGLFPKFQ 181
                PP  Q F+  IH+ + ++P TIL+YCHVLYLALFAGGKL++SN+YR  GLFP F+
Sbjct: 125 ATFQKPPLLQQFINNIHENIHKEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLFPNFE 184

Query: 182 HLTPEQIVRRGTNFFTFSEEGADAEGKLRWEYKKGYELATRKELTEEQKQEIIKVSSEIF 241
            L+ +++V++GTNFFTFS+ G   E +L+WEYKK YELATR ELTE QK +II V+  IF
Sbjct: 185 KLSQKELVKKGTNFFTFSDLGPTEETRLKWEYKKNYELATRTELTEAQKLQIISVAEGIF 244

Query: 242 DWNMDVIGELGEINRNELMGKFSFKLVSFILEEWKYSEKLSKENKI--TILVIFAILQFL 299
           DWN +++ E+GE+NR ELMGKFSFK ++++ EEW +++  +    +   +L++ +I+   
Sbjct: 245 DWNFNIVAEIGELNRRELMGKFSFKCITYLYEEWMFNKDSATRRALHTVMLLVLSIIAIW 304

Query: 300 LAYWLLR 306
           + Y+L++
Sbjct: 305 VLYFLVK 311

>Skud_12.268 Chr12 complement(499347..500303) [957 bp, 318 aa] {ON}
           YLR205C (REAL)
          Length = 318

 Score =  365 bits (937), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 177/311 (56%), Positives = 230/311 (73%), Gaps = 4/311 (1%)

Query: 2   SATTIPSPTDVGALANRINFHTRDSHNKINADMSVKLAFAMKHGHIYRQGILAFYYIFAA 61
           + T IPSPTDVGALANRINFHTRD+HNKIN  M +++A AM+HG IYRQGILA+YY+F A
Sbjct: 5   TNTIIPSPTDVGALANRINFHTRDAHNKINTFMGIRMAIAMRHGFIYRQGILAYYYVFDA 64

Query: 62  VEQEIDNLLQNASTPLELQTQKILNQFWCEEFRRSNMIFQDLELLYSKEYSTRTELHAFL 121
           +EQEID LL +  T  ELQT  IL QFW E+FRRS  I++DL+LLYS  + +   L+ FL
Sbjct: 65  IEQEIDRLLHDPVTEKELQTSTILKQFWLEDFRRSTQIYKDLKLLYSNLFKSTESLNEFL 124

Query: 122 DDNVLPPQQQAFVEYIHQTVREKPYTILAYCHVLYLALFAGGKLMKSNIYRHTGLFPKFQ 181
                PP  Q FV  IH+ +R++P TIL+YCHVLYLALFAGGKL++SN+YR  GLFP F+
Sbjct: 125 AKFEKPPLLQQFVNDIHENIRKEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLFPNFE 184

Query: 182 HLTPEQIVRRGTNFFTFSEEGADAEGKLRWEYKKGYELATRKELTEEQKQEIIKVSSEIF 241
            L+ +++V++GTNFFTFS+ G   E +L+ EYKK YELATR ELTE QK +II V+  IF
Sbjct: 185 RLSQKELVKKGTNFFTFSDLGPTEETRLKLEYKKNYELATRTELTEAQKLQIISVAGGIF 244

Query: 242 DWNMDVIGELGEINRNELMGKFSFKLVSFILEEWKYSEKLS---KENKITILVIFAILQF 298
           DWN  ++ E+GE+NR ELMGKFSFK V+++ EEW  S+K S   K     +L++ +I+  
Sbjct: 245 DWNFHIVAEIGELNRRELMGKFSFKCVTYVYEEW-MSDKDSAFRKAFNTAMLLMLSIIAV 303

Query: 299 LLAYWLLRKLF 309
            + Y L++K F
Sbjct: 304 WVIYLLVKKNF 314

>Smik_12.263 Chr12 complement(499758..500714) [957 bp, 318 aa] {ON}
           YLR205C (REAL)
          Length = 318

 Score =  360 bits (924), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 165/275 (60%), Positives = 214/275 (77%)

Query: 6   IPSPTDVGALANRINFHTRDSHNKINADMSVKLAFAMKHGHIYRQGILAFYYIFAAVEQE 65
           IPSPTD+GALANRINFHTRD+HNKIN  M +K+A AM+HG IYRQGILA+YY+F A+EQE
Sbjct: 9   IPSPTDIGALANRINFHTRDAHNKINTFMGIKMAIAMRHGFIYRQGILAYYYVFDAIEQE 68

Query: 66  IDNLLQNASTPLELQTQKILNQFWCEEFRRSNMIFQDLELLYSKEYSTRTELHAFLDDNV 125
           ID LL +  T  ELQT  IL QFW E+FRRS  I++DL+LLYS  + +   L+ FL    
Sbjct: 69  IDRLLNDPVTGKELQTSAILKQFWLEDFRRSTQIYKDLKLLYSNTFKSTESLNEFLATFE 128

Query: 126 LPPQQQAFVEYIHQTVREKPYTILAYCHVLYLALFAGGKLMKSNIYRHTGLFPKFQHLTP 185
            PP  Q FV  IH+ ++++P TIL+YCHVLYLALFAGGKL++SN+YR  GLFP F+ L+ 
Sbjct: 129 KPPVLQQFVNNIHENIQKEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLFPNFEKLSQ 188

Query: 186 EQIVRRGTNFFTFSEEGADAEGKLRWEYKKGYELATRKELTEEQKQEIIKVSSEIFDWNM 245
           +++V++GTNFFTFS+ G   E +L+ EYKK YELATR ELTE QK +II V+  IFDWN 
Sbjct: 189 KELVKKGTNFFTFSDLGPTEETRLKLEYKKNYELATRTELTEAQKLQIISVAEGIFDWNF 248

Query: 246 DVIGELGEINRNELMGKFSFKLVSFILEEWKYSEK 280
           +++ E+GE+NR ELMGKFSFK V+++ EEW ++++
Sbjct: 249 NIVAEIGELNRRELMGKFSFKCVTYVYEEWMFNKE 283

>NCAS0E02890 Chr5 complement(565154..566101) [948 bp, 315 aa] {ON}
           Anc_7.344 YLR205C
          Length = 315

 Score =  330 bits (846), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 154/309 (49%), Positives = 219/309 (70%), Gaps = 3/309 (0%)

Query: 2   SATTIPSPTDVGALANRINFHTRDSHNKINADMSVKLAFAMKHGHIYRQGILAFYYIFAA 61
           + T IPSPTD  ALANRINF TRD+HNKIN  MS+KLA A++HG IYRQGIL +YYIF  
Sbjct: 5   TNTIIPSPTDTKALANRINFQTRDAHNKINKKMSIKLAIALRHGFIYRQGILTYYYIFKV 64

Query: 62  VEQEIDNLLQNASTPLELQTQKILNQFWCEEFRRSNMIFQDLELLYSKEYSTRTELHAFL 121
           VE+EI  L  + +T  E++   +L++ W  EF R+  + +DL+LLY  EY T+  L  FL
Sbjct: 65  VEEEIIKLTTSPTTSEEVKIGNLLSKTWIPEFNRTENLLKDLQLLYHDEYPTKEALQLFL 124

Query: 122 DDNV--LPPQQQAFVEYIHQTVREKPYTILAYCHVLYLALFAGGKLMKSNIYRHTGLFPK 179
           + N   LPP   +F++YIHQ++ E P +I AYCHVLYLALFAGGK+++S IY++ G  P 
Sbjct: 125 ETNATELPPVLDSFIKYIHQSILENPCSIFAYCHVLYLALFAGGKIIRSKIYKNLGFLPN 184

Query: 180 FQHLTPEQIVRRGTNFFTFSEEGADAEGKLRWEYKKGYELATRKELTEEQKQEIIKVSSE 239
           F HL+ +++  +GTNFF F  +G   E KL+ E+KK YEL TR+ L E++K  II+ S +
Sbjct: 185 FNHLSSKEVFEKGTNFFKFGSDGVIEETKLKLEFKKNYELNTRESLNEKEKSIIIETSKK 244

Query: 240 IFDWNMDVIGELGEINRNELMGKFSFKLVSFILEEWKYSEK-LSKENKITILVIFAILQF 298
           IFD+N+  + ELG IN+ +LM K +FK+V+++LEEWK+++  LSK  K  I+V+  +L  
Sbjct: 245 IFDYNLMAMEELGSINKEQLMSKLNFKMVTYLLEEWKFNDNFLSKRGKHLIMVVMVLLHM 304

Query: 299 LLAYWLLRK 307
           L A+++L++
Sbjct: 305 LFAFFILKR 313

>TPHA0F02920 Chr6 (645567..646529) [963 bp, 320 aa] {ON} Anc_7.344
           YLR205C
          Length = 320

 Score =  324 bits (830), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 158/290 (54%), Positives = 210/290 (72%), Gaps = 9/290 (3%)

Query: 6   IPSPTDVGALANRINFHTRDSHNKINADMSVKLAFAMKHGHIYRQGILAFYYIFAAVEQE 65
           IPSPTDV ALANRINF TRD HNKI A MS++LA A++HG IYRQG++AFY+IF  +E E
Sbjct: 7   IPSPTDVKALANRINFETRDFHNKIGAFMSIRLALALRHGFIYRQGLVAFYHIFGTIENE 66

Query: 66  IDNLLQNASTPLE---LQTQKILNQFWCEEFRRSNMIFQDLELLYSKEY-STRTELHAFL 121
           IDNLL    + L+   +QT+KIL  F+  EFRR + + QDL +LY  E+   R ++  FL
Sbjct: 67  IDNLLNTLDSELDSVQIQTKKILKSFYVNEFRRKDNLLQDLTVLYYPEFKGNRQDVLDFL 126

Query: 122 DDNVLP----PQQQAFVEYIHQTVREKPYTILAYCHVLYLALFAGGKLMKSNIYRHTGLF 177
           +         P+   F +YI  T +EKPYTI+AYCHVLYLALFAGGK+MKSN+ ++ GLF
Sbjct: 127 NSETFNKENYPELNFFTDYIKDTTKEKPYTIIAYCHVLYLALFAGGKIMKSNVLKNVGLF 186

Query: 178 PKFQHLTPEQIVRRGTNFFTFSEEG-ADAEGKLRWEYKKGYELATRKELTEEQKQEIIKV 236
           PKF H++ E++  +G+NFF F++E  AD + KLR+EYKK YEL+TR EL E QK +II+V
Sbjct: 187 PKFDHMSHEEVTNQGSNFFRFTQEDTADFDSKLRFEYKKNYELSTRDELNEMQKNDIIEV 246

Query: 237 SSEIFDWNMDVIGELGEINRNELMGKFSFKLVSFILEEWKYSEKLSKENK 286
           S  IF    +VI E+G  NR +LMG F+ K +++++EEWKY+EKL+K NK
Sbjct: 247 SKNIFVMLENVIAEIGAKNRTKLMGGFTLKTITYLVEEWKYNEKLTKTNK 296

>Kpol_530.36 s530 complement(84853..85788) [936 bp, 311 aa] {ON}
           complement(84853..85788) [936 nt, 312 aa]
          Length = 311

 Score =  313 bits (803), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 159/311 (51%), Positives = 216/311 (69%), Gaps = 9/311 (2%)

Query: 3   ATTIPSPTDVGALANRINFHTRDSHNKINADMSVKLAFAMKHGHIYRQGILAFYYIFAAV 62
            +TIPSPTDVGALANRINF TRD HNK++A M ++LA A+KHG IYR+G++ FY+IF  +
Sbjct: 2   TSTIPSPTDVGALANRINFETRDFHNKVSAFMGIRLALALKHGFIYREGLVVFYHIFNTI 61

Query: 63  EQEIDNLLQNASTPLELQTQKILNQFWCEEFRRSNMIFQDLELLYSKEY-STRTELHAFL 121
           E EID +L N     + Q + IL+ F+ +EFRR + I +DLELLY  E+ + R +L  F+
Sbjct: 62  ETEIDLVLNNQD---DSQMKLILSSFYLDEFRRKDKILKDLELLYYPEFQNDRPQLLEFI 118

Query: 122 DDNVL---PPQQQAFVEYIHQTVREKPYTILAYCHVLYLALFAGGKLMKSNIYRHTGLFP 178
           + +       Q Q FV+YI     E P T+LAYCHVLYLALFAGGK+MKSN+ +H G+FP
Sbjct: 119 NSDRFTNDSEQLQNFVKYIQTNATEDPCTLLAYCHVLYLALFAGGKIMKSNVTKHLGIFP 178

Query: 179 KFQHLTPEQIVRRGTNFFTFSEEG--ADAEGKLRWEYKKGYELATRKELTEEQKQEIIKV 236
           KF+HL+ ++I+ RGTNF+ F++       + KLRW YKK YEL+TR EL E+QK  +IK 
Sbjct: 179 KFEHLSHKEIIARGTNFYQFTDSTNPETTDVKLRWLYKKNYELSTRDELLEQQKLTVIKT 238

Query: 237 SSEIFDWNMDVIGELGEINRNELMGKFSFKLVSFILEEWKYSEKLSKENKITILVIFAIL 296
           S ++F    + I E+G  NRNELM  FS+KL +FI+EEWKY+  +S   K +++ I  I+
Sbjct: 239 SKDVFVMLENCIAEVGTRNRNELMNIFSYKLFTFIVEEWKYNSSISPFLKKSLMFILIII 298

Query: 297 QFLLAYWLLRK 307
           QF LA  LL +
Sbjct: 299 QFTLASVLLNR 309

>NDAI0E04500 Chr5 complement(1009814..1010797) [984 bp, 327 aa] {ON}
           Anc_7.344 YLR205C
          Length = 327

 Score =  293 bits (750), Expect = 5e-98,   Method: Compositional matrix adjust.
 Identities = 145/324 (44%), Positives = 213/324 (65%), Gaps = 18/324 (5%)

Query: 2   SATTIPSPTDVGALANRINFHTRDSHNKINADMSVKLAFAMKHGHIYRQGILAFYYIFAA 61
           + T IPSPTD  ALANRINFHTRD+HNKI+  M++KLA A++HG IYRQGIL +YYIF A
Sbjct: 5   TVTIIPSPTDTEALANRINFHTRDAHNKIDKKMTLKLAVALRHGDIYRQGILTYYYIFQA 64

Query: 62  VEQEIDNLL--QNASTPLELQTQKILNQFWCEEFRRSNMIFQDLELLYSKEYSTRTELHA 119
           VE EI+ LL     +T  + +T  +L++ W  EF R++ +F+DL+LLYS  +    +L  
Sbjct: 65  VESEINYLLSFNTDATKEQKRTGSLLSKIWLTEFNRTDKLFKDLKLLYSDRFQNDQDLLN 124

Query: 120 FLDDNVLPPQQQA------FVEYIHQTVREKPYTILAYCHVLYLALFAGGKLMKSNIYRH 173
           F+++      Q        FV +IH +++  P  ILAYCHVLYLALFAGGK++KS IY++
Sbjct: 125 FINEEFKLIHQNKNSKLYQFVNFIHISIQTNPCCILAYCHVLYLALFAGGKIIKSKIYKN 184

Query: 174 TGLFPKFQHLTPEQIVRRGTNFFTFSEEGADAEG--------KLRWEYKKGYELATRKEL 225
            G  P F HL+ +++    TNFF F+E     EG        KL+ ++K+ +EL TR  L
Sbjct: 185 LGFLPNFNHLSSKELFNNATNFFQFTENSDSLEGINSISNENKLKLKFKRNFELNTRSNL 244

Query: 226 TEEQKQEIIKVSSEIFDWNMDVIGELGEINRNELMGKFSFKLVSFILEEWKYSEKLSKEN 285
            E +K  II+++ +IF WN++ + ELG+ N+ ELM  FSFKL++++ EEWK+++ + K  
Sbjct: 245 NENEKLTIIEIAKQIFQWNLESMEELGQRNQKELMNLFSFKLINYLFEEWKFNDSIKKNF 304

Query: 286 KITILVIFAILQFLLAYWLLRKLF 309
           K   +++F IL  L+ +++ R LF
Sbjct: 305 K--AILMFVILLLLIQFFVSRSLF 326

>CAGL0A03905g Chr1 complement(395219..396067) [849 bp, 282 aa] {ON}
           similar to uniprot|P32339 Saccharomyces cerevisiae
           YLR205c
          Length = 282

 Score =  291 bits (745), Expect = 7e-98,   Method: Compositional matrix adjust.
 Identities = 138/257 (53%), Positives = 184/257 (71%), Gaps = 11/257 (4%)

Query: 34  MSVKLAFAMKHGHIYRQGILAFYYIFAAVEQEIDNLLQ-----NASTPLELQTQKIL--- 85
           MSV+ A A++HG +YRQGILAFYY+F A+EQEID LL       A+   ++  QK+L   
Sbjct: 1   MSVRFAVALRHGKLYRQGILAFYYVFQAIEQEIDALLSIDTATGATGATDVSDQKLLASK 60

Query: 86  --NQFWCEEFRRSNMIFQDLELLYSKEYSTRTELHAFLDDNVLPPQQQAFVEYIHQTVRE 143
              QFW  EFRR+  +++DL LLYS EY T TEL A L D+ LPPQ Q FV+ +H TVR+
Sbjct: 61  IVKQFWMPEFRRTEQLYKDLLLLYSPEYPTSTELDAMLVDHQLPPQLQGFVDMVHATVRQ 120

Query: 144 KPYTILAYCHVLYLALFAGGKLMKSNIYRHTGLFPKFQHLTPEQIVRRGTNFFTFSEEGA 203
            P T+LAYCHV+YLALFAGGK+M+S +YR+TGLFPKF+HL+ +++ R+GTNFFTFS+ G 
Sbjct: 121 NPVTVLAYCHVMYLALFAGGKVMRSTLYRNTGLFPKFEHLSSKELARKGTNFFTFSDAGV 180

Query: 204 DAEGKLRWEYKKGYELATRKELTEEQKQEIIKVSSEIFDWNMDVIGELGEINRNELMGKF 263
           D E +L+W+YKK YELATR+ L E  K EII V+  IF+ NMD+I E+G++N+  L    
Sbjct: 181 DVENQLKWQYKKNYELATREALAENDKLEIIDVAKRIFERNMDIIQEIGQLNKEALTNN- 239

Query: 264 SFKLVSFILEEWKYSEK 280
              L+ ++ EE K+  K
Sbjct: 240 KLDLLQYVFEELKFYNK 256

>ACL154W Chr3 (83962..84921) [960 bp, 319 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YLR205C (HMX1)
          Length = 319

 Score =  271 bits (694), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 137/283 (48%), Positives = 184/283 (65%), Gaps = 1/283 (0%)

Query: 2   SATTIPSPTDVGALANRINFHTRDSHNKINADMSVKLAFAMKHGHIYRQGILAFYYIFAA 61
           ++  +P PTD GALANRINFHTR+ H+K +A +S K A A++H  IYRQG+LA YYIF +
Sbjct: 14  ASPVVPLPTDTGALANRINFHTRELHSKADAFVSAKFAVALRHPSIYRQGLLAMYYIFRS 73

Query: 62  VEQEIDNLLQNASTPLELQTQKILNQFWCEEFRRSNMIFQDLELLYSKEYSTRTELHAFL 121
           VEQ ID LL+  +T  E +  +IL  FW  EF R+  + QD E+ Y+ EYST  +LH FL
Sbjct: 74  VEQHIDRLLRAPATADEARIGEILRAFWRPEFARAPALVQDFEVYYAAEYSTSAQLHQFL 133

Query: 122 DDNVLPPQQQAFVEYIHQTVREKPYTILAYCHVLYLALFAGGKLMKSNIYRHTGLFPKFQ 181
           D   LPP+  A V  I      +P+TILA+CHVLYLALFAGG++M+S + R  GL P+  
Sbjct: 134 DSYELPPRLAAAVADIEAAALRQPWTILAHCHVLYLALFAGGRVMRSALSRQLGLLPRAA 193

Query: 182 HLTPEQIVRRGTNFFTFSEEGADAEGKLRWEYKKGYELATRKELTEEQKQEIIKVSSEIF 241
            L+  +   RGT+FFTF   GA  E K R  YK+ YELATR  L+E +K ++I  +   F
Sbjct: 194 GLSARETQLRGTHFFTFG-AGAGEENKARVAYKRAYELATRTALSEAEKADVIDAARADF 252

Query: 242 DWNMDVIGELGEINRNELMGKFSFKLVSFILEEWKYSEKLSKE 284
           D    V+ EL   NR EL+G  S++L++F+ EEW+Y  K S +
Sbjct: 253 DHIQAVMAELAVRNRQELLGSPSYRLLTFLGEEWRYRTKNSPQ 295

>KAFR0L01470 Chr12 (272767..273669) [903 bp, 300 aa] {ON} Anc_7.344
           YLR205C
          Length = 300

 Score =  239 bits (610), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 118/298 (39%), Positives = 191/298 (64%), Gaps = 17/298 (5%)

Query: 6   IPSPTDVGALANRINFHTRDSHNKINADMSVKLAFAMKHGHIYRQGILAFYYIFAAVEQE 65
           +PSPTD  ALANRINFHTRD HN I+  MS+K  FA++H  IY+  +L++YY+F  +E E
Sbjct: 5   VPSPTDTDALANRINFHTRDLHNVIDKTMSIKATFALRHSFIYKDILLSYYYVFRTLEDE 64

Query: 66  IDNLLQNASTPLELQTQKILNQFWCEEFRRSNMIFQDLELLYSKEYSTRTELHAFLDDNV 125
           ID ++ N  +       +IL  F+ ++FRR + I +DL+ L   +  +        DD  
Sbjct: 65  IDFIISNDRS----HIGEILRGFFNDKFRRKDQILKDLKFLNVIQDQS--------DDQW 112

Query: 126 LP--PQQQAFVEYIHQTVREKPYTILAYCHVLYLALFAGGKLMKSNIYRHTGLF--PKFQ 181
           L   P+   F+ +I   + E P  +LAYCHVLYLALFAGG++M++++ ++   F  PKF 
Sbjct: 113 LSSRPELCKFLNFIKSNLHEHPVDVLAYCHVLYLALFAGGRIMRASMNKNLSFFFMPKFD 172

Query: 182 HLTPEQIVRRGTNFFTFSEEGADAEGKLRWEYKKGYELATRKELTEEQKQEIIKVSSEIF 241
            ++   ++   TNFF F ++   +E KL+ EYK+ Y++ T+ +L E++K EII +S EIF
Sbjct: 173 KMSHTDVIMNATNFFKFDKDIV-SENKLKSEYKRNYDILTKAKLNEDEKLEIIDISREIF 231

Query: 242 DWNMDVIGELGEINRNELMGKFSFKLVSFILEEWKYSEKLSKENKITILVIFAILQFL 299
            +N +++ E+G +N++ELM  F++K+V++++EEWK+ +   K+  I  L+IF +  F+
Sbjct: 232 KFNFNLLQEIGTVNKDELMKNFNYKMVTYVVEEWKFRKPQIKKYVILFLIIFHLFVFI 289

>KNAG0B02640 Chr2 complement(510618..511526) [909 bp, 302 aa] {ON}
           Anc_7.344 YLR205C
          Length = 302

 Score =  224 bits (571), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 121/287 (42%), Positives = 169/287 (58%), Gaps = 18/287 (6%)

Query: 4   TTIPSPTDVGALANRINFHTRDSHNKINADMSVKLAFAMKHGHIYRQGILAFYYIFAAVE 63
           +TIPSPTD  ALANRINFHTRD HN+++   SVK   A++H  IY   +  FY +F  VE
Sbjct: 3   STIPSPTDTDALANRINFHTRDLHNEVDKAFSVKFMMALRHSFIYTDILKTFYTVFGTVE 62

Query: 64  QEIDNLLQNASTPLELQTQKILNQFWCEEFRRSNMIFQDLELLYSKEYSTRTELHAFLDD 123
           Q ID L+ +           IL +F+  EFRR++ I +DL  L   E+ T          
Sbjct: 63  QRIDELIASEGGD---GVGAILGEFYVPEFRRADKIKRDLVFL--GEWDTVESGQW---- 113

Query: 124 NVLPPQQQAFVEYIHQTVREKPYTILAYCHVLYLALFAGGKLMKSNIYRHTGLFPKF--- 180
              PPQ   F++Y+   +   P T+LA CHVLYLALFAGG++ KS+++++ G  P F   
Sbjct: 114 -TPPPQLAGFLQYLRSEMDRDPITVLAPCHVLYLALFAGGRVFKSSLFKNLGFLPNFRDK 172

Query: 181 ----QHLTPEQIVRRGTNFFTFSEEGADAEGKLRWEYKKGYELATRKELTEEQKQEIIKV 236
               + ++   +V   TNFF F+E   D E KLRW YK+ YELATR  LTE+QK  +I  
Sbjct: 173 NGPGEEMSDHTLVSNATNFFQFAETIED-ENKLRWTYKRNYELATRDTLTEDQKLAVIAA 231

Query: 237 SSEIFDWNMDVIGELGEINRNELMGKFSFKLVSFILEEWKYSEKLSK 283
           S ++F     VI E+ + N +ELM   SFK+V++ LEEWK+++   +
Sbjct: 232 SRDVFRHTFAVIEEICQQNHDELMSFRSFKIVTYFLEEWKFNKNFKR 278

>CAGL0K09988g Chr11 (977846..978436) [591 bp, 196 aa] {ON} similar
           to uniprot|P38962 Saccharomyces cerevisiae YDR084c
          Length = 196

 Score = 34.3 bits (77), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 33/131 (25%), Positives = 51/131 (38%), Gaps = 8/131 (6%)

Query: 147 TILAYCHVLYLALFAGGKLMKSNIYRHTGLFPKFQHLTPEQIVRRGTNFFTFSEEGADAE 206
           TIL   H L +A    GK      Y    LFP F  L    ++    +F+          
Sbjct: 10  TILRSSHPLLMAFHLAGKAAPLAFYIAGFLFPSFTALFITIVLLLAADFYFTKNISGRRL 69

Query: 207 GKLRWEYKKGYELATRKELTEEQKQ-----EIIKVSSEIFDWNMDVIGELGEINRNELMG 261
            +LRW Y      +T     E  KQ      I  + S++F W+M +   +  +    ++ 
Sbjct: 70  VQLRWWYDSS-ATSTETFTFESHKQYTAGPPINPIDSKLFWWSMYLTPAIWFV--LGILA 126

Query: 262 KFSFKLVSFIL 272
               KL++FIL
Sbjct: 127 ILRLKLITFIL 137

>CAGL0G08492g Chr7 (802604..804190) [1587 bp, 528 aa] {ON} some
           similarities with uniprot|P17214 Saccharomyces
           cerevisiae YLR233c EST1 telomere elongation protein
          Length = 528

 Score = 31.6 bits (70), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 55/247 (22%), Positives = 99/247 (40%), Gaps = 33/247 (13%)

Query: 6   IPSPTDVGALANRINFHTRDSHNKINADMSVKLAFAMKHG----HIYRQGILAFYYIFAA 61
           I SPT +  L + +N  +  +   I+A   + L           HI    + + + +  +
Sbjct: 155 IFSPTIIKQLLSILNVESLPTKTTISASARISLPIIQSVNQLLLHIGDTQVKSSFILGKS 214

Query: 62  VEQEIDNL--LQNASTPLELQT-QKILNQFWCEEFRRSNMIFQDLELLYSKEYSTRTELH 118
           +  +I N   L +  TP E    QKI + FW E     N I + +E +     +TR    
Sbjct: 215 LGFDIPNTYYLSSLITPYEGTCRQKIADYFW-ETKMYDNFIIKLIESMIVPTRNTR---- 269

Query: 119 AFLDDNVLPPQQQAFVEYIHQTVREKPYTILAYCHVLYLALFAGGKLMKSNIYRHTGLFP 178
                    P Q  F+EY  +  R    T + YC    + +   G + +S      G+  
Sbjct: 270 ---------PTQIMFLEYFKRYTRSSFATFINYC----IKIINKGDIEQSMSLETEGILQ 316

Query: 179 KFQHLTPEQIVRRG---TNFFTFSEEGADAEGKLRWEYKKGYELATRKELTEEQKQEIIK 235
            FQ+  P QI+ +      FF      A + G   +EY    +L+ +    +++ + I++
Sbjct: 317 FFQN--PSQILDQALLMIYFFHICPLLA-SHGNFEYEYDNIKKLSYKN--LDDRHKAILQ 371

Query: 236 VSSEIFD 242
           +  EI +
Sbjct: 372 LIFEILE 378

>Smik_3.29 Chr3 complement(45086..45913) [828 bp, 275 aa] {ON}
           YCL047C (REAL)
          Length = 275

 Score = 30.0 bits (66), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 37/134 (27%), Positives = 60/134 (44%), Gaps = 17/134 (12%)

Query: 91  EEFRRSNMIFQDLELLYSKEYSTRTELHAFLDDNVLPPQQQAFVEYIHQTVREKPYTIL- 149
           E+FR+SN +FQ ++     E+        F+ D+   P   A  + + QTV+   + +  
Sbjct: 23  EQFRKSNSLFQIIKGPQHLEFPK-----LFVLDSSFNPPHLAHFQLLSQTVKN--FKLRN 75

Query: 150 AYCHV-LYLALFAGGKLMKSNIYRH----TGLFPKF-QHLTPEQIVRRGTNFFTFSEEGA 203
            + HV L LA+    KL K   + H      LF  + Q   P  +V  G   F+   +  
Sbjct: 76  THSHVLLLLAVNNADKLPKPASFPHRLEMMCLFADYLQEKLPHSVVSVGLTVFS---KFI 132

Query: 204 DAEGKLRWEYKKGY 217
           D +  LR ++ KGY
Sbjct: 133 DKDIVLREQFTKGY 146

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.323    0.137    0.404 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 32,252,209
Number of extensions: 1407112
Number of successful extensions: 4286
Number of sequences better than 10.0: 32
Number of HSP's gapped: 4389
Number of HSP's successfully gapped: 32
Length of query: 309
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 200
Effective length of database: 40,982,805
Effective search space: 8196561000
Effective search space used: 8196561000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 65 (29.6 bits)