Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0F10978g7.340ON40540519770.0
Ecym_45197.340ON4323896922e-86
ACL159W7.340ON4133906415e-79
KLTH0H01474g7.340ON3813855351e-63
Kwal_56.246047.340ON3813824862e-56
KLLA0C16687g7.340ON3983904541e-51
TPHA0D045507.340ON4374202412e-21
NCAS0A140707.340ON1731131613e-12
Kpol_538.163.381ON63991722.6
KAFR0D026403.368ON776130712.9
ABR180W7.518ON2596112696.5
ZYRO0F11022g8.617ON71484687.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0F10978g
         (405 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0F10978g Chr6 complement(859590..860807) [1218 bp, 405 aa] {...   766   0.0  
Ecym_4519 Chr4 (1034982..1036280) [1299 bp, 432 aa] {ON} similar...   271   2e-86
ACL159W Chr3 (77497..78738) [1242 bp, 413 aa] {ON} NOHBY310; No ...   251   5e-79
KLTH0H01474g Chr8 complement(134657..135802) [1146 bp, 381 aa] {...   210   1e-63
Kwal_56.24604 s56 (1071942..1073087) [1146 bp, 381 aa] {ON} [con...   191   2e-56
KLLA0C16687g Chr3 (1461624..1462820) [1197 bp, 398 aa] {ON} cons...   179   1e-51
TPHA0D04550 Chr4 (993082..994395) [1314 bp, 437 aa] {ON} Anc_7.340     97   2e-21
NCAS0A14070 Chr1 (2767470..2767991) [522 bp, 173 aa] {ON} Anc_7....    67   3e-12
Kpol_538.16 s538 (31742..33661) [1920 bp, 639 aa] {ON} (31742..3...    32   2.6  
KAFR0D02640 Chr4 complement(527097..529427) [2331 bp, 776 aa] {O...    32   2.9  
ABR180W Chr2 (742457..750247) [7791 bp, 2596 aa] {ON} Syntenic h...    31   6.5  
ZYRO0F11022g Chr6 (899338..901482) [2145 bp, 714 aa] {ON} simila...    31   7.5  

>SAKL0F10978g Chr6 complement(859590..860807) [1218 bp, 405 aa] {ON}
           conserved hypothetical protein
          Length = 405

 Score =  766 bits (1977), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/405 (92%), Positives = 376/405 (92%)

Query: 1   MRVLVXXXXXXXXXXXXXXXXXQACYRVSCTQCQLFEPVLKYCPLCMEVPSRADQTHCTK 60
           MRVLV                 QACYRVSCTQCQLFEPVLKYCPLCMEVPSRADQTHCTK
Sbjct: 1   MRVLVLCDCSSKCKSLSQLNLCQACYRVSCTQCQLFEPVLKYCPLCMEVPSRADQTHCTK 60

Query: 61  NCFQCPRCKLGLVISSGSCDDGNKKYVFKCMGCHWDYKTPSVGKIRSLTKYIKSLKANEC 120
           NCFQCPRCKLGLVISSGSCDDGNKKYVFKCMGCHWDYKTPSVGKIRSLTKYIKSLKANEC
Sbjct: 61  NCFQCPRCKLGLVISSGSCDDGNKKYVFKCMGCHWDYKTPSVGKIRSLTKYIKSLKANEC 120

Query: 121 LLSRRFEVLERHYHSKRQLLDWGLTKTPLKIPLDGSLVADRRNVLQRLSQGDKLFELLDE 180
           LLSRRFEVLERHYHSKRQLLDWGLTKTPLKIPLDGSLVADRRNVLQRLSQGDKLFELLDE
Sbjct: 121 LLSRRFEVLERHYHSKRQLLDWGLTKTPLKIPLDGSLVADRRNVLQRLSQGDKLFELLDE 180

Query: 181 PCPMPLNDTSDALELPLQMHLRCKYKYSCPYCLNTLLKPETQPKSLKFYTTSFAVKYLPA 240
           PCPMPLNDTSDALELPLQMHLRCKYKYSCPYCLNTLLKPETQPKSLKFYTTSFAVKYLPA
Sbjct: 181 PCPMPLNDTSDALELPLQMHLRCKYKYSCPYCLNTLLKPETQPKSLKFYTTSFAVKYLPA 240

Query: 241 LSLAPRSQIDNKVYDDTRFALVINNPTSSEEMHITMSGSDGLFIPITEVRIRAVTPVTPS 300
           LSLAPRSQIDNKVYDDTRFALVINNPTSSEEMHITMSGSDGLFIPITEVRIRAVTPVTPS
Sbjct: 241 LSLAPRSQIDNKVYDDTRFALVINNPTSSEEMHITMSGSDGLFIPITEVRIRAVTPVTPS 300

Query: 301 HQDHGLKTIEQFILSVPTYKLTADTKLSRVERTKRLGKKNLNVYSTANNSSTSXXXXXXX 360
           HQDHGLKTIEQFILSVPTYKLTADTKLSRVERTKRLGKKNLNVYSTANNSSTS       
Sbjct: 301 HQDHGLKTIEQFILSVPTYKLTADTKLSRVERTKRLGKKNLNVYSTANNSSTSLLEDLED 360

Query: 361 XXXXXQGSGWCIVPVNVLNNASVHSLFITVATQKFKVTMNCVIKK 405
                QGSGWCIVPVNVLNNASVHSLFITVATQKFKVTMNCVIKK
Sbjct: 361 YKLLDQGSGWCIVPVNVLNNASVHSLFITVATQKFKVTMNCVIKK 405

>Ecym_4519 Chr4 (1034982..1036280) [1299 bp, 432 aa] {ON} similar to
           Ashbya gossypii ACL159W
          Length = 432

 Score =  271 bits (692), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 153/389 (39%), Positives = 229/389 (58%), Gaps = 20/389 (5%)

Query: 23  QACYRVSCTQCQLFEPVLKYCPLCMEVPSRADQTHCTKNCFQCPRCKLGLVISSGSCDDG 82
           + CY +SC +CQ FEPV+KYCP C+E P + DQ  C +NCFQCPRC + LVISS   D  
Sbjct: 43  RECYSLSCFRCQGFEPVVKYCPKCLEEPGKMDQIFCNRNCFQCPRCDISLVISSEKMDSD 102

Query: 83  NKKYVFKCMGCHWDYKTPSVGKIRSLTKYIKSLKANECLLSRRFEVLERHYHSKRQLLDW 142
            K Y+F C GC W + TP  GKI+SLTKYI  L +++   +R +E++  H H+K+QLL W
Sbjct: 103 KKCYLFNCTGCKWTFTTPPTGKIKSLTKYILELYSSKN--ARAYELIT-HLHNKKQLLQW 159

Query: 143 ---GLTKTPLKIPLDGSLVADRRNVLQRLSQGDKLFELLDEPCPMPLNDTSDALELPLQM 199
                    +   L+G+     R+++QRL+ G+KL +L+ E  P+PL D S+ +  P ++
Sbjct: 160 EGKAFKFDEIVSALEGNAP---RSIVQRLAVGEKLHQLISEQIPLPLKDDSNEVLYPKRL 216

Query: 200 HLRCKYKYSCPYCLNTLLKPETQPKSLKFYTTSFAVKYLPAL---SLAPRSQIDNKVYDD 256
           HL+CKY+Y+CP C +TL  P+  P S + +  SFA+  LP +    LA    +D++  D 
Sbjct: 217 HLKCKYRYTCPQCNHTLSVPDDSPSSSRLHKESFAMNILPRIRIEKLAVALGMDHQ--DP 274

Query: 257 TRFALVINNPTSSEEMHITMSGSDGLFIPITEVRIRAVTP-----VTPSHQDHGLKTIEQ 311
           + FA+V+ NP  S  +  T++ SD LF+PI +  I AV+      +  S +D  L+ +EQ
Sbjct: 275 SAFAIVVINPNPSRSIECTLTASDTLFMPIRKFNIPAVSVNDYKIIKNSGKDINLQILEQ 334

Query: 312 FILSVPTYKLTADTKLSRVERTKRLGKKNLNVYSTANNSSTSXXXXXXXXXXXXQGSGWC 371
           +    PTY L  D K++R ERT+RLG +     ST N+ +              +G GWC
Sbjct: 335 YAKFTPTYMLGNDHKINRAERTRRLGSRFPFQNSTTNSINLLDYDIDEDAKAIDKGDGWC 394

Query: 372 IVPVNVLNNASVHSLFITVATQKFKVTMN 400
           I+P+ +LN  + H L + V  + F+V +N
Sbjct: 395 ILPLKLLNKGN-HLLNLLVNIEGFEVRLN 422

>ACL159W Chr3 (77497..78738) [1242 bp, 413 aa] {ON} NOHBY310; No
           homolog in Saccharomyces cerevisiae
          Length = 413

 Score =  251 bits (641), Expect = 5e-79,   Method: Compositional matrix adjust.
 Identities = 136/390 (34%), Positives = 210/390 (53%), Gaps = 11/390 (2%)

Query: 23  QACYRVSCTQCQLFEPVLKYCPLCMEVPSRADQTHCTKNCFQCPRCKLGLVISSGSCDDG 82
           + C+ +SC +CQ FEPVLKYCP C+E P + DQ  C +NCFQCPRC + LVISS    + 
Sbjct: 22  KECHSISCFRCQEFEPVLKYCPKCLEEPGKIDQIFCNRNCFQCPRCNISLVISSEKVTED 81

Query: 83  NKKYVFKCMGCHWDYKTPSVGKIRSLTKYIKSLKANECLLSRRFEVLERHYHSKRQLLDW 142
           +K YVF C GC W + TP  GKI+SLTKY+  L  ++   SR +E++  H H+K+QLL W
Sbjct: 82  SKSYVFTCTGCKWSFTTPPTGKIKSLTKYVLELYNSKN--SRAYELMT-HLHNKKQLLQW 138

Query: 143 GLTKTPLKIPLDGSLVADRRNVLQRLSQGDKLFELLDEPCPMPLNDTSDALELPLQMHLR 202
                     ++       R+ +QRL+ G+KL  L++E    PL    + +  P + HL+
Sbjct: 139 EGRAFKFDEIVNALEGNAPRSFVQRLAAGEKLHHLINEELAQPLQQDMEHVLYPKRTHLK 198

Query: 203 CKYKYSCPYCLNTLLKPETQPKSLKFYTTSFAVKYLPALSLAPRSQ-IDNKVYDDTRFAL 261
           C+Y+Y CP C +TL  P+  P S K +  SFA+  LP + +   ++ +     D T  A+
Sbjct: 199 CRYRYMCPKCHHTLSMPDQTPASSKLHKESFAMNVLPHIRIETEARALGVDTQDPTALAI 258

Query: 262 VINNPTSSEEMHITMSGSDGLFIPITEVRIRAVTPVT-----PSHQDHGLKTIEQFILSV 316
           ++ NP     +   +S SD LF+P+ +  I +V P          +D  L+ +E ++  +
Sbjct: 259 IVMNPIPMRAVDFVLSASDTLFLPVRKFTIPSVAPDDSQLDRSQGKDVNLQILEHYVKFI 318

Query: 317 PTYKLTADTKLSRVERTKRLGKK-NLNVYSTANNSSTSXXXXXXXXXXXXQGSGWCIVPV 375
           PT  L  D KL+R ERT+RLG +      ++    +              QG  WCI+P+
Sbjct: 319 PTCMLGNDHKLNRAERTRRLGNRFQFQGSASPTPPNPVDYDIEEEARPLDQGDAWCILPL 378

Query: 376 NVLNNASVHSLFITVATQKFKVTMNCVIKK 405
            +L +  +H L + V    ++V +N   K+
Sbjct: 379 KLLRDG-LHLLNVLVTIGDWQVNLNLHFKQ 407

>KLTH0H01474g Chr8 complement(134657..135802) [1146 bp, 381 aa] {ON}
           conserved hypothetical protein
          Length = 381

 Score =  210 bits (535), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 124/385 (32%), Positives = 199/385 (51%), Gaps = 35/385 (9%)

Query: 25  CYRVSCTQCQLFEPVLKYCPLCMEVPSRADQTHCTKNCFQCPRCKLGLVISSGSCDDGNK 84
           C+RVSC  CQ  E ++KYCP C  V     Q  C  NC +CPRC+L L +S      G+K
Sbjct: 25  CHRVSCNWCQKPELLIKYCPGCFRVAESEGQLRCVHNCLECPRCELILSVSMEKLASGHK 84

Query: 85  KYVFKCMGCHWDYKTPSVGKIRSLTKYIKSLKANECLLSRRFEVLERHYHSKRQLLDWGL 144
           ++   C GC W YKTP V  +++LT  ++ L+  E   ++RF  L   Y  KR+      
Sbjct: 85  RFEMVCNGCSWRYKTPEVSTLKTLTGCVEELRKKEDPYTQRFNSLREFYGFKRE------ 138

Query: 145 TKTPLKIPLDGSLVAD---RRNVLQRLSQGDKLFELLDEPCPMPLNDTSDA--LELPLQM 199
               L+   +G  V++    + +  RL++  KL+++++E CP+   DT D+  + LPL +
Sbjct: 139 ----LQYMEEGGEVSESIASKELFDRLNE-TKLYKMINEECPIEFKDTKDSGDIALPLPL 193

Query: 200 HLRCKYKYSCPYCLNTLLKPETQPKSLKFYTTSFAVKYLPALSLAPRSQIDNKVYDDTRF 259
            LR K+ Y CP C   L K    P+S +F   SFA   LP+L +  RS+++  V D+   
Sbjct: 194 RLRAKFDYRCPSCGEWLTKSHPDPRSSRFLLESFAAHMLPSLEIVHRSKVEPSVSDENAM 253

Query: 260 ALVINNPTSSEE-MHITMSGSDGLFIPITEVRIRAVTPVTPSHQDHGLKTIEQFILSVPT 318
           ALV      S+  + IT+ GS  + IP+ +  +    PV     +  ++TI++ +  VPT
Sbjct: 254 ALVFTASDQSDTPVEITILGSATIHIPVRQFTLAYDGPV---KCESTMETIKRLVTRVPT 310

Query: 319 YKLTADTKLSRVERTKRLGKKNLNVYSTANNSSTSXXXXXXXXXXXXQGSGWCIVPVNVL 378
           Y+L ++T +   E+++RL +     +   NN                QGSGWCI+P+ +L
Sbjct: 311 YQLNSNTNILATEKSRRLTRPETAPHK--NN-------------MIDQGSGWCILPMYIL 355

Query: 379 NNASVHSLFITVATQKFKVTMNCVI 403
             A  H + +T+  +   VT+  V+
Sbjct: 356 EPAKTHRIQLTIPIKGVYVTLQAVL 380

>Kwal_56.24604 s56 (1071942..1073087) [1146 bp, 381 aa] {ON} [contig
           161] FULL
          Length = 381

 Score =  191 bits (486), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 126/382 (32%), Positives = 186/382 (48%), Gaps = 30/382 (7%)

Query: 25  CYRVSCTQCQLFEPVLKYCPLCMEVPSRADQTHCTKNCFQCPRCKLGLVISSGSCDDGNK 84
           C+RVSC  CQ  E ++K+CP C +     +Q  C KNCF+CPRC+L + +S     DG +
Sbjct: 25  CHRVSCRWCQKPELLIKFCPGCSKGAETKNQMSCNKNCFECPRCQLAVSVSMRKQGDGAR 84

Query: 85  KYVFKCMGCHWDYKTPSVGKIRSLTKYIKSLKANECLLSRRFEVLERHYHSKRQLLDWGL 144
            +   C GC W Y TP++ K R LT+++K L+  E    +RF  L + Y  K Q  +   
Sbjct: 85  CFELVCNGCLWKYTTPAMTKARPLTQFVKELQEKEDPHEQRFISLRKLYRDKIQFQNLET 144

Query: 145 TKTPLKIPLDGSLVADRRNVLQRLSQGDKLFELLDEPCPMPLNDT--SDALELPLQMHLR 202
           T       +D S     + V +RL+   KLFEL++E  P+P++    +     P    LR
Sbjct: 145 TDV-----IDPSFAT--KEVAERLNNM-KLFELVNEEFPLPIHKGTFTSWNSFPRARALR 196

Query: 203 CKYKYSCPYCLNTLLKPETQPKSLKFYTTSFAVKYLPALSLAPRSQIDNKVYDDTRFALV 262
            K+ Y CP C   L K    PKS +F   SFA+  LP L +  RS ID K+ D+   ALV
Sbjct: 197 GKFNYRCPACGEYLTKCHPDPKSSRFMLESFAMHQLPDLQVVSRSLIDPKIDDENSMALV 256

Query: 263 INNPTSSE-EMHITMSGSDGLFIPITEVRIRAVTPVTPSHQDHGLKTIEQFILSVPTYKL 321
               +S+     IT+       IP   VR   +T   PS  +   + I++    VPT++L
Sbjct: 257 FKASSSAHVATDITIVSCATAHIP---VRQFTLTRDIPSRNELTQEAIKRLASEVPTFQL 313

Query: 322 TADTKLSRVERTKRLGKKNLNVYSTANNSSTSXXXXXXXXXXXXQGSGWCIVPVNVLNNA 381
             +TK+   E+++R    N  V  T  N                QG+GWCI+P+ +L   
Sbjct: 314 NTNTKILAAEKSRR----NSKVERTHKNEIID------------QGNGWCIIPMYILEPT 357

Query: 382 SVHSLFITVATQKFKVTMNCVI 403
             H L +T+  +   VT   V+
Sbjct: 358 PTHKLQLTIPIEGVYVTFQVVL 379

>KLLA0C16687g Chr3 (1461624..1462820) [1197 bp, 398 aa] {ON}
           conserved hypothetical protein
          Length = 398

 Score =  179 bits (454), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 122/390 (31%), Positives = 195/390 (50%), Gaps = 29/390 (7%)

Query: 25  CYRVSCTQCQLFEPVLKYCPLCMEVPSRADQTHCTKNCFQCPRCKLGLVISSGSCDDGN- 83
           C+ +SC QCQ FE V KYC  C +  S+ D  +C KNCFQCP C + L I S   D+ N 
Sbjct: 25  CHLISCQQCQDFEVVGKYCSQCGKDASKNDAVYCHKNCFQCPCCAMSLQIISNK-DENNT 83

Query: 84  --KKYVFKCMGCHWDYKTPSVGKIRSLTKYIKSLKANECLLSRRFEVLERHYHSKRQLLD 141
             + Y FKC GC+W Y TP V KI+SLTKYI  L+ +     RRFE L + YH++  L  
Sbjct: 84  DHRSYSFKCQGCNWSYCTPVVPKIKSLTKYIIELEYST-DTHRRFESLRQFYHTRNTLN- 141

Query: 142 WGLTKTPLKIPLDGSLVADRRNVLQRLSQGDKLFELLDEPCPMPLND--TSDALELPLQM 199
             L+  P  +  D    ++  +  +RL+ G+ L++L++E   +P ++    +   LP   
Sbjct: 142 -SLSLKPESLKFDALDPSNLNSWWKRLANGEPLWKLINEENAIPFDELKQENKHWLPSLC 200

Query: 200 HLRCKYKYSCPYCLNTLLKPETQPKSLKFYTTSFAVKYLPALSLAPRSQIDN--KVYD-D 256
            LR KY Y CPYC   + + +  P ++K+  T      +P +S+    Q     K +D D
Sbjct: 201 KLRPKYNYFCPYCKRCMTRMDPTPDTVKWVKTPPIYSGIPRISVISSYQCTQLYKEFDHD 260

Query: 257 TRFALVINNPTSSEEMHITMSGSDGLFIPITEVRIRAVTPVTPSHQDHGLKTIEQFILSV 316
               L+I N        + ++  + L +P  E+ I A        +D  L+ ++  + S+
Sbjct: 261 NNLMLLIENTRQDSNATLKINAEESLLVPNHELSIFAAIKTNQKRKD-NLEQLQDVLHSL 319

Query: 317 PTYKLTA---DTKLSRVERTKRLGKKNLNVYSTANNSSTSXXXXXXXXXXXXQGSGWCIV 373
           PT+ L       KL RVE T+RLG   LN   +++N                +G+GW ++
Sbjct: 320 PTHMLNTSPDSDKLLRVENTRRLGL--LNKRLSSDN-----------LRIIDEGTGWIVI 366

Query: 374 PVNVLNNASVHSLFITVATQKFKVTMNCVI 403
           P+ ++N    + + I V  + + ++M+  I
Sbjct: 367 PLMIINRKPRYEIDIFVHFEDWDLSMSAFI 396

>TPHA0D04550 Chr4 (993082..994395) [1314 bp, 437 aa] {ON} Anc_7.340
          Length = 437

 Score = 97.4 bits (241), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 97/420 (23%), Positives = 181/420 (43%), Gaps = 55/420 (13%)

Query: 23  QACYRVSCTQCQLFEPVLKYCPLC---MEVPSRADQT----------------HCTKNCF 63
           + C+++SC  CQLF+   K+CP C    +VP  AD +                +CT  CF
Sbjct: 35  RKCHKISCDSCQLFQDYEKFCPYCCRNNKVPDCADGSRLSFEERYCQEICYDEYCTNGCF 94

Query: 64  QCPRCKLGLVIS---SGSCDDGNKKYV-FKCMGCHWDYKTPSVGKIRSLTKYIKSLKANE 119
           QCP+C   L +S   +    D N K + F+C  C W + T   G ++ L+K+I SL  N 
Sbjct: 95  QCPKCNNSLALSLCKNERLKDPNGKTISFQCYCCSWSWSTELPGNVKLLSKHIFSLHLNL 154

Query: 120 CLLSRRFEVLERHYHSKRQLLDWGLTKTPLK-IPLDGSLVADRRNVLQRL-SQGDKLFE- 176
               +RF+ L   Y +             +K I L    +   R +L  + ++ +  F  
Sbjct: 155 DPKFQRFKQLSNIYLNDSSDCSNNDPSYSVKDIYLKQGDLQSARGLLDIINNKKETSFNT 214

Query: 177 ----LLDEPCPMP--LNDTSDALELPLQMHLRCKYKYSCPYCLNTLLKPETQPKSLKFYT 230
               LL++  P     +DT+ +  LP    L  K++Y CP+C  T+LKP ++  S     
Sbjct: 215 SSTVLLNDQFPHQNLYDDTNTS--LPELSKLVMKFEYKCPHCEETILKPSSELYSSDNTY 272

Query: 231 TSFAVKYLPALSLAPRSQIDNKVYDDTRFALVINNPTSSEEMHITMSGSDGLFIPITEVR 290
            SFA   LP + ++    +   +       L++ N   +    +         I +++ +
Sbjct: 273 ESFAFTQLPTIEVSAIKDLKQDL------VLIMKNIEDNLNDFVQAEIITSDNIQLSQNK 326

Query: 291 IRAVTPVTPSHQDHGLKTIE--QFILSVPTYKL----TADTKLSRVERTKRLGKKNLNVY 344
              +       QD      E   ++  +P++ L      + K  R+E+ +RL K N N+ 
Sbjct: 327 FIFMKSTGDKLQDKSKYYAELMSYLEGLPSFDLNLCDNVNNKFVRIEKQRRLAKNN-NI- 384

Query: 345 STANNSSTSXXXXXXXXXXXXQGSGWCIVPVNVLNNASVHSLFITVATQKFKVTMNCVIK 404
           +  NN+++             +   + + P+ +L   +++ L +    + ++V++ C++K
Sbjct: 385 AVMNNANSP-------MNYKEESDRYIVSPIKILTETALNKLLVKYKFKTYEVSLECILK 437

>NCAS0A14070 Chr1 (2767470..2767991) [522 bp, 173 aa] {ON} Anc_7.340
          Length = 173

 Score = 66.6 bits (161), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 36/113 (31%), Positives = 59/113 (52%), Gaps = 4/113 (3%)

Query: 23  QACYRVSCTQCQLFEPVLKYCPLCMEVPSRADQ-THCTKNCFQCPRCKLGLVISSGSCDD 81
           + C+  +C  C+LF+P+ + CP C  +    D+ T C  +CFQCP C+  L +       
Sbjct: 18  KVCHNTTCPDCELFQPLQRECPQCQTITMHMDEDTRCKNDCFQCPNCETALTVLLAK-SS 76

Query: 82  GNKKYVFKCMGCHWDYKTP--SVGKIRSLTKYIKSLKANECLLSRRFEVLERH 132
             K+Y F C  C +DY TP  SV   RS+++ +  L     +   RF+ L+++
Sbjct: 77  RKKRYKFTCKHCDYDYVTPSMSVTDERSISQIVDHLNETLNVEYLRFQELKKN 129

>Kpol_538.16 s538 (31742..33661) [1920 bp, 639 aa] {ON}
           (31742..33661) [1920 nt, 640 aa]
          Length = 639

 Score = 32.3 bits (72), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 43/91 (47%), Gaps = 4/91 (4%)

Query: 141 DWGLTKTPLKIPLDGSLVADRRNVLQRLS--QGDKLFELLDEPCPMPLNDTSDALELPLQ 198
           D  L +    IPLDG ++   + VL +L    GD+L +L+ E   +    T   L+ P++
Sbjct: 124 DKNLKQLNHSIPLDGDIIRKYKEVLNKLDGYSGDELAKLM-EVFEIVNPTTGGKLQSPME 182

Query: 199 MHLRCKYKYSCPYCLNTLLKPET-QPKSLKF 228
            +L  +        +   L+PET Q + L F
Sbjct: 183 FNLMFETSIGPSSQMKGFLRPETAQGQFLNF 213

>KAFR0D02640 Chr4 complement(527097..529427) [2331 bp, 776 aa] {ON}
           Anc_3.368 YBR114W
          Length = 776

 Score = 32.0 bits (71), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 30/130 (23%), Positives = 56/130 (43%), Gaps = 14/130 (10%)

Query: 41  KYCPLCMEVPSRADQTHCTKNCFQCPRCKLGLVIS------SGSCDDGNKKYVFKCMGCH 94
           K+C LC  V    +    T N   CP C +GL I           D  NK+ +   +   
Sbjct: 541 KFCRLC--VQEYVESYLETNNNLTCPVCHIGLSIDLSQPSLEVDVDAFNKQSIVSRLNLK 598

Query: 95  WDYKTPSVGKIRSLTKYIKSLKANECLLSRRFEVLERHYHSKRQLLDWGLTKTPLK-IPL 153
             +++ +  KI +L + +  L++N   +     ++   + S   L++W L +   K + L
Sbjct: 599 GTWRSST--KIEALVEELYKLRSNVRTIK---SIVFSQFTSMLDLVEWRLKRAGFKTVKL 653

Query: 154 DGSLVADRRN 163
            GS+   +R+
Sbjct: 654 QGSMSPTQRS 663

>ABR180W Chr2 (742457..750247) [7791 bp, 2596 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YLR454W
          Length = 2596

 Score = 31.2 bits (69), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 29/112 (25%), Positives = 45/112 (40%), Gaps = 11/112 (9%)

Query: 75   SSGSCDDGNKKYVFKCMGCHWDYKTPSVGKIRSLTKYIKSL----KANECLLSRRFEVLE 130
            S+GS      K+   CM   WD     V     + KY+  L    +A     S+  +V+E
Sbjct: 1891 STGSVSPFENKFFVFCMQLKWDEDARDV-----IFKYLHLLELSSQAVTLTRSKTLQVIE 1945

Query: 131  RHYHSKRQLL--DWGLTKTPLKIPLDGSLVADRRNVLQRLSQGDKLFELLDE 180
            R  H K      D  +  +   IP+DG  ++      +   +   LFEL +E
Sbjct: 1946 RLCHRKLAYTKSDESIFSSISDIPIDGHDLSTAETSSEEQPKSQSLFELFEE 1997

>ZYRO0F11022g Chr6 (899338..901482) [2145 bp, 714 aa] {ON} similar
           to uniprot|P39744 Saccharomyces cerevisiae YOR206W NOC2
           Protein that forms a nucleolar complex with Mak21p that
           binds to 90S and 66S pre-ribosomes as well as a nuclear
           complex with Noc3p that binds to 66S pre- ribosomes both
           complexes mediate intranuclear transport of ribosomal
           precursors
          Length = 714

 Score = 30.8 bits (68), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 21/84 (25%), Positives = 37/84 (44%), Gaps = 5/84 (5%)

Query: 230 TTSFAVKYLPALSLAPRSQIDNKVYDDTRFALVINNPTSSEEMHITMSGSDG----LFIP 285
           T     K+   L  +P  +    V    + A+ +NN  S E+   +MS        LF+ 
Sbjct: 184 TLKLVKKWRDQLHNSPNFKTIRNVVSAFKMAINMNNDESKEDYKYSMSDERAFKELLFVA 243

Query: 286 ITEVRIRAVTPVTPSHQDHGLKTI 309
           + ++  RA+  + P H  HG +T+
Sbjct: 244 LRDLP-RAIQAMIPYHNKHGARTL 266

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.135    0.415 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 39,261,087
Number of extensions: 1661289
Number of successful extensions: 4337
Number of sequences better than 10.0: 18
Number of HSP's gapped: 4432
Number of HSP's successfully gapped: 19
Length of query: 405
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 293
Effective length of database: 40,638,807
Effective search space: 11907170451
Effective search space used: 11907170451
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 67 (30.4 bits)