Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0F10934g7.342ON4982518851e-113
Kwal_56.246107.342ON5082626312e-75
TDEL0C020507.342ON5012536277e-75
KLTH0H01430g7.342ON5022596042e-71
Smik_4.757.342ON4602535916e-70
Skud_4.947.342ON4472515811e-68
KNAG0C038007.342ON4472505774e-68
YDL161W (ENT1)7.342ON4542515766e-68
Suva_4.837.342ON4622515699e-67
Skud_12.2707.342ON6262755676e-65
KLLA0C16731g7.342ON4781285481e-63
CAGL0A03872g7.342ON5102575483e-63
NCAS0H006707.342ON4832605454e-63
Suva_10.3007.342ON6182635492e-62
TPHA0D045607.342ON4872515394e-62
ZYRO0F11550g7.342ON5382525417e-62
KAFR0L014607.342ON5502635373e-61
TBLA0E004807.342ON5992745342e-60
NDAI0D006107.342ON4862665263e-60
Smik_12.2647.342ON6122675334e-60
ACL157C7.342ON5152545274e-60
YLR206W (ENT2)7.342ON6131275291e-59
Ecym_47317.342ON5142575222e-59
Kpol_2001.707.342ON5331275205e-59
KAFR0B008907.342ON4141234961e-56
KNAG0B026507.342ON6461284187e-44
TBLA0E020407.342ON7012603942e-40
Suva_12.2164.346ON4101272309e-20
Kwal_47.168574.346ON3821262281e-19
Skud_10.3494.346ON4101272263e-19
TDEL0D007104.346ON3751272253e-19
SAKL0G17952g4.346ON4151272254e-19
KNAG0M003804.346ON4031272244e-19
Smik_10.4184.346ON4091272237e-19
YJR125C (ENT3)4.346ON4081272237e-19
KLTH0D16896g4.346ON4011262227e-19
NDAI0D032004.346ON4351272238e-19
TBLA0E047604.346ON4261272192e-18
KLLA0B04587g4.346ON4001262183e-18
KAFR0B067404.346ON3991272174e-18
CAGL0H04323g4.346ON4121232174e-18
ZYRO0B14784g4.346ON4241272157e-18
NCAS0A062104.346ON4231232141e-17
AER155C4.346ON3641272102e-17
Kpol_1001.24.346ON4181272094e-17
TPHA0B004004.346ON3991272051e-16
Ecym_11334.346ON3921231891e-14
Kwal_55.206114.17ON2541111682e-12
Kpol_388.54.17ON2681051452e-09
SAKL0H25762g4.17ON2621111433e-09
KLTH0E05874g4.17ON2551111407e-09
TBLA0B062204.346ON3391221411e-08
ZYRO0G07876g4.17ON2591001327e-08
TDEL0G017404.17ON2571291319e-08
TBLA0G006504.17ON4231241312e-07
KLLA0D03949g4.17ON2251021253e-07
TPHA0F002304.17ON2801211274e-07
ACL061C4.17ON2341151202e-06
Ecym_84074.17ON2541041202e-06
CAGL0E03806g4.17ON2601111142e-05
Suva_10.354.17ON2471081104e-05
YLL038C (ENT4)4.17ON2471151088e-05
Skud_12.304.17ON2471151079e-05
Smik_12.194.17ON2471151071e-04
NCAS0C058404.17ON2671211052e-04
YHR161C (YAP1801)5.84ON637721072e-04
SAKL0H02530g5.84ON669891072e-04
KAFR0B058008.335ON382971035e-04
CAGL0E01199g8.335ON412971018e-04
TBLA0H012108.335ON491971028e-04
NCAS0B036608.335ON4161021010.001
AGR046C8.335ON3871271010.001
NDAI0H002804.17ON310110990.001
Skud_8.2255.84ON621871010.001
NDAI0J009308.335ON41897990.001
ZYRO0F13684g8.335ON40797990.002
KLLA0D16654g8.335ON39997980.002
KNAG0A051008.335ON42197980.002
Smik_8.2455.84ON62772970.003
TBLA0A040408.335ON415114950.005
KLTH0G11902g8.335ON399114930.008
Kwal_YGOB_27.112618.335ON40497920.011
Kwal_27.11263singletonOFF27597900.013
Suva_2.3158.335ON40397900.018
SAKL0H15290g8.335ON393150900.021
TDEL0F045908.335ON36197880.033
Skud_4.4128.335ON40697870.038
Kpol_1036.768.335ON36897870.041
Smik_4.3988.335ON41697870.042
YDR153C (ENT5)8.335ON41197870.042
Kpol_344.88.335ON384102870.046
TPHA0C007408.335ON38597850.085
TBLA0B057705.84ON68072840.13
NDAI0A028305.84ON47377810.23
KNAG0E006105.84ON60472800.35
KAFR0I014604.17ON275114780.45
Ecym_42648.335ON40869760.92
NCAS0A032005.702ON1788100732.7
NCAS0E038205.84ON42872714.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0F10934g
         (498 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0F10934g Chr6 (856966..858462) [1497 bp, 498 aa] {ON} some s...   345   e-113
Kwal_56.24610 s56 complement(1073855..1075381) [1527 bp, 508 aa]...   247   2e-75
TDEL0C02050 Chr3 (355071..356576) [1506 bp, 501 aa] {ON} Anc_7.3...   246   7e-75
KLTH0H01430g Chr8 (132738..134246) [1509 bp, 502 aa] {ON} some s...   237   2e-71
Smik_4.75 Chr4 (144483..145865) [1383 bp, 460 aa] {ON} YDL161W (...   232   6e-70
Skud_4.94 Chr4 (163372..164715) [1344 bp, 447 aa] {ON} YDL161W (...   228   1e-68
KNAG0C03800 Chr3 (746891..748234) [1344 bp, 447 aa] {ON} Anc_7.3...   226   4e-68
YDL161W Chr4 (167714..169078) [1365 bp, 454 aa] {ON}  ENT1Epsin-...   226   6e-68
Suva_4.83 Chr4 (155278..156666) [1389 bp, 462 aa] {ON} YDL161W (...   223   9e-67
Skud_12.270 Chr12 (501192..503072) [1881 bp, 626 aa] {ON} YLR206...   223   6e-65
KLLA0C16731g Chr3 complement(1463616..1465052) [1437 bp, 478 aa]...   215   1e-63
CAGL0A03872g Chr1 complement(392922..394454) [1533 bp, 510 aa] {...   215   3e-63
NCAS0H00670 Chr8 (117595..119046) [1452 bp, 483 aa] {ON} Anc_7.342    214   4e-63
Suva_10.300 Chr10 (527412..529268) [1857 bp, 618 aa] {ON} YLR206...   216   2e-62
TPHA0D04560 Chr4 complement(994552..996015) [1464 bp, 487 aa] {O...   212   4e-62
ZYRO0F11550g Chr6 complement(947131..948747) [1617 bp, 538 aa] {...   213   7e-62
KAFR0L01460 Chr12 complement(270433..272085) [1653 bp, 550 aa] {...   211   3e-61
TBLA0E00480 Chr5 complement(88019..89818) [1800 bp, 599 aa] {ON}...   210   2e-60
NDAI0D00610 Chr4 (133678..135138) [1461 bp, 486 aa] {ON} Anc_7.3...   207   3e-60
Smik_12.264 Chr12 (501598..503436) [1839 bp, 612 aa] {ON} YLR206...   209   4e-60
ACL157C Chr3 complement(79325..80872) [1548 bp, 515 aa] {ON} Syn...   207   4e-60
YLR206W Chr12 (554578..556419) [1842 bp, 613 aa] {ON}  ENT2Epsin...   208   1e-59
Ecym_4731 Chr4 (1427875..1429419) [1545 bp, 514 aa] {ON} similar...   205   2e-59
Kpol_2001.70 s2001 complement(192214..193815) [1602 bp, 533 aa] ...   204   5e-59
KAFR0B00890 Chr2 (166365..167609) [1245 bp, 414 aa] {ON} Anc_7.3...   195   1e-56
KNAG0B02650 Chr2 (511995..513935) [1941 bp, 646 aa] {ON} Anc_7.3...   165   7e-44
TBLA0E02040 Chr5 complement(494899..497004) [2106 bp, 701 aa] {O...   156   2e-40
Suva_12.216 Chr12 complement(334254..335486) [1233 bp, 410 aa] {...    93   9e-20
Kwal_47.16857 s47 (145176..146324) [1149 bp, 382 aa] {ON} YJR125...    92   1e-19
Skud_10.349 Chr10 complement(613398..614630) [1233 bp, 410 aa] {...    92   3e-19
TDEL0D00710 Chr4 (127174..128301) [1128 bp, 375 aa] {ON} Anc_4.3...    91   3e-19
SAKL0G17952g Chr7 complement(1555520..1556767) [1248 bp, 415 aa]...    91   4e-19
KNAG0M00380 Chr13 (56675..57886) [1212 bp, 403 aa] {ON} Anc_4.34...    91   4e-19
Smik_10.418 Chr10 complement(643833..645062) [1230 bp, 409 aa] {...    91   7e-19
YJR125C Chr10 complement(654737..655963) [1227 bp, 408 aa] {ON} ...    91   7e-19
KLTH0D16896g Chr4 complement(1395711..1396916) [1206 bp, 401 aa]...    90   7e-19
NDAI0D03200 Chr4 complement(764129..765436) [1308 bp, 435 aa] {O...    91   8e-19
TBLA0E04760 Chr5 complement(1226806..1228086) [1281 bp, 426 aa] ...    89   2e-18
KLLA0B04587g Chr2 (411097..412299) [1203 bp, 400 aa] {ON} simila...    89   3e-18
KAFR0B06740 Chr2 (1406075..1407274) [1200 bp, 399 aa] {ON} Anc_4...    88   4e-18
CAGL0H04323g Chr8 (407884..409122) [1239 bp, 412 aa] {ON} simila...    88   4e-18
ZYRO0B14784g Chr2 complement(1205944..1207218) [1275 bp, 424 aa]...    87   7e-18
NCAS0A06210 Chr1 complement(1229758..1231029) [1272 bp, 423 aa] ...    87   1e-17
AER155C Chr5 complement(929042..930136) [1095 bp, 364 aa] {ON} S...    86   2e-17
Kpol_1001.2 s1001 (8057..9313) [1257 bp, 418 aa] {ON} (8057..931...    85   4e-17
TPHA0B00400 Chr2 (83356..84555) [1200 bp, 399 aa] {ON} Anc_4.346...    84   1e-16
Ecym_1133 Chr1 (274069..275247) [1179 bp, 392 aa] {ON} similar t...    77   1e-14
Kwal_55.20611 s55 complement(489968..490732) [765 bp, 254 aa] {O...    69   2e-12
Kpol_388.5 s388 complement(17825..18631) [807 bp, 268 aa] {ON} c...    60   2e-09
SAKL0H25762g Chr8 (2256842..2257630) [789 bp, 262 aa] {ON} some ...    60   3e-09
KLTH0E05874g Chr5 complement(530814..531581) [768 bp, 255 aa] {O...    59   7e-09
TBLA0B06220 Chr2 (1466908..1467927) [1020 bp, 339 aa] {ON} Anc_4...    59   1e-08
ZYRO0G07876g Chr7 complement(636468..637247) [780 bp, 259 aa] {O...    55   7e-08
TDEL0G01740 Chr7 (342371..343144) [774 bp, 257 aa] {ON} Anc_4.17...    55   9e-08
TBLA0G00650 Chr7 (140678..141949) [1272 bp, 423 aa] {ON} Anc_4.1...    55   2e-07
KLLA0D03949g Chr4 (333566..334243) [678 bp, 225 aa] {ON} similar...    53   3e-07
TPHA0F00230 Chr6 complement(43589..44431) [843 bp, 280 aa] {ON} ...    54   4e-07
ACL061C Chr3 complement(256803..257507) [705 bp, 234 aa] {ON} Sy...    51   2e-06
Ecym_8407 Chr8 (843359..844123) [765 bp, 254 aa] {ON} similar to...    51   2e-06
CAGL0E03806g Chr5 (356594..357376) [783 bp, 260 aa] {ON} similar...    49   2e-05
Suva_10.35 Chr10 complement(70188..70931) [744 bp, 247 aa] {ON} ...    47   4e-05
YLL038C Chr12 complement(65775..66518) [744 bp, 247 aa] {ON}  EN...    46   8e-05
Skud_12.30 Chr12 complement(56967..57710) [744 bp, 247 aa] {ON} ...    46   9e-05
Smik_12.19 Chr12 complement(50134..50877) [744 bp, 247 aa] {ON} ...    46   1e-04
NCAS0C05840 Chr3 (1202292..1203095) [804 bp, 267 aa] {ON} Anc_4....    45   2e-04
YHR161C Chr8 complement(420373..422286) [1914 bp, 637 aa] {ON}  ...    46   2e-04
SAKL0H02530g Chr8 (250148..252157) [2010 bp, 669 aa] {ON} weakly...    46   2e-04
KAFR0B05800 Chr2 complement(1200666..1201814) [1149 bp, 382 aa] ...    44   5e-04
CAGL0E01199g Chr5 (108041..109279) [1239 bp, 412 aa] {ON} simila...    44   8e-04
TBLA0H01210 Chr8 (269471..270946) [1476 bp, 491 aa] {ON} Anc_8.3...    44   8e-04
NCAS0B03660 Chr2 complement(653627..654877) [1251 bp, 416 aa] {O...    44   0.001
AGR046C Chr7 complement(800910..802073) [1164 bp, 387 aa] {ON} S...    44   0.001
NDAI0H00280 Chr8 complement(48177..49109) [933 bp, 310 aa] {ON} ...    43   0.001
Skud_8.225 Chr8 complement(391820..393685) [1866 bp, 621 aa] {ON...    44   0.001
NDAI0J00930 Chr10 (209579..210835) [1257 bp, 418 aa] {ON} Anc_8....    43   0.001
ZYRO0F13684g Chr6 complement(1125731..1126954) [1224 bp, 407 aa]...    43   0.002
KLLA0D16654g Chr4 complement(1413507..1414706) [1200 bp, 399 aa]...    42   0.002
KNAG0A05100 Chr1 (744989..746254) [1266 bp, 421 aa] {ON} Anc_8.3...    42   0.002
Smik_8.245 Chr8 complement(397342..399225) [1884 bp, 627 aa] {ON...    42   0.003
TBLA0A04040 Chr1 complement(1004703..1005950) [1248 bp, 415 aa] ...    41   0.005
KLTH0G11902g Chr7 (1002588..1003787) [1200 bp, 399 aa] {ON} simi...    40   0.008
Kwal_YGOB_27.11261 s27 complement(716644..717033,717035..717859)...    40   0.011
Kwal_27.11263 s27 complement(717032..717859) [828 bp, 275 aa] {O...    39   0.013
Suva_2.315 Chr2 complement(560767..560940,560968..561033,561037....    39   0.018
SAKL0H15290g Chr8 (1322030..1323211) [1182 bp, 393 aa] {ON} simi...    39   0.021
TDEL0F04590 Chr6 complement(864567..865652) [1086 bp, 361 aa] {O...    39   0.033
Skud_4.412 Chr4 complement(736255..737475) [1221 bp, 406 aa] {ON...    38   0.038
Kpol_1036.76 s1036 complement(205197..206303) [1107 bp, 368 aa] ...    38   0.041
Smik_4.398 Chr4 complement(724753..726003) [1251 bp, 416 aa] {ON...    38   0.042
YDR153C Chr4 complement(766736..767971) [1236 bp, 411 aa] {ON}  ...    38   0.042
Kpol_344.8 s344 complement(20765..21919) [1155 bp, 384 aa] {ON} ...    38   0.046
TPHA0C00740 Chr3 (144476..145633) [1158 bp, 385 aa] {ON} Anc_8.3...    37   0.085
TBLA0B05770 Chr2 complement(1364772..1366814) [2043 bp, 680 aa] ...    37   0.13 
NDAI0A02830 Chr1 (636619..638040) [1422 bp, 473 aa] {ON} Anc_5.8...    36   0.23 
KNAG0E00610 Chr5 complement(102826..104640) [1815 bp, 604 aa] {O...    35   0.35 
KAFR0I01460 Chr9 (304865..305692) [828 bp, 275 aa] {ON} Anc_4.17...    35   0.45 
Ecym_4264 Chr4 complement(558142..559368) [1227 bp, 408 aa] {ON}...    34   0.92 
NCAS0A03200 Chr1 complement(627997..633363) [5367 bp, 1788 aa] {...    33   2.7  
NCAS0E03820 Chr5 (750631..751917) [1287 bp, 428 aa] {ON} Anc_5.8...    32   4.0  

>SAKL0F10934g Chr6 (856966..858462) [1497 bp, 498 aa] {ON} some
           similarities with uniprot|Q12518 Saccharomyces
           cerevisiae YDL161W ENT1
          Length = 498

 Score =  345 bits (885), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 187/251 (74%), Positives = 187/251 (74%)

Query: 1   MSKALLRTAKNVVNGYSSVQVLVRNATSNEPTGPTVDQLDELAEKTYDNVEFFEIMDMLD 60
           MSKALLRTAKNVVNGYSSVQVLVRNATSNEPTGPTVDQLDELAEKTYDNVEFFEIMDMLD
Sbjct: 1   MSKALLRTAKNVVNGYSSVQVLVRNATSNEPTGPTVDQLDELAEKTYDNVEFFEIMDMLD 60

Query: 61  KRLNDKGKNWRHVAKSLTVLDYLVRYGSENCVLWSQENLYIIKTLREFMHEDEMGVDHGQ 120
           KRLNDKGKNWRHVAKSLTVLDYLVRYGSENCVLWSQENLYIIKTLREFMHEDEMGVDHGQ
Sbjct: 61  KRLNDKGKNWRHVAKSLTVLDYLVRYGSENCVLWSQENLYIIKTLREFMHEDEMGVDHGQ 120

Query: 121 IIRVKAKXXXXXXXXXXXXXXXXNMRKKRRGKTRRPERSRGGEEYDDDLQXXXXXXXXXX 180
           IIRVKAK                NMRKKRRGKTRRPERSRGGEEYDDDLQ          
Sbjct: 121 IIRVKAKELTSLLRDEERLTEERNMRKKRRGKTRRPERSRGGEEYDDDLQRALEESRLTA 180

Query: 181 XXXXXXXXXDSGSNDDDDFQTALQLSKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYYDV 240
                    DSGSNDDDDFQTALQLSK                             YYDV
Sbjct: 181 EEEERRRRTDSGSNDDDDFQTALQLSKEEEELRRLRNLQMQQQQTAMFQQQQQQPMYYDV 240

Query: 241 FGNPITPEEYM 251
           FGNPITPEEYM
Sbjct: 241 FGNPITPEEYM 251

 Score =  263 bits (673), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 134/172 (77%), Positives = 134/172 (77%)

Query: 327 TGSNNPFALGRQEPDEEQITPKVSESVXXXXXXXXXXXXXXXXXLNPTRTGNQSISQKYN 386
           TGSNNPFALGRQEPDEEQITPKVSESV                 LNPTRTGNQSISQKYN
Sbjct: 327 TGSNNPFALGRQEPDEEQITPKVSESVATTAGTTTATTTTQQQALNPTRTGNQSISQKYN 386

Query: 387 DLNNLLASGTGLDTFGNTGQTRIPAQHTRTGNFINSQGTGYKQVTNDQPKNNPFLAAQYT 446
           DLNNLLASGTGLDTFGNTGQTRIPAQHTRTGNFINSQGTGYKQVTNDQPKNNPFLAAQYT
Sbjct: 387 DLNNLLASGTGLDTFGNTGQTRIPAQHTRTGNFINSQGTGYKQVTNDQPKNNPFLAAQYT 446

Query: 447 GLPSTSVVPSYTGYGFGNXXXXXXXXXXXXXXXXXXXXXRGNPDQGISLIDL 498
           GLPSTSVVPSYTGYGFGN                     RGNPDQGISLIDL
Sbjct: 447 GLPSTSVVPSYTGYGFGNQQLSSQQGQQLQQQQQQQQQQRGNPDQGISLIDL 498

>Kwal_56.24610 s56 complement(1073855..1075381) [1527 bp, 508 aa]
           {ON} YDL161W (ENT1) - Ent1p [contig 161] FULL
          Length = 508

 Score =  247 bits (631), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 132/262 (50%), Positives = 160/262 (61%), Gaps = 15/262 (5%)

Query: 1   MSKALLRTAKNVVNGYSSVQVLVRNATSNEPTGPTVDQLDELAEKTYDNVEFFEIMDMLD 60
           MSK+L+R AKNVVNGYS+ QVL+R ATSN+P GP++D +DE+AE+++D+V FFEIMDMLD
Sbjct: 1   MSKSLIRKAKNVVNGYSTTQVLLREATSNDPEGPSLDIMDEIAERSWDSVSFFEIMDMLD 60

Query: 61  KRLNDKGKNWRHVAKSLTVLDYLVRYGSENCVLWSQENLYIIKTLREFMHEDEMGVDHGQ 120
           KRLNDKGKNWRHVAKSLTVLDYLVR GSE+CV W++ENLY+IKTLREFMHEDE+G+D GQ
Sbjct: 61  KRLNDKGKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYVIKTLREFMHEDELGIDQGQ 120

Query: 121 IIRVKAKXXXXXXXXXXXXXXXXNMRKKRRGKTRRPERSRGGEEYDDDLQXXXXXX--XX 178
           I+RVKA+                ++R K R   RRP  + G E  D+DLQ          
Sbjct: 121 IVRVKARELTALLLDDERLREERSLRTKNRKPRRRP--TAGSE--DEDLQRAMEESRLTA 176

Query: 179 XXXXXXXXXXXDSGSNDDDDFQTALQLSKXXXXXXXXXXXXXXXXXX---------XXXX 229
                      +   N  DD QTALQLSK                               
Sbjct: 177 EQEEAERRRKLEIYDNSSDDLQTALQLSKEEEELRRLRELQMQQQMQQAQQQMFGLSQQQ 236

Query: 230 XXXXXXXYYDVFGNPITPEEYM 251
                  YYDVFGNPI+ EEY+
Sbjct: 237 TQAQQPMYYDVFGNPISAEEYL 258

 Score =  164 bits (414), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 85/125 (68%), Positives = 96/125 (76%), Gaps = 11/125 (8%)

Query: 374 TRTGNQSISQKYNDLNNLLASGTGLDTFGNTGQTRIPAQHTRTGNFINSQGTGYKQVTND 433
           TRTGNQSI++K+++LNNLLASGTGLDTFGNTGQTRIPAQHT+TGNFINSQGTGYKQV++ 
Sbjct: 395 TRTGNQSITEKHSELNNLLASGTGLDTFGNTGQTRIPAQHTKTGNFINSQGTGYKQVSS- 453

Query: 434 QPKNNPFLAAQYTGLPSTSVVPSYTGYGFGNXXXXXXXXXXXXXXXXXXXXXRGNPDQGI 493
            PK+NPFL  QYTGLPST+VVPSYTGYGFGN                         DQG+
Sbjct: 454 TPKHNPFLGQQYTGLPSTNVVPSYTGYGFGNQPNQNQQNQNQSN----------GADQGM 503

Query: 494 SLIDL 498
           SLIDL
Sbjct: 504 SLIDL 508

>TDEL0C02050 Chr3 (355071..356576) [1506 bp, 501 aa] {ON} Anc_7.342
           YLR206W
          Length = 501

 Score =  246 bits (627), Expect = 7e-75,   Method: Compositional matrix adjust.
 Identities = 137/253 (54%), Positives = 157/253 (62%), Gaps = 8/253 (3%)

Query: 1   MSKALLRTAKNVVNGYSSVQVLVRNATSNEPTGPTVDQLDELAEKTYDNVEFFEIMDMLD 60
           MSK  +R+AKNVV GYSS QVLVRNAT+NE  GP+VD+LDELAEKTYD+VEFFEIMDM+D
Sbjct: 1   MSKQFVRSAKNVVKGYSSAQVLVRNATANESEGPSVDELDELAEKTYDSVEFFEIMDMID 60

Query: 61  KRLNDKGKNWRHVAKSLTVLDYLVRYGSENCVLWSQENLYIIKTLREFMHEDEMGVDHGQ 120
           KRLNDKGK WRH+AKSLTVLDYLVR+GSENCVLW +ENLY+IKTL EF ++D+ GVD GQ
Sbjct: 61  KRLNDKGKYWRHIAKSLTVLDYLVRFGSENCVLWCRENLYVIKTLMEFRNDDDGGVDQGQ 120

Query: 121 IIRVKAKXXXXXXXXXXXXXXXXNMRKKRRGKTRRPERSRGGEE--YDDDLQXXXXXXXX 178
           IIRVKAK                 M +K R    R  R   GE+  +DDDLQ        
Sbjct: 121 IIRVKAKELTNLLSDDERLREEREMNRKGRKNGTRRRRRTTGEQDGFDDDLQRALDESRL 180

Query: 179 XXXXXXXXXXXDSGSNDDDDFQTALQLSKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYY 238
                        GS +DDD Q ALQLSK                             YY
Sbjct: 181 TAEEDERRRKM-LGS-EDDDLQAALQLSK----EEEELKRLQEMQKLQQQQTQQQPSQYY 234

Query: 239 DVFGNPITPEEYM 251
           D+FGNPI+PEEY 
Sbjct: 235 DIFGNPISPEEYF 247

 Score =  148 bits (373), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 82/186 (44%), Positives = 105/186 (56%), Gaps = 26/186 (13%)

Query: 327 TGSNNPFALG-----RQEPDEEQITPKVSESVXXXXXXXXXXXXXXXXXL---------N 372
           TGSNNPFAL      +  P +    P  + +                             
Sbjct: 328 TGSNNPFALNNLQLQQARPAQSSPVPNFTSTQAQSPPKPQPQAQPQKQAPLPQQPQQALK 387

Query: 373 PTRTGNQSISQKYNDLNNLLASGTGLDTFGNTGQTRIPAQHTRTGNFINSQGTGYKQVTN 432
           P RTG+ ++++KY +LN LLA+GTG+DTFGNTG  RIPAQHT+TG FINSQGTGY+QVT 
Sbjct: 388 PVRTGDLAMTEKYGELNKLLATGTGIDTFGNTGDARIPAQHTKTGTFINSQGTGYRQVTG 447

Query: 433 DQPKNNPFLAAQYTGLPSTSVVPSYTGYGFGNXXXXXXXXXXXXXXXXXXXXXRGNPDQG 492
            +PK NPFL +QYTG+PS+++VP++TGYGFGN                         DQG
Sbjct: 448 -EPKKNPFLQSQYTGIPSSNIVPAHTGYGFGNQPSQQNQAQQHQ-----------TADQG 495

Query: 493 ISLIDL 498
           +SLIDL
Sbjct: 496 VSLIDL 501

>KLTH0H01430g Chr8 (132738..134246) [1509 bp, 502 aa] {ON} some
           similarities with uniprot|Q12518 Saccharomyces
           cerevisiae YDL161W ENT1
          Length = 502

 Score =  237 bits (604), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 131/259 (50%), Positives = 158/259 (61%), Gaps = 13/259 (5%)

Query: 1   MSKALLRTAKNVVNGYSSVQVLVRNATSNEPTGPTVDQLDELAEKTYDNVEFFEIMDMLD 60
           MSK+L+R AKNVVNGYS+ QVL+R ATSN+P GP++D +DE+AE+++D+V FFEIMDMLD
Sbjct: 1   MSKSLMRRAKNVVNGYSTTQVLLREATSNDPDGPSLDLMDEIAERSWDSVSFFEIMDMLD 60

Query: 61  KRLNDKGKNWRHVAKSLTVLDYLVRYGSENCVLWSQENLYIIKTLREFMHEDEMGVDHGQ 120
           KRLNDKGKNWRHVAKSLTVLDYLVR GSE+CV W++ENLYIIKTLREF HEDE GVD GQ
Sbjct: 61  KRLNDKGKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYIIKTLREFTHEDETGVDQGQ 120

Query: 121 IIRVKAKXXXXXXXXXXXXXXXXNMRKKRRGKTRRPERSRGGEEYDDDLQXX--XXXXXX 178
           I+RVKA+                   ++ +G+ RRP R +  + YDDD+Q          
Sbjct: 121 IVRVKAR----ELTALLQDEERLREERELKGRNRRPRRRKNSDSYDDDMQRALEESRMTA 176

Query: 179 XXXXXXXXXXXDSGSNDDDDFQTALQLSKXXXXXXXXXXXXXXXXXXXXXXXXXXXX--- 235
                      +   N  DD QTALQLSK                               
Sbjct: 177 EQEEAERRRKLEMYDNSADDLQTALQLSKEEEELRRLRELQMQQQMQQAQQQMFGLQQQQ 236

Query: 236 ----XYYDVFGNPITPEEY 250
                YYDVFGNPI+ EEY
Sbjct: 237 TQQPMYYDVFGNPISAEEY 255

 Score =  171 bits (433), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 101/186 (54%), Positives = 112/186 (60%), Gaps = 25/186 (13%)

Query: 327 TGSNNPFALGRQEPDEEQITPKVSES------------VXXXXXXXXXXXXXXXXXLNPT 374
           TGSNNPFA   Q+P  E  +   + S                              L  T
Sbjct: 328 TGSNNPFAKNAQQPSAEDPSKYAAASSPQRTQQLSPQLQPQPEQFQQQQQQIPQQPLKQT 387

Query: 375 RTGNQSISQKYNDLNNLLASGTGLDTFGNTGQTRIPAQHTRTGNFINSQGTGYKQVTN-D 433
           RTGNQS++ K++DLNNLLASGTGLDTFGNTGQTRIPAQHT+TG FINSQGTGYKQV+N  
Sbjct: 388 RTGNQSVTDKFSDLNNLLASGTGLDTFGNTGQTRIPAQHTKTGTFINSQGTGYKQVSNMP 447

Query: 434 QPKNNPFLAAQYTGLPSTSVVPSYTGYGFGNXXXXXXXXXXXXXXXXXXXXXRGN-PDQG 492
           Q K+NPFL  QYTGLPSTSVVPSYTGYGFGN                     R N  DQG
Sbjct: 448 QGKHNPFLGQQYTGLPSTSVVPSYTGYGFGN-----------QNVQKQTNQNRANGADQG 496

Query: 493 ISLIDL 498
           +SLIDL
Sbjct: 497 VSLIDL 502

>Smik_4.75 Chr4 (144483..145865) [1383 bp, 460 aa] {ON} YDL161W
           (REAL)
          Length = 460

 Score =  232 bits (591), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 126/253 (49%), Positives = 153/253 (60%), Gaps = 13/253 (5%)

Query: 1   MSKALLRTAKNVVNGYSSVQVLVRNATSNEPTGPTVDQLDELAEKTYDNVEFFEIMDMLD 60
           MSK  +R+AKN+V GYSS QVLVRNATSN+    + D L ELAEK+YD+ +FFEIMDMLD
Sbjct: 1   MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD 60

Query: 61  KRLNDKGKNWRHVAKSLTVLDYLVRYGSENCVLWSQENLYIIKTLREFMHEDEMGVDHGQ 120
           KRLNDKGK WRH+AK+LTVLDYL+R+GSENCVLW +ENLYIIKTL+EF HED+ G+D GQ
Sbjct: 61  KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHEDDEGIDQGQ 120

Query: 121 IIRVKAKXXXXXXXXXXXXXXXXNMRKK---RRGKTRRPERSRGGEEYDDDLQXXXXXXX 177
           I+RVK+K                NM  K   R+G++RR    R   + D+DLQ       
Sbjct: 121 IVRVKSKELTALLSDDERLNEERNMNIKGRNRKGRSRRGT-GRSSNDNDNDLQRALDASR 179

Query: 178 XXXXXXXXXXXXDSGSNDDDDFQTALQLSKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXY 237
                             D+D++TALQLSK                             Y
Sbjct: 180 MTAEEDEKRRKM------DEDYETALQLSK---EEEELKRLQDLQRMQQLQTQQQQQPMY 230

Query: 238 YDVFGNPITPEEY 250
           YD+FGNPITPEEY
Sbjct: 231 YDIFGNPITPEEY 243

 Score =  150 bits (378), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 70/93 (75%), Positives = 80/93 (86%), Gaps = 1/93 (1%)

Query: 371 LNPTRTGNQSISQKYNDLNNLLASGTGLDTFGNTGQTRIPAQHTRTGNFINSQGTGYKQV 430
           L  TRTGNQS++ KYN LN LLA+GTG+DTFGN G  R+PAQHT+TG FINSQGTGYKQV
Sbjct: 347 LTQTRTGNQSMTDKYNKLNELLATGTGIDTFGNVGDARVPAQHTKTGTFINSQGTGYKQV 406

Query: 431 TNDQPKNNPFLAAQYTGLPSTSVVPSYTGYGFG 463
           +ND PK NPFL+ QYTGLPST+VVP+ TGYGFG
Sbjct: 407 SND-PKYNPFLSGQYTGLPSTNVVPTQTGYGFG 438

 Score = 34.3 bits (77), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 13/13 (100%), Positives = 13/13 (100%)

Query: 237 YYDVFGNPITPEE 249
           YYDVFGNPITPEE
Sbjct: 266 YYDVFGNPITPEE 278

>Skud_4.94 Chr4 (163372..164715) [1344 bp, 447 aa] {ON} YDL161W
           (REAL)
          Length = 447

 Score =  228 bits (581), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 129/251 (51%), Positives = 152/251 (60%), Gaps = 9/251 (3%)

Query: 1   MSKALLRTAKNVVNGYSSVQVLVRNATSNEPTGPTVDQLDELAEKTYDNVEFFEIMDMLD 60
           MSK  +R+AKN+V GYSS QVLVRNATSN+    + D L ELAEK+YD+ +FFEIMDMLD
Sbjct: 1   MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD 60

Query: 61  KRLNDKGKNWRHVAKSLTVLDYLVRYGSENCVLWSQENLYIIKTLREFMHEDEMGVDHGQ 120
           KRLNDKGK WRH+AK+LTVLDYL+R+GSENCVLW +ENLYIIKTL+EF HED+ GVD GQ
Sbjct: 61  KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHEDDEGVDQGQ 120

Query: 121 IIRVKAKXXXXXXXXXXXXXXXXNMRKKRRGKTRRPERSRG-GEEYDDDLQXXXXXXXXX 179
           I+RVKAK                NM  K R +  R  R  G  +E DDDLQ         
Sbjct: 121 IVRVKAKELTTLLSDDERLNEERNMNIKGRSRKGRKRRGTGRNDEDDDDLQ------RAI 174

Query: 180 XXXXXXXXXXDSGSNDDDDFQTALQLSKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYYD 239
                     +     D+D++TALQLSK                             YYD
Sbjct: 175 DASRMTAEEDERRRKQDEDYETALQLSK--EEEELKRLQDLQRMQQVHAQQQQQQPMYYD 232

Query: 240 VFGNPITPEEY 250
           +FGNPITPEEY
Sbjct: 233 IFGNPITPEEY 243

 Score =  151 bits (381), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 77/135 (57%), Positives = 95/135 (70%), Gaps = 8/135 (5%)

Query: 329 SNNPFALGRQEPDEEQITPKVSESVXXXXXXXXXXXXXXXXXLNPTRTGNQSISQKYNDL 388
           SNNPFA    +P++E  + K  +S                  L  TRTGNQS++ KY  L
Sbjct: 299 SNNPFA----KPNQEVTSQKQDQSFMASSSMQQQQQQQP---LTQTRTGNQSMTDKYGKL 351

Query: 389 NNLLASGTGLDTFGNTGQTRIPAQHTRTGNFINSQGTGYKQVTNDQPKNNPFLAAQYTGL 448
           N LLA+GTG+DTFGN G +R+PAQHT+TG FINSQGTGY+QV+ND PK NPFL +QYTGL
Sbjct: 352 NELLATGTGIDTFGNVGDSRVPAQHTKTGTFINSQGTGYRQVSND-PKQNPFLNSQYTGL 410

Query: 449 PSTSVVPSYTGYGFG 463
           PST++VP+ TGYGFG
Sbjct: 411 PSTNIVPTQTGYGFG 425

 Score = 33.1 bits (74), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 12/13 (92%), Positives = 13/13 (100%)

Query: 237 YYDVFGNPITPEE 249
           YYDVFGNPI+PEE
Sbjct: 266 YYDVFGNPISPEE 278

>KNAG0C03800 Chr3 (746891..748234) [1344 bp, 447 aa] {ON} Anc_7.342
           YLR206W
          Length = 447

 Score =  226 bits (577), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 124/250 (49%), Positives = 151/250 (60%), Gaps = 10/250 (4%)

Query: 5   LLRTAKNVVNGYSSVQVLVRNATSNEPTGPTVDQLDELAEKTYDNVEFFEIMDMLDKRLN 64
           +LR+AKN+V GYS  +VLVR+AT+N  T P+ + LD+LA+K+Y++VEFFEI+DMLDKR+N
Sbjct: 1   MLRSAKNIVKGYSDTEVLVRDATANNSTNPSRELLDDLADKSYNSVEFFEILDMLDKRIN 60

Query: 65  DKGKNWRHVAKSLTVLDYLVRYGSENCVLWSQENLYIIKTLREFMHEDEMGVDHGQIIRV 124
           DKGK WRHVAK+LTVLDYLVR+GSENCV+W QENLYIIKTLREF HED  G D G+IIRV
Sbjct: 61  DKGKYWRHVAKALTVLDYLVRFGSENCVIWCQENLYIIKTLREFSHEDAGGEDEGKIIRV 120

Query: 125 KAKXXXXXXXXXXXXXXXXNMRKKRRGKTRRPERSRGGEEY----DDDLQXXXXXXXXXX 180
           KAK                 M  +RRG  +R  RS G  E     D+DLQ          
Sbjct: 121 KAKELTSLLMDEERLKEERAMNIRRRGGPKR--RSGGSRERNNRSDEDLQRAIEESKRTA 178

Query: 181 XXXXXXXXXDSGSNDDDDFQTALQLSKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYYDV 240
                     +G++ + D Q ALQLS+                             YYDV
Sbjct: 179 EEEERRRR--NGASSEADRQAALQLSR--EEEDLRRLQEQARLAQQQQQQQQQQPMYYDV 234

Query: 241 FGNPITPEEY 250
           FGNPITPEEY
Sbjct: 235 FGNPITPEEY 244

 Score =  155 bits (392), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 81/138 (58%), Positives = 92/138 (66%), Gaps = 7/138 (5%)

Query: 327 TGSNNPFALGRQEPDEEQITPKVSESVXXXXXXXXXXXXXXXXXLNPTRTGNQSISQKYN 386
           TGSNNPFAL           P    S                  L  TR+GNQ+IS KY+
Sbjct: 297 TGSNNPFALN------NATQPSAPASTTAARPAAIETPATQTKPLTQTRSGNQAISDKYS 350

Query: 387 DLNNLLASGTGLDTFGNTGQTRIPAQHTRTGNFINSQGTGYKQVTNDQPKNNPFLAAQYT 446
            LNNLLASGTG+DTFGNTG+ RIPAQHT+TG FINSQGTGY+QV ND  K NPFL  QYT
Sbjct: 351 ALNNLLASGTGIDTFGNTGEQRIPAQHTQTGTFINSQGTGYRQVNNDD-KPNPFLNGQYT 409

Query: 447 GLPSTSVVPSYTGYGFGN 464
           GLPST++VP+ TG+GFGN
Sbjct: 410 GLPSTNIVPTQTGFGFGN 427

>YDL161W Chr4 (167714..169078) [1365 bp, 454 aa] {ON}
           ENT1Epsin-like protein involved in endocytosis and actin
           patch assembly and functionally redundant with Ent2p;
           binds clathrin via a clathrin-binding domain motif at
           C-terminus
          Length = 454

 Score =  226 bits (576), Expect = 6e-68,   Method: Compositional matrix adjust.
 Identities = 127/251 (50%), Positives = 152/251 (60%), Gaps = 9/251 (3%)

Query: 1   MSKALLRTAKNVVNGYSSVQVLVRNATSNEPTGPTVDQLDELAEKTYDNVEFFEIMDMLD 60
           MSK  +R+AKN+V GYSS QVLVRNATSN+    + D L ELAEK+YD+ +FFEIMDMLD
Sbjct: 1   MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD 60

Query: 61  KRLNDKGKNWRHVAKSLTVLDYLVRYGSENCVLWSQENLYIIKTLREFMHEDEMGVDHGQ 120
           KRLNDKGK WRH+AK+LTV+DYL+R+GSENCVLW +ENLYIIKTL+EF HED+ G+D GQ
Sbjct: 61  KRLNDKGKYWRHIAKALTVIDYLIRFGSENCVLWCRENLYIIKTLKEFRHEDDEGIDQGQ 120

Query: 121 IIRVKAKXXXXXXXXXXXXXXXXNMR-KKRRGKTRRPERSRGGEEYDDDLQXXXXXXXXX 179
           I+RVKAK                NM  K R  K RR   +   +E DDDLQ         
Sbjct: 121 IVRVKAKELTALLSDDERLNEERNMNIKGRNRKGRRRRGTGRSDENDDDLQ------RAI 174

Query: 180 XXXXXXXXXXDSGSNDDDDFQTALQLSKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYYD 239
                     +     D+D++TALQLSK                             YYD
Sbjct: 175 SASRLTAEEDERRRKQDEDYETALQLSK--EEEELKRLQDLQRMQQQQGQQQLQQPMYYD 232

Query: 240 VFGNPITPEEY 250
           +FGNPITPEEY
Sbjct: 233 IFGNPITPEEY 243

 Score =  142 bits (358), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 65/88 (73%), Positives = 78/88 (88%), Gaps = 1/88 (1%)

Query: 375 RTGNQSISQKYNDLNNLLASGTGLDTFGNTGQTRIPAQHTRTGNFINSQGTGYKQVTNDQ 434
           RTGNQS++ KY+ LN LLA+GTG+DTFGN G+ RIPAQHT+TG FINSQGTGY+QV++D 
Sbjct: 345 RTGNQSMTDKYSKLNELLATGTGIDTFGNVGEARIPAQHTKTGTFINSQGTGYRQVSDD- 403

Query: 435 PKNNPFLAAQYTGLPSTSVVPSYTGYGF 462
           P +NPFL +QYTGLPSTSVVP+ TGYGF
Sbjct: 404 PNHNPFLNSQYTGLPSTSVVPTQTGYGF 431

>Suva_4.83 Chr4 (155278..156666) [1389 bp, 462 aa] {ON} YDL161W
           (REAL)
          Length = 462

 Score =  223 bits (569), Expect = 9e-67,   Method: Compositional matrix adjust.
 Identities = 127/251 (50%), Positives = 149/251 (59%), Gaps = 9/251 (3%)

Query: 1   MSKALLRTAKNVVNGYSSVQVLVRNATSNEPTGPTVDQLDELAEKTYDNVEFFEIMDMLD 60
           MSK L+R+AKN+V GYSS QVLVRNATSN+    + D L ELAEK+YD+ +FFEIMDMLD
Sbjct: 1   MSKQLVRSAKNLVKGYSSTQVLVRNATSNDNNQVSKDSLIELAEKSYDSADFFEIMDMLD 60

Query: 61  KRLNDKGKNWRHVAKSLTVLDYLVRYGSENCVLWSQENLYIIKTLREFMHEDEMGVDHGQ 120
           KRLNDKGK WRH+AK+LTVLDYL+R+GSENCVLW +ENLYIIKTL+EF H+D+ G D GQ
Sbjct: 61  KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHDDDEGTDQGQ 120

Query: 121 IIRVKAKXXXXXXXXXXXXXXXXNMR-KKRRGKTRRPERSRGGEEYDDDLQXXXXXXXXX 179
           I+RVKAK                NM  K R    RR  R+    E DDDLQ         
Sbjct: 121 IVRVKAKELTSLLSDEERLNEERNMNIKGRNRGGRRRRRTNRSSEDDDDLQRAIDASRMT 180

Query: 180 XXXXXXXXXXDSGSNDDDDFQTALQLSKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYYD 239
                           D+D++TALQLSK                             Y D
Sbjct: 181 ADEDERRRKQ------DEDYETALQLSK--EEEELKRLQDLQRIQAQQQQQQQQQPMYCD 232

Query: 240 VFGNPITPEEY 250
           +FGNPITPEEY
Sbjct: 233 IFGNPITPEEY 243

 Score =  152 bits (384), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 87/172 (50%), Positives = 105/172 (61%), Gaps = 16/172 (9%)

Query: 329 SNNPFALGRQEPD-EEQITPKV-SESVXXXXXXXXXXXXXXXXXLNPTRTGNQSISQKYN 386
           SNNPFA   QE   + Q  P + + S+                 L  TRTGNQS++ KY+
Sbjct: 305 SNNPFAKPNQEASPQRQDQPSMNTSSMPQQQQQQQQQQQQQQEPLTQTRTGNQSMTDKYS 364

Query: 387 DLNNLLASGTGLDTFGNTGQTRIPAQHTRTGNFINSQGTGYKQVTNDQPKNNPFLAAQYT 446
            LN LL +GTG+DTFGN G TR+PAQHT+TG FINSQGTGY+QV+ND PK+NPFL +QYT
Sbjct: 365 KLNELLGTGTGIDTFGNFGDTRVPAQHTKTGTFINSQGTGYRQVSND-PKHNPFLNSQYT 423

Query: 447 GLPSTSVVPSYTGYGFGNXXXXXXXXXXXXXXXXXXXXXRGNPDQGISLIDL 498
           GLPST+VVP+ TGYGFGN                      G   QG +LIDL
Sbjct: 424 GLPSTNVVPAQTGYGFGNQPQQQSQTN-------------GTNSQGYALIDL 462

>Skud_12.270 Chr12 (501192..503072) [1881 bp, 626 aa] {ON} YLR206W
           (REAL)
          Length = 626

 Score =  223 bits (567), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 124/275 (45%), Positives = 154/275 (56%), Gaps = 24/275 (8%)

Query: 1   MSKALLRTAKNVVNGYSSVQVLVRNATSNEPTGPTVDQLDELAEKTYDNVEFFEIMDMLD 60
           M K  +R+AKN+V GYSS QVLVR+AT+N+   P++D LD+LA+++YD+V+FFEIMDMLD
Sbjct: 1   MPKQFVRSAKNMVKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKNWRHVAKSLTVLDYLVRYGSENCVLWSQENLYIIKTLREFMHEDEMGVDHGQ 120
           KRLNDKGK WRHVAKSLTVLDYLVR+GSENCVLW +EN Y+IKTLREF HE+E G D GQ
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120

Query: 121 IIRVKAKXXXXXXXXXXXXXXXXNMRKKRRGKTRR----PERSRGGE-------EYDDDL 169
           IIRVKAK                +M  + RG  +     P R R G         Y D+L
Sbjct: 121 IIRVKAKELVSLLNDDERLREERSMNTRNRGANKAPRPGPRRQRTGSNPRDSSPSYQDEL 180

Query: 170 QXXXXXXXXXXXXXXXXXXXDSGSNDDD-DFQTALQLSKXXXXXXXXXXXXXXXXXXXXX 228
           +                    +  +D+D DFQ ALQLSK                     
Sbjct: 181 EKVLEESRITAQEDEQRRRELAQYDDEDPDFQAALQLSKEEEELKQLQELQRLQKQQQPL 240

Query: 229 XXX------------XXXXXYYDVFGNPITPEEYM 251
                               YYD+FGNPI+ +EY+
Sbjct: 241 SQMPVPVQQQQQQQQQQLPAYYDIFGNPISQDEYL 275

 Score =  158 bits (399), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 76/94 (80%), Positives = 85/94 (90%), Gaps = 1/94 (1%)

Query: 371 LNPTRTGNQSISQKYNDLNNLLASGTGLDTFGNTGQTRIPAQHTRTGNFINSQGTGYKQV 430
           L  TRTGNQSIS KYNDLN LLA+GTGLDTFGNTG+ RIPAQHT+TG FINSQGTGYKQV
Sbjct: 451 LEQTRTGNQSISDKYNDLNVLLATGTGLDTFGNTGEARIPAQHTKTGTFINSQGTGYKQV 510

Query: 431 TNDQPKNNPFLAAQYTGLPSTSVVPSYTGYGFGN 464
           T++ PKNNPFL+ QYTGLPST++VP+ TGYGFGN
Sbjct: 511 TSE-PKNNPFLSNQYTGLPSTNIVPTQTGYGFGN 543

>KLLA0C16731g Chr3 complement(1463616..1465052) [1437 bp, 478 aa]
           {ON} some similarities with uniprot|Q12518 Saccharomyces
           cerevisiae YDL161W ENT1
          Length = 478

 Score =  215 bits (548), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 99/128 (77%), Positives = 114/128 (89%), Gaps = 1/128 (0%)

Query: 1   MSKALLRTAKNVVNGYSSVQVLVRNATSNEPTGPTVDQLDELAEKTYDNVEFFEIMDMLD 60
           MSKA LR+AKN+VNGYS  QVLVR+ATSN+  GP+VDQL+ELAE+T+DNVEFFEIMDMLD
Sbjct: 1   MSKAFLRSAKNLVNGYSQAQVLVRSATSNDKDGPSVDQLEELAERTFDNVEFFEIMDMLD 60

Query: 61  KRLNDKGKNWRHVAKSLTVLDYLVRYGSENCVLWSQENLYIIKTLREFMHEDEMG-VDHG 119
           KRLNDKG+NWRHVAKSLT LD+LVR GSENCV W +ENLYIIKTLREF H DE   +D+G
Sbjct: 61  KRLNDKGRNWRHVAKSLTCLDFLVRCGSENCVFWCKENLYIIKTLREFTHTDEFTEIDNG 120

Query: 120 QIIRVKAK 127
           +I+RVKAK
Sbjct: 121 EIVRVKAK 128

 Score =  170 bits (430), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 83/141 (58%), Positives = 100/141 (70%), Gaps = 3/141 (2%)

Query: 327 TGSNNPFALGRQEPDEEQITPKVSESVXXXXXXXXXXXXXXXXXLNPT---RTGNQSISQ 383
           TGSNNPFAL R    +E    +  +                     P    RTGNQSIS 
Sbjct: 309 TGSNNPFALNRPPSPQEIEEIEEPDFTPVQLPPSPSPAAVPQQEFKPVPKQRTGNQSISD 368

Query: 384 KYNDLNNLLASGTGLDTFGNTGQTRIPAQHTRTGNFINSQGTGYKQVTNDQPKNNPFLAA 443
           K+++LNNLLASGTG+DTFGNTG+TR+PAQHT+TG FINSQGTGYKQ+TND PK+NPFL +
Sbjct: 369 KFSELNNLLASGTGIDTFGNTGETRVPAQHTKTGTFINSQGTGYKQITNDAPKHNPFLTS 428

Query: 444 QYTGLPSTSVVPSYTGYGFGN 464
           QYTG+PS+++ PSYTGYGFGN
Sbjct: 429 QYTGIPSSAIAPSYTGYGFGN 449

>CAGL0A03872g Chr1 complement(392922..394454) [1533 bp, 510 aa] {ON}
           highly similar to uniprot|Q05785 Saccharomyces
           cerevisiae YLR206w ENT2
          Length = 510

 Score =  215 bits (548), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 127/257 (49%), Positives = 146/257 (56%), Gaps = 13/257 (5%)

Query: 1   MSKALLRTAKNVVNGYSSVQVLVRNATSNEPTGPTVDQLDELAEKTYDNVEFFEIMDMLD 60
           M   L+R+AKN+V GYSS QV+VR+AT+N+ T P+V  L++LA+KTYD VEFFEIMDMLD
Sbjct: 1   MPSQLVRSAKNMVKGYSSTQVMVRDATANDSTSPSVGVLEDLADKTYDTVEFFEIMDMLD 60

Query: 61  KRLNDKGKNWRHVAKSLTVLDYLVRYGSENCVLWSQENLYIIKTLREFMHEDEM-GVDHG 119
           KRLNDKGK WRHVAKSLTVLDYLVR+GSENCVLW +ENLYIIKTLREF HEDE+ G D G
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDEVSGSDEG 120

Query: 120 QIIRVKAKXXXXXXX--XXXXXXXXXNMRKKRRGKTRRPERSRGGE------EYDDDLQX 171
           QIIRVKAK                  N   +R G  +R  R            YDDDLQ 
Sbjct: 121 QIIRVKAKELTSLLTDDERLREERALNRANRRNGDAKRRRRRSRSRSTSYRNAYDDDLQK 180

Query: 172 XXXXXXXXXXXXXXXXXXDSG-SNDDDDFQTALQLSKXXXXXXXXXXXXXXXXXXXXXXX 230
                              +   N D D   ALQLSK                       
Sbjct: 181 ALEESRMTAEEEEARRREQAQYENQDPDLLAALQLSK---EEEELKKLQDMQRMQELQAQ 237

Query: 231 XXXXXXYYDVFGNPITP 247
                 YYD+FGNPI+P
Sbjct: 238 QQQQNVYYDIFGNPISP 254

 Score =  162 bits (410), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 75/90 (83%), Positives = 86/90 (95%), Gaps = 1/90 (1%)

Query: 374 TRTGNQSISQKYNDLNNLLASGTGLDTFGNTGQTRIPAQHTRTGNFINSQGTGYKQVTND 433
           TRTGNQSIS KY++LNNLLASGTG+DTFGNTG+ RIPAQHT+TG FINSQGTGYKQVTN 
Sbjct: 361 TRTGNQSISDKYSELNNLLASGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVTN- 419

Query: 434 QPKNNPFLAAQYTGLPSTSVVPSYTGYGFG 463
           +PKNNPFL++QYTGLPST++VPS+TGYGFG
Sbjct: 420 EPKNNPFLSSQYTGLPSTNIVPSHTGYGFG 449

>NCAS0H00670 Chr8 (117595..119046) [1452 bp, 483 aa] {ON} Anc_7.342
          Length = 483

 Score =  214 bits (545), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 124/260 (47%), Positives = 155/260 (59%), Gaps = 12/260 (4%)

Query: 1   MSKALLRTAKNVVNGYSSVQVLVRNATSNEPTGPTVDQLDELAEKTYDNVEFFEIMDMLD 60
           MSK  +R+AKN+V GYS+ QVLVR+ATSN+ + P+ + L ELA++++D+V+FFEIMDMLD
Sbjct: 1   MSKQFVRSAKNMVKGYSTTQVLVRDATSNDASNPSFELLYELAQRSFDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKNWRHVAKSLTVLDYLVRYGSENCVLWSQENLYIIKTLREFMHEDEMGVDHGQ 120
           KRLNDKGK WRHVAKSLTVLDYLVR+GSENCVLW +ENLYIIKTLREF HED+ G D GQ
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDDGGADQGQ 120

Query: 121 IIRVKAKXXXX--XXXXXXXXXXXXNMRKKRRGKTR------RPERSRGGEEYDDDLQXX 172
           IIRVKAK                  N++ +R G  +           RG +E  D+LQ  
Sbjct: 121 IIRVKAKELTSLLLDEERLKEERTINLKNRRDGDMKGRRRRRGTRNGRGNDEDQDELQRA 180

Query: 173 XXXXXXXXXXXXXXXXXDSGSNDDD-DFQTALQLSKXXXXXXXXXXXXXXXXXXXXXXXX 231
                             +  +D D D QTALQLSK                        
Sbjct: 181 LEESRLTAEEDERRRRQMAQYDDQDPDLQTALQLSK---EEEELKKLQEMQRLQQQQGQM 237

Query: 232 XXXXXYYDVFGNPITPEEYM 251
                Y+D+FGNPI+P+EY+
Sbjct: 238 NQPQGYFDIFGNPISPDEYL 257

 Score =  157 bits (397), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 89/172 (51%), Positives = 104/172 (60%), Gaps = 10/172 (5%)

Query: 327 TGSNNPFALGRQEPDEEQITPKVSESVXXXXXXXXXXXXXXXXXLNPTRTGNQSISQKYN 386
           TGSNNPFA+          + +   +                  L  TRTGNQSI+ KY+
Sbjct: 322 TGSNNPFAMNNFNNKPAVESTQAYTASAPQLNQQPAQQQPQQQPLKQTRTGNQSITDKYS 381

Query: 387 DLNNLLASGTGLDTFGNTGQTRIPAQHTRTGNFINSQGTGYKQVTNDQPKNNPFLAAQYT 446
            LN LLA+GTG+DTFGNTG+ RIPAQHT+TG FINSQGTGY+QVTND PKNNPFL +QYT
Sbjct: 382 QLNTLLATGTGIDTFGNTGEQRIPAQHTQTGTFINSQGTGYRQVTND-PKNNPFLNSQYT 440

Query: 447 GLPSTSVVPSYTGYGFGNXXXXXXXXXXXXXXXXXXXXXRGNPDQGISLIDL 498
           GLPST++V + TGYGFGN                        PDQG SLIDL
Sbjct: 441 GLPSTNIVSTQTGYGFGNAPSQQQQQQQQQQQ---------RPDQGFSLIDL 483

>Suva_10.300 Chr10 (527412..529268) [1857 bp, 618 aa] {ON} YLR206W
           (REAL)
          Length = 618

 Score =  216 bits (549), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 120/263 (45%), Positives = 147/263 (55%), Gaps = 17/263 (6%)

Query: 1   MSKALLRTAKNVVNGYSSVQVLVRNATSNEPTGPTVDQLDELAEKTYDNVEFFEIMDMLD 60
           MSK  +R+AKN+V GYSS QVLVR+AT+N+P  P++D LD+LA+++YD+V+FFEIMDMLD
Sbjct: 1   MSKQFVRSAKNMVKGYSSTQVLVRDATANDPRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKNWRHVAKSLTVLDYLVRYGSENCVLWSQENLYIIKTLREFMHEDEMGVDHGQ 120
           KRLNDKGK WRHVAKSLTVLDYLVR+GSENCVLW +EN Y+IKTLREF HE+E G D GQ
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120

Query: 121 IIRVKAKXXXXXXXXXXXXXXXXNMRKKRRGKTRRPERSRGGEE---------------Y 165
           IIRVKAK                 M  + R   +    +                    Y
Sbjct: 121 IIRVKAKELVSLLNDDERLREERTMNTRNRRTNKTARPTPTPRPRRQRTRSNLYDSPPTY 180

Query: 166 DDDLQXXXXXXXXXXXXXXXXXXXDSGSNDDD-DFQTALQLSKXXXXXXXXXXXXXXXXX 224
            +DL+                    +  +DDD DFQ ALQLSK                 
Sbjct: 181 QNDLEKALEESRITAQEDELRRNEMAQYDDDDPDFQAALQLSKEEEELKQLQELQKQQQL 240

Query: 225 XXXXXX-XXXXXXYYDVFGNPIT 246
                        YYD+FGNPI+
Sbjct: 241 QSQLQMPPQQQAAYYDIFGNPIS 263

 Score =  157 bits (398), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 76/94 (80%), Positives = 84/94 (89%), Gaps = 1/94 (1%)

Query: 371 LNPTRTGNQSISQKYNDLNNLLASGTGLDTFGNTGQTRIPAQHTRTGNFINSQGTGYKQV 430
           L  TRTGNQSIS KYNDLN LLA+GTG DTFGNTG++RIPAQHT+TG FINSQGTGYKQV
Sbjct: 434 LTQTRTGNQSISDKYNDLNVLLATGTGADTFGNTGESRIPAQHTKTGTFINSQGTGYKQV 493

Query: 431 TNDQPKNNPFLAAQYTGLPSTSVVPSYTGYGFGN 464
            N +PKNNPFL +QYTGLPSTS+VP+ TGYGFGN
Sbjct: 494 VN-EPKNNPFLNSQYTGLPSTSIVPTQTGYGFGN 526

>TPHA0D04560 Chr4 complement(994552..996015) [1464 bp, 487 aa] {ON}
           Anc_7.342 YLR206W
          Length = 487

 Score =  212 bits (539), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 125/251 (49%), Positives = 145/251 (57%), Gaps = 13/251 (5%)

Query: 1   MSKALLRTAKNVVNGYSSVQVLVRNATSNEPTGPTVDQLDELAEKTYDNVEFFEIMDMLD 60
           MS   +R+ KNVV GYSS QVLVRNAT+NE TGP +D L ++AEKTYD+ +FFEIMDMLD
Sbjct: 1   MSNQFVRSMKNVVKGYSSTQVLVRNATANEGTGPNIDLLADIAEKTYDSADFFEIMDMLD 60

Query: 61  KRLNDKGKNWRHVAKSLTVLDYLVRYGSENCVLWSQENLYIIKTLREFMHEDEM--GVDH 118
           KRLNDKGK W+H+AKSLTVLDYLVR+GSENCVLW +ENLY+IKTL EF +EDE   GVD 
Sbjct: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYLIKTLTEFRYEDENSGGVDQ 120

Query: 119 GQIIRVKAKXXXXXXXXXXXXXXXXNMRKKRRGKTRRPERSRGGEEYDDDLQXXXXXXXX 178
           GQIIRVKAK                 +  +R     R   +R G   D+DLQ        
Sbjct: 121 GQIIRVKAKELTALLMDDERLREERRLNNRRDRNRNRRPPARNGS--DEDLQRALEESRR 178

Query: 179 XXXXXXXXXXXDSGSNDDDDFQTALQLSKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYY 238
                      +    DD D Q ALQLSK                             YY
Sbjct: 179 TAEEDERKRRLN---QDDSDLQAALQLSK------EEEELKRLQELQSSMHMQQQQPVYY 229

Query: 239 DVFGNPITPEE 249
           DVFGNPI+ EE
Sbjct: 230 DVFGNPISYEE 240

 Score =  136 bits (342), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 62/89 (69%), Positives = 78/89 (87%), Gaps = 1/89 (1%)

Query: 375 RTGNQSISQKYNDLNNLLASGTGLDTFGNTGQTRIPAQHTRTGNFINSQGTGYKQVTNDQ 434
           RTGN+ ++ KYN+LN LLASGTG+DTFGNTG+TRIPAQHT+TG FINSQGTGY+Q +  +
Sbjct: 375 RTGNKEMTNKYNELNQLLASGTGIDTFGNTGETRIPAQHTQTGTFINSQGTGYRQQSG-E 433

Query: 435 PKNNPFLAAQYTGLPSTSVVPSYTGYGFG 463
            K NPFL+ QYTGLPS++++P+ TGYGFG
Sbjct: 434 SKVNPFLSNQYTGLPSSNIIPTQTGYGFG 462

>ZYRO0F11550g Chr6 complement(947131..948747) [1617 bp, 538 aa] {ON}
           some similarities with uniprot|Q12518 Saccharomyces
           cerevisiae YDL161W ENT1
          Length = 538

 Score =  213 bits (541), Expect = 7e-62,   Method: Compositional matrix adjust.
 Identities = 119/252 (47%), Positives = 143/252 (56%), Gaps = 12/252 (4%)

Query: 1   MSKALLRTAKNVVNGYSSVQVLVRNATSNEPTGPTVDQLDELAEKTYDNVEFFEIMDMLD 60
           M    +R+AKN + GY+S QVLVR+AT+NE  GP+VD LDELA ++YD+VEFFEIMDM+D
Sbjct: 1   MPTQFVRSAKNALKGYTSAQVLVRDATANEVEGPSVDMLDELAHRSYDSVEFFEIMDMID 60

Query: 61  KRLNDKGKNWRHVAKSLTVLDYLVRYGSENCVLWSQENLYIIKTLREFMHEDEMGVDHGQ 120
           KRLNDKGK WRHVAKSLTVLDYLVR+GSENCVLW +ENLYIIKTLREF H+D+   D GQ
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENLYIIKTLREFRHDDDGTQDGGQ 120

Query: 121 IIRVKAKXXXXXXXXXXXXXXXXNMRK-----KRRGKTRRPERSRGGEEYDDDLQXXXXX 175
           IIRVKAK                   K             P R+     YD ++Q     
Sbjct: 121 IIRVKAKELTNLLMDDERLRMERGEDKGAPPRMMSPSPPTPRRN----SYDSEMQRALDA 176

Query: 176 XXXXXXXXXXXXXXDSGSNDDDDFQTALQLSKXXXXXXXXXXXXXXXXXXXXXXXXXXXX 235
                          + +N+D D +TALQLSK                            
Sbjct: 177 SRLTAEEDERRRK--TLNNEDADLETALQLSK-EEEELKRLQELQKAQQDQQRLSQMQPQ 233

Query: 236 XYYDVFGNPITP 247
            YYD+FGNPI+P
Sbjct: 234 GYYDIFGNPISP 245

 Score =  148 bits (374), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 68/94 (72%), Positives = 79/94 (84%), Gaps = 1/94 (1%)

Query: 371 LNPTRTGNQSISQKYNDLNNLLASGTGLDTFGNTGQTRIPAQHTRTGNFINSQGTGYKQV 430
           + P RTGNQSIS KYNDLN LLA  TG+DTFGN G  RIPAQHT+TG FINSQGTG+KQ 
Sbjct: 420 MQPVRTGNQSISDKYNDLNQLLAQPTGVDTFGNVGDARIPAQHTKTGTFINSQGTGFKQY 479

Query: 431 TNDQPKNNPFLAAQYTGLPSTSVVPSYTGYGFGN 464
           +N+ PK NPFL  Q+TG+P++SVVPS+TGYGFGN
Sbjct: 480 SNE-PKKNPFLPTQFTGIPTSSVVPSHTGYGFGN 512

>KAFR0L01460 Chr12 complement(270433..272085) [1653 bp, 550 aa] {ON}
           Anc_7.342 YLR206W
          Length = 550

 Score =  211 bits (537), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 121/263 (46%), Positives = 151/263 (57%), Gaps = 14/263 (5%)

Query: 1   MSKALLRTAKNVVNGYSSVQVLVRNATSNEPTGPTVDQLDELAEKTYDNVEFFEIMDMLD 60
           MSK  +R+AKNV+ GYSS QVLVR+ATSN+     +D LD++A ++YD+V+FFEIMDMLD
Sbjct: 1   MSKQFVRSAKNVMKGYSSTQVLVRDATSNDNRVTNIDTLDDIASRSYDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKNWRHVAKSLTVLDYLVRYGSENCVLWSQENLYIIKTLREFMHEDEMGVDHGQ 120
           KRLNDKGK W+H+ KSLTVLDYLVR+GSENCVLW +ENLY+IKTLREF +ED+ G+D GQ
Sbjct: 61  KRLNDKGKYWKHIVKSLTVLDYLVRFGSENCVLWCKENLYVIKTLREFRYEDDTGIDQGQ 120

Query: 121 IIRVKAKXXXX----------XXXXXXXXXXXXNMRKKRRGKTRRPERSRGGEEYDDDLQ 170
           IIRVKAK                          N    R   T R + + G +  DDDLQ
Sbjct: 121 IIRVKAKELTSLLQDEERLREERRFNNRRNRRNNRSANRSRATSRSQSNIGPD--DDDLQ 178

Query: 171 XXXXXXXXXXXXXXXXXXXDSGSNDDD-DFQTALQLSKXXXX-XXXXXXXXXXXXXXXXX 228
                               +  +++D +FQ ALQLSK                      
Sbjct: 179 RVIEESKKTAEEDERRRKELARYDEEDPEFQAALQLSKEEEELKNLQDLQRQQQQLQMLQ 238

Query: 229 XXXXXXXXYYDVFGNPITPEEYM 251
                   YYDVFGNPI+ +EYM
Sbjct: 239 QQQTSANVYYDVFGNPISYDEYM 261

 Score =  155 bits (392), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 70/90 (77%), Positives = 82/90 (91%)

Query: 375 RTGNQSISQKYNDLNNLLASGTGLDTFGNTGQTRIPAQHTRTGNFINSQGTGYKQVTNDQ 434
           RTGN+ I++KY++LNNLLA GTG+DTFGNTGQ RIPAQHT+TG FINSQGTGYKQVTN++
Sbjct: 389 RTGNEEITEKYSELNNLLAQGTGVDTFGNTGQERIPAQHTKTGTFINSQGTGYKQVTNER 448

Query: 435 PKNNPFLAAQYTGLPSTSVVPSYTGYGFGN 464
            KNNPFL  QYTGLPS+++VPS TGYGFGN
Sbjct: 449 SKNNPFLNTQYTGLPSSNIVPSSTGYGFGN 478

>TBLA0E00480 Chr5 complement(88019..89818) [1800 bp, 599 aa] {ON}
           Anc_7.342 YLR206W
          Length = 599

 Score =  210 bits (534), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 118/274 (43%), Positives = 150/274 (54%), Gaps = 25/274 (9%)

Query: 1   MSKALLRTAKNVVNGYSSVQVLVRNATSNEPTGPTVDQLDELAEKTYDNVEFFEIMDMLD 60
           MSK  LR+ KN+V GYSS Q+LVR+AT+N+   P++D LD++AEKTYD+V+FFEIMDMLD
Sbjct: 1   MSKQFLRSTKNMVKGYSSTQILVRDATANDENTPSIDILDDIAEKTYDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKNWRHVAKSLTVLDYLVRYGSENCVLWSQENLYIIKTLREFMHEDEM----GV 116
           KRLNDKGK W+HVAKSLTVLDYL+R+GSENCV W +ENLY+IKTL+EF  +D +    G 
Sbjct: 61  KRLNDKGKYWKHVAKSLTVLDYLIRFGSENCVFWCKENLYLIKTLKEFRVDDAIDYNTGY 120

Query: 117 DHGQIIRVKAKXXXXXXXXXXXXXXXXN--------------MRKKRRGKTRRP-ERSRG 161
           D GQI+RV+A                 +              M  +RR  +R    R R 
Sbjct: 121 DQGQIVRVRATELTSLLMDDERLREERSLHSRGGRRSAPPPRMAPQRRNTSRSDFNRQRA 180

Query: 162 GEEYDDDLQXXXXXXXXXXXXXXXXXXXDSGSNDDDDFQTALQLS-----KXXXXXXXXX 216
            + YDDDLQ                     G + +DDF+TALQLS               
Sbjct: 181 DDHYDDDLQKAIEESKRTAEEDERRRRNREG-DQEDDFETALQLSKEEEELKKLQELHAQ 239

Query: 217 XXXXXXXXXXXXXXXXXXXXYYDVFGNPITPEEY 250
                               Y D+FGNPI+ EE+
Sbjct: 240 QIALQNQQNATPTTQNVANVYTDIFGNPISYEEW 273

 Score =  154 bits (388), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 86/157 (54%), Positives = 97/157 (61%), Gaps = 20/157 (12%)

Query: 327 TGSNNPFALGRQEPDEEQITPKVSESVXXX--------------XXXXXXXXXXXXXXLN 372
           TG+NNPF+L      ++Q  P +S S                                L 
Sbjct: 404 TGTNNPFSLSNINNPQQQQPPLMSSSSTTLPDLSSFKQSTSVPPATQSSYTTKTNASSLP 463

Query: 373 P-----TRTGNQSISQKYNDLNNLLASGTGLDTFGNTGQTRIPAQHTRTGNFINSQGTGY 427
           P      RTGNQ IS KYN+LN LLA+GTG+DTFGNTG  RIPAQHT TG FINSQGTGY
Sbjct: 464 PQPIPQMRTGNQEISDKYNNLNTLLATGTGIDTFGNTGDMRIPAQHTATGTFINSQGTGY 523

Query: 428 KQVTNDQPKNNPFLAAQYTGLPSTSVVPSYTGYGFGN 464
           KQ  ND PKNNPF++ QYTGLPST+VVPSYTGYGFGN
Sbjct: 524 KQYIND-PKNNPFMSNQYTGLPSTNVVPSYTGYGFGN 559

>NDAI0D00610 Chr4 (133678..135138) [1461 bp, 486 aa] {ON} Anc_7.342
           YDL161W
          Length = 486

 Score =  207 bits (526), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 117/266 (43%), Positives = 153/266 (57%), Gaps = 17/266 (6%)

Query: 1   MSKALLRTAKNVVNGYSSVQVLVRNATSNEPTGPTVDQLDELAEKTYDNVEFFEIMDMLD 60
           MSK  +R+AKN++ GYS+ QVLVR+ATSN+ + P+ + L E++++++D+V+FFEIMDMLD
Sbjct: 1   MSKQFVRSAKNMMKGYSTTQVLVRDATSNDSSNPSFEILYEISKRSFDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKNWRHVAKSLTVLDYLVRYGSENCVLWSQENLYIIKTLREFMHEDEMGVDHGQ 120
           KRLNDKGK W+H+AKSLTVLDYLVR+GSENCVLW ++NLYIIKTL+EF  ED+  VD   
Sbjct: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKQNLYIIKTLKEFKLEDD-NVDESS 119

Query: 121 IIRVKAKXXXX------XXXXXXXXXXXXNMRKKRRGKTRR-PERSRGGEEYDDDLQXXX 173
           IIRVKAK                      N R +R+ ++RR    +R G + D+DLQ   
Sbjct: 120 IIRVKAKELTALLQDDERLKEERSINLKNNRRSERKNRSRRGTNATRRGTKSDEDLQKAL 179

Query: 174 XXXXXXXXXXXXXXXXDSG-SNDDDDFQTALQLS--------KXXXXXXXXXXXXXXXXX 224
                            +   N D D+QTALQLS                          
Sbjct: 180 EESRITAEEDERRRRELAQYDNQDTDYQTALQLSKEEEELKKLQELQRLQQLQQQQQQQM 239

Query: 225 XXXXXXXXXXXXYYDVFGNPITPEEY 250
                       YYD+FGNPI+PEEY
Sbjct: 240 QFQQQPQQQEQVYYDIFGNPISPEEY 265

 Score =  154 bits (390), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 83/136 (61%), Positives = 93/136 (68%), Gaps = 2/136 (1%)

Query: 327 TGSNNPFALGRQEPDEEQITPKVSESVXXXXXXXXXXXXXXXXXLNPTRTGNQSISQKYN 386
           TGSNNPFAL     +   I P   +                   L  TRTGNQSIS KYN
Sbjct: 323 TGSNNPFALN-ATINTSPIRP-AEQQPQPQFTAPQQQQQPLQQPLKQTRTGNQSISDKYN 380

Query: 387 DLNNLLASGTGLDTFGNTGQTRIPAQHTRTGNFINSQGTGYKQVTNDQPKNNPFLAAQYT 446
           +LNNLLASGTG+DTFGNTG  RIPAQHT+TG FINSQGTGYKQ+ ND  K NPFL  QYT
Sbjct: 381 ELNNLLASGTGIDTFGNTGDQRIPAQHTQTGTFINSQGTGYKQIVNDPVKKNPFLNNQYT 440

Query: 447 GLPSTSVVPSYTGYGF 462
           GLPS+++VPS+TGYGF
Sbjct: 441 GLPSSNIVPSHTGYGF 456

>Smik_12.264 Chr12 (501598..503436) [1839 bp, 612 aa] {ON} YLR206W
           (REAL)
          Length = 612

 Score =  209 bits (533), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 118/267 (44%), Positives = 147/267 (55%), Gaps = 23/267 (8%)

Query: 1   MSKALLRTAKNVVNGYSSVQVLVRNATSNEPTGPTVDQLDELAEKTYDNVEFFEIMDMLD 60
           MSK  +R+AKN++ GYSS QVLVR+AT+N+   P++D LD+LA+++YD+V+FFEIMDMLD
Sbjct: 1   MSKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKNWRHVAKSLTVLDYLVRYGSENCVLWSQENLYIIKTLREFMHEDEMGVDHGQ 120
           KRLNDKGK WRHVAKSLTVLDYLVR+GSENCVLW +EN Y+IKTLREF HE+E G D GQ
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120

Query: 121 IIRVKAKXXXXXXXXXXXXXXXXNMRKKRR-------------GKTRRPERSRGGEEYDD 167
           IIRVKAK                +M  + R                  P  S     Y +
Sbjct: 121 IIRVKAKELVSLLNDDERLREERSMNTRNRRDRSAARPRPRRQRTRSNPHDS--SPSYQN 178

Query: 168 DLQXXXXXXXXXXXXXXXXXXXDSGSNDDD-DFQTALQLS-------KXXXXXXXXXXXX 219
           DL+                    +  +D+D DFQ ALQLS       +            
Sbjct: 179 DLEKALEESRITAQEDEQRRRELAQYDDEDPDFQAALQLSKEEEELKQLQELQRLQNQQQ 238

Query: 220 XXXXXXXXXXXXXXXXXYYDVFGNPIT 246
                            YYD+FGNPI+
Sbjct: 239 SLSQMQVPVQQQQEQPAYYDIFGNPIS 265

 Score =  157 bits (397), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 75/94 (79%), Positives = 83/94 (88%), Gaps = 1/94 (1%)

Query: 371 LNPTRTGNQSISQKYNDLNNLLASGTGLDTFGNTGQTRIPAQHTRTGNFINSQGTGYKQV 430
           L  TRTGNQSIS KYNDLN LLA+GTG DTFGNTG+ RIPAQHT+TG FINSQGTGYKQV
Sbjct: 426 LKQTRTGNQSISDKYNDLNTLLATGTGTDTFGNTGEARIPAQHTKTGTFINSQGTGYKQV 485

Query: 431 TNDQPKNNPFLAAQYTGLPSTSVVPSYTGYGFGN 464
            N+ PKNNPFL+ QYTGLPST++VP+ TGYGFGN
Sbjct: 486 INE-PKNNPFLSNQYTGLPSTNIVPTQTGYGFGN 518

>ACL157C Chr3 complement(79325..80872) [1548 bp, 515 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR206W
           (ENT2) and YDL161W (ENT1)
          Length = 515

 Score =  207 bits (527), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 115/254 (45%), Positives = 144/254 (56%), Gaps = 6/254 (2%)

Query: 1   MSKALLRTAKNVVNGYSSVQVLVRNATSNEPTGPTVDQLDELAEKTYDNVEFFEIMDMLD 60
           MSK LLR+AKNVVNGYS  Q+LVRNATSNE  GP++DQ++ELAE++Y  VEFFEI+ MLD
Sbjct: 1   MSKQLLRSAKNVVNGYSPAQILVRNATSNEEYGPSMDQMEELAERSYSAVEFFEIVVMLD 60

Query: 61  KRLNDKGKNWRHVAKSLTVLDYLVRYGSENCVLWSQENLYIIKTLREFMHEDE-MGVDHG 119
           KRL+DK K+WRHVAKSLTV D+LVR G+E CV W++ENLY+ + L EF H DE  GVDHG
Sbjct: 61  KRLSDKPKHWRHVAKSLTVTDFLVRTGAETCVDWARENLYLFRRLTEFYHVDESTGVDHG 120

Query: 120 QIIRVKAKXXXXXXXXXXXXXXXXNMRKKRRGKTRRPERSRGGEEYDDDLQXXXXXXXXX 179
           QIIRVKA+                NMR  R  + R+       E+ D DLQ         
Sbjct: 121 QIIRVKARELVALLRDEERLREERNMRLGRNPRNRQASVPPPAEDLDPDLQRALEESRIT 180

Query: 180 XXXXXXXXXXDSG-SNDDDDFQTALQLS----KXXXXXXXXXXXXXXXXXXXXXXXXXXX 234
                      +    D+++ + ALQLS    +                           
Sbjct: 181 AEEEERRRREKTNQQQDNEELEVALQLSKEEEELRKLRELQQQREQQMALWQQQQQQQPQ 240

Query: 235 XXYYDVFGNPITPE 248
             YYD+FGNPI+ E
Sbjct: 241 AMYYDIFGNPISLE 254

 Score =  166 bits (419), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 77/94 (81%), Positives = 87/94 (92%)

Query: 371 LNPTRTGNQSISQKYNDLNNLLASGTGLDTFGNTGQTRIPAQHTRTGNFINSQGTGYKQV 430
           L PTRTGNQSI+ KY++LN LLASGTGLDTFGNTGQTRIPAQHT+TG FINSQGTGYKQV
Sbjct: 398 LQPTRTGNQSITDKYSELNTLLASGTGLDTFGNTGQTRIPAQHTKTGTFINSQGTGYKQV 457

Query: 431 TNDQPKNNPFLAAQYTGLPSTSVVPSYTGYGFGN 464
            N+ PK+NPF+A QYTGLPST++VPS+TGYGFGN
Sbjct: 458 GNEPPKHNPFIATQYTGLPSTNMVPSHTGYGFGN 491

>YLR206W Chr12 (554578..556419) [1842 bp, 613 aa] {ON}
           ENT2Epsin-like protein required for endocytosis and
           actin patch assembly and functionally redundant with
           Ent1p; contains clathrin-binding motif at C-terminus
          Length = 613

 Score =  208 bits (529), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 93/127 (73%), Positives = 112/127 (88%)

Query: 1   MSKALLRTAKNVVNGYSSVQVLVRNATSNEPTGPTVDQLDELAEKTYDNVEFFEIMDMLD 60
           MSK  +R+AKN++ GYSS QVLVR+AT+N+   P++D LD+LA+++YD+V+FFEIMDMLD
Sbjct: 1   MSKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKNWRHVAKSLTVLDYLVRYGSENCVLWSQENLYIIKTLREFMHEDEMGVDHGQ 120
           KRLNDKGK WRHVAKSLTVLDYLVR+GSENCVLW +EN Y+IKTLREF HE+E G D GQ
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120

Query: 121 IIRVKAK 127
           IIRVKAK
Sbjct: 121 IIRVKAK 127

 Score =  158 bits (400), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 75/94 (79%), Positives = 85/94 (90%), Gaps = 1/94 (1%)

Query: 371 LNPTRTGNQSISQKYNDLNNLLASGTGLDTFGNTGQTRIPAQHTRTGNFINSQGTGYKQV 430
           L  TRTGNQSIS KY+DLN LLA+GTG+DTFGNTG+ RIPAQHT+TG FINSQGTGYKQV
Sbjct: 425 LKQTRTGNQSISDKYSDLNTLLATGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYKQV 484

Query: 431 TNDQPKNNPFLAAQYTGLPSTSVVPSYTGYGFGN 464
           TN +PKNNPFL+ QYTGLPST++VP+ TGYGFGN
Sbjct: 485 TN-EPKNNPFLSNQYTGLPSTNIVPTQTGYGFGN 517

>Ecym_4731 Chr4 (1427875..1429419) [1545 bp, 514 aa] {ON} similar to
           Ashbya gossypii ACL157C
          Length = 514

 Score =  205 bits (522), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 119/257 (46%), Positives = 144/257 (56%), Gaps = 13/257 (5%)

Query: 1   MSKALLRTAKNVVNGYSSVQVLVRNATSNEPTGPTVDQLDELAEKTYDNVEFFEIMDMLD 60
           MSK LLR+AKNV+NGYS  QVLVRNATSN+  GP++DQ++ELAE+TY  VEFFEIM MLD
Sbjct: 1   MSKQLLRSAKNVMNGYSQAQVLVRNATSNDEYGPSLDQMEELAERTYSAVEFFEIMVMLD 60

Query: 61  KRLNDKGKNWRHVAKSLTVLDYLVRYGSENCVLWSQENLYIIKTLREFMHEDE-MGVDHG 119
           +RLNDK KNWRHVAKSLTV DYLVR G+E CV W++EN++II+ L EF+H DE  G DHG
Sbjct: 61  RRLNDKPKNWRHVAKSLTVTDYLVRTGAEACVDWARENMFIIRKLTEFVHVDESSGTDHG 120

Query: 120 QIIRVKAKXXXXXXXXXXXXXXXXNMRKKRRGKTRR--PERSRGGEEYDDDLQXXXXXXX 177
           Q+IRVKAK                N+R  R  K  +  PE +  G   D DL+       
Sbjct: 121 QLIRVKAKELIALLRDDERLKEERNLRLGRGKKNPQNVPETNPDG--VDPDLKRALEESR 178

Query: 178 XXXXXXXXXXXXDSGSNDDDDFQTALQLSKXXXXXXXXXXXXXXXXXXXXXXXXXXXX-- 235
                          + D ++ Q ALQLSK                              
Sbjct: 179 ITAEEEERRRKLAEKTEDAEELQAALQLSKEEEELRKLRELQQQREQQMAFWQQQQVQQV 238

Query: 236 ------XYYDVFGNPIT 246
                  YYD+FGNPIT
Sbjct: 239 QYQQQPMYYDIFGNPIT 255

 Score =  154 bits (389), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 76/125 (60%), Positives = 89/125 (71%), Gaps = 13/125 (10%)

Query: 374 TRTGNQSISQKYNDLNNLLASGTGLDTFGNTGQTRIPAQHTRTGNFINSQGTGYKQVTND 433
           TRTGNQSIS KY +LN LLA+GTG+DTFGNTGQ RI +QHT+T  FINS GTG+KQV+N+
Sbjct: 403 TRTGNQSISDKYGELNALLATGTGIDTFGNTGQARISSQHTKTETFINSHGTGFKQVSNE 462

Query: 434 QPKNNPFLAAQYTGLPSTSVVPSYTGYGFGNXXXXXXXXXXXXXXXXXXXXXRGNPDQGI 493
            PK+NPFL  QYTGLPST++VPS+TGYGFGN                         DQG+
Sbjct: 463 PPKHNPFLTTQYTGLPSTNIVPSHTGYGFGNASSFQQTASKPN-------------DQGM 509

Query: 494 SLIDL 498
           SLIDL
Sbjct: 510 SLIDL 514

>Kpol_2001.70 s2001 complement(192214..193815) [1602 bp, 533 aa]
           {ON} complement(192214..193815) [1602 nt, 534 aa]
          Length = 533

 Score =  204 bits (520), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 95/127 (74%), Positives = 109/127 (85%)

Query: 1   MSKALLRTAKNVVNGYSSVQVLVRNATSNEPTGPTVDQLDELAEKTYDNVEFFEIMDMLD 60
           M K  +R+AKNVV GYSS QV+VRNATSN+  GP +D LD LAEKTYD+VEFFEIMDMLD
Sbjct: 1   MPKQFVRSAKNVVKGYSSTQVMVRNATSNDSGGPDIDTLDALAEKTYDSVEFFEIMDMLD 60

Query: 61  KRLNDKGKNWRHVAKSLTVLDYLVRYGSENCVLWSQENLYIIKTLREFMHEDEMGVDHGQ 120
           KRLNDKGK W+H+AKSLTVLDYLVR+GSENCVLW +ENLYII+TL+EF + D+   D GQ
Sbjct: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYIIQTLKEFSYIDDSDHDQGQ 120

Query: 121 IIRVKAK 127
           IIRVKAK
Sbjct: 121 IIRVKAK 127

 Score =  155 bits (393), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 72/91 (79%), Positives = 83/91 (91%), Gaps = 1/91 (1%)

Query: 374 TRTGNQSISQKYNDLNNLLASGTGLDTFGNTGQTRIPAQHTRTGNFINSQGTGYKQVTND 433
           TRTGNQ I+ K+ +LN LLASGTG+DTFGNTG+ RIPAQHT+TG FINSQGTGY+QVTND
Sbjct: 383 TRTGNQDITDKFGELNQLLASGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYRQVTND 442

Query: 434 QPKNNPFLAAQYTGLPSTSVVPSYTGYGFGN 464
            PKNNPFL +QYTGLPST++VPS+TGYGFGN
Sbjct: 443 -PKNNPFLNSQYTGLPSTNIVPSHTGYGFGN 472

>KAFR0B00890 Chr2 (166365..167609) [1245 bp, 414 aa] {ON} Anc_7.342
           YLR206W
          Length = 414

 Score =  195 bits (496), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 88/123 (71%), Positives = 105/123 (85%)

Query: 5   LLRTAKNVVNGYSSVQVLVRNATSNEPTGPTVDQLDELAEKTYDNVEFFEIMDMLDKRLN 64
           +LR+AKN+V GYSS Q LVR+ATSN    P +DQL ELAE TY+N+EFFEIMDMLDKR+N
Sbjct: 1   MLRSAKNLVKGYSSTQKLVRDATSNSHDNPPIDQLSELAEMTYNNMEFFEIMDMLDKRIN 60

Query: 65  DKGKNWRHVAKSLTVLDYLVRYGSENCVLWSQENLYIIKTLREFMHEDEMGVDHGQIIRV 124
            KGK W+HV KSL VLDYLVR+GSENCV+W +ENLYIIKTLREF +EDE G+D GQ++RV
Sbjct: 61  SKGKYWKHVIKSLIVLDYLVRFGSENCVIWCKENLYIIKTLREFTYEDESGMDQGQMVRV 120

Query: 125 KAK 127
           +AK
Sbjct: 121 RAK 123

 Score =  147 bits (371), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 79/138 (57%), Positives = 95/138 (68%), Gaps = 12/138 (8%)

Query: 327 TGSNNPFALGRQEPDEEQITPKVSESVXXXXXXXXXXXXXXXXXLNPTRTGNQSISQKYN 386
           TGSNNPFAL  ++  +    P V ++                  L  TRTG+QSIS KY+
Sbjct: 278 TGSNNPFALNNKKLQQHTPEPSVIDTTLNTQAP-----------LKQTRTGSQSISDKYS 326

Query: 387 DLNNLLASGTGLDTFGNTGQTRIPAQHTRTGNFINSQGTGYKQVTNDQPKNNPFLAAQYT 446
            LN LLA+GTG+DTFGNTG  RIPAQHT+TG FINSQGTGYKQV+ +   NN FL +QYT
Sbjct: 327 ALNTLLATGTGIDTFGNTGNQRIPAQHTKTGTFINSQGTGYKQVSTN-GFNNVFLNSQYT 385

Query: 447 GLPSTSVVPSYTGYGFGN 464
           GLPS+++VPS TGYGFGN
Sbjct: 386 GLPSSNIVPSQTGYGFGN 403

 Score = 37.7 bits (86), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 13/15 (86%), Positives = 15/15 (100%)

Query: 237 YYDVFGNPITPEEYM 251
           YYD+FGNPITPEEY+
Sbjct: 219 YYDIFGNPITPEEYL 233

>KNAG0B02650 Chr2 (511995..513935) [1941 bp, 646 aa] {ON} Anc_7.342
           YLR206W
          Length = 646

 Score =  165 bits (418), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 73/128 (57%), Positives = 104/128 (81%), Gaps = 1/128 (0%)

Query: 1   MSKALLRTAKNVVNGYSSVQVLVRNATSNEPTGPTVDQLDELAEKTYDNVEFFEIMDMLD 60
           MS+  +R+AKNV+ GYSS QVLVR+AT+N+   P +D L+++A  ++D+V+FFEIMD+L+
Sbjct: 1   MSRQFVRSAKNVMKGYSSTQVLVRDATANDGRTPHLDTLEDIAGLSFDSVDFFEIMDVLE 60

Query: 61  KRLNDKGKNWRHVAKSLTVLDYLVRYGSENCVLWSQENLYIIKTLREFMH-EDEMGVDHG 119
           KRLND GK WRH+ KSLTVLDYLVR+GSE+C  W++++L+++K LR F   +D +G D G
Sbjct: 61  KRLNDSGKYWRHIEKSLTVLDYLVRFGSEHCADWARDHLFLLKALRNFRFVDDGIGFDQG 120

Query: 120 QIIRVKAK 127
           QI+RVKA+
Sbjct: 121 QIVRVKAR 128

 Score =  137 bits (345), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 64/91 (70%), Positives = 77/91 (84%), Gaps = 2/91 (2%)

Query: 376 TGNQSISQKYNDLNNLLASGTGLDTFGNTGQTRIPAQHTRTGNFINSQGTGYKQVTND-- 433
           TGNQ ++ KY++LNNLLA GTG+DTFGN G  RIPAQHT+TG FINSQGTG+KQV ++  
Sbjct: 496 TGNQEVTNKYSELNNLLAQGTGVDTFGNEGTQRIPAQHTQTGTFINSQGTGFKQVNSEGK 555

Query: 434 QPKNNPFLAAQYTGLPSTSVVPSYTGYGFGN 464
            P +NPFL +QYTGLPST +VP+YTGYGFGN
Sbjct: 556 DPNSNPFLNSQYTGLPSTGIVPAYTGYGFGN 586

>TBLA0E02040 Chr5 complement(494899..497004) [2106 bp, 701 aa] {ON}
           Anc_7.342 YLR206W
          Length = 701

 Score =  156 bits (394), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 93/260 (35%), Positives = 132/260 (50%), Gaps = 23/260 (8%)

Query: 1   MSKALLRTAKNVVNGYSSVQVLVRNATSNEPTGPTVDQLDELAEKTYDNVEFFEIMDMLD 60
           MS   +R+ KN+  GYS  QVLVR+AT+N  +G ++D LD+L E +YD  EF +I  +LD
Sbjct: 1   MSHQFVRSTKNMFKGYSPTQVLVRDATANNDSGTSIDVLDQLGEMSYDTHEFRDIFSVLD 60

Query: 61  KRLNDKGKNWRHVAKSLTVLDYLVRYGSENCVLWSQENLYIIKTLREFMHEDEMGVDHGQ 120
           +R++DK K WRHVAKSLTV+DYLVR+GSE CV W+++N   ++ LR+F + D  G+D GQ
Sbjct: 61  RRISDKPKYWRHVAKSLTVVDYLVRFGSEACVQWARDNARQLEILRDFYYSDSAGIDQGQ 120

Query: 121 IIRVKAKXXXXXXX--XXXXXXXXXNMR-------KKRRGKTRRPERSRGGEEYDDDLQX 171
           +IRVKA                   NMR        +R G  RRP   R  E+ ++D+  
Sbjct: 121 LIRVKAAELIDLLRDPERLATERGMNMRGRRNALPPRRMGPHRRPSMPRRPED-EEDVDR 179

Query: 172 XXXXXXXXXXXXXXXXXXDSGSNDDDDFQTALQLSKXXXXXXXXXXXXXXXXXXXXXXXX 231
                             D    +  D + A++LSK                        
Sbjct: 180 ALEESKKTAEEDEARRRKDQ-EREKQDLKEAVKLSK------------EEDELKRLQDEA 226

Query: 232 XXXXXYYDVFGNPITPEEYM 251
                Y+D  GNPI+ EE++
Sbjct: 227 NNKPQYFDENGNPISQEEWL 246

 Score =  112 bits (280), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 62/84 (73%), Gaps = 1/84 (1%)

Query: 371 LNPTRTGNQSISQKYNDLNNLLASGTGLDTFGNTGQTRIPAQHTRTGNFINSQGTGYKQV 430
           L P  TGN  IS KY++LN LLA GTG+DTFGN G TRIPAQHT+TG FINSQGTGYKQV
Sbjct: 591 LQPMHTGNSVISAKYSNLNQLLAQGTGIDTFGNEGATRIPAQHTKTGTFINSQGTGYKQV 650

Query: 431 TNDQPKNNPFLAAQYTGLPSTSVV 454
           T+      P L  QYTGLP+ + V
Sbjct: 651 TSSSSP-IPLLPTQYTGLPAQTAV 673

>Suva_12.216 Chr12 complement(334254..335486) [1233 bp, 410 aa] {ON}
           YJR125C (REAL)
          Length = 410

 Score = 93.2 bits (230), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 46/127 (36%), Positives = 78/127 (61%), Gaps = 1/127 (0%)

Query: 2   SKALLRTAKNVVNGYSSVQVLVRNATSNEPTGPTVDQLDELAEKTYDNVEFFEIMDMLDK 61
           +K   R A+NVV  Y+ ++  VR AT+NEP G +   +D++++ TY+  E  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMDQISQGTYNFREREEILSMIFR 74

Query: 62  RLNDK-GKNWRHVAKSLTVLDYLVRYGSENCVLWSQENLYIIKTLREFMHEDEMGVDHGQ 120
           R  +K G  WR + K+L +LDYL+++GSE  +  ++ ++ +IK L  F + D  G D G 
Sbjct: 75  RFTEKAGSEWRQIYKALQLLDYLIKHGSERFIDDTRSSINLIKILESFHYTDSQGRDQGI 134

Query: 121 IIRVKAK 127
            +R + K
Sbjct: 135 NVRTRVK 141

>Kwal_47.16857 s47 (145176..146324) [1149 bp, 382 aa] {ON} YJR125C
           (ENT3) - Ent3p [contig 219] FULL
          Length = 382

 Score = 92.4 bits (228), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 47/126 (37%), Positives = 77/126 (61%), Gaps = 1/126 (0%)

Query: 2   SKALLRTAKNVVNGYSSVQVLVRNATSNEPTGPTVDQLDELAEKTYDNVEFFEIMDMLDK 61
           +K   R A+NVV  Y+ ++  VR AT+NEP G +   ++++A+ TY+  E  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEAKVREATNNEPWGASSTLMEQIAQGTYNYREREEILGMIFR 74

Query: 62  RLNDK-GKNWRHVAKSLTVLDYLVRYGSENCVLWSQENLYIIKTLREFMHEDEMGVDHGQ 120
           R  +K    WR + K+L +LDYL+R+G+E  +  ++ NL +IK L  F + D  G D G 
Sbjct: 75  RFTEKTASEWRQIYKALQLLDYLIRHGAERFIDDTRANLSLIKMLESFHYIDSQGRDQGI 134

Query: 121 IIRVKA 126
            +R +A
Sbjct: 135 NVRNRA 140

>Skud_10.349 Chr10 complement(613398..614630) [1233 bp, 410 aa] {ON}
           YJR125C (REAL)
          Length = 410

 Score = 91.7 bits (226), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 46/127 (36%), Positives = 78/127 (61%), Gaps = 1/127 (0%)

Query: 2   SKALLRTAKNVVNGYSSVQVLVRNATSNEPTGPTVDQLDELAEKTYDNVEFFEIMDMLDK 61
           +K   R A+NVV  Y+ ++  VR AT+NEP G +   +D++++ TY+  E  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMDQISQGTYNFREREEILSMIFR 74

Query: 62  RLNDK-GKNWRHVAKSLTVLDYLVRYGSENCVLWSQENLYIIKTLREFMHEDEMGVDHGQ 120
           R  +K G  WR + K+L +LDYL+++GSE  +  ++ ++ +IK L  F + D  G D G 
Sbjct: 75  RFTEKAGSEWRQIYKALQLLDYLIKHGSERFIDDTRSSINLIKILETFHYIDSQGRDQGI 134

Query: 121 IIRVKAK 127
            +R + K
Sbjct: 135 NVRTRVK 141

>TDEL0D00710 Chr4 (127174..128301) [1128 bp, 375 aa] {ON} Anc_4.346
           YJR125C
          Length = 375

 Score = 91.3 bits (225), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 47/127 (37%), Positives = 79/127 (62%), Gaps = 1/127 (0%)

Query: 2   SKALLRTAKNVVNGYSSVQVLVRNATSNEPTGPTVDQLDELAEKTYDNVEFFEIMDMLDK 61
           +K   R A+NVV  Y+ ++  VR AT+NEP G +   ++++++ TY+  E  EI+ M+ +
Sbjct: 15  AKKYFRRAQNVVFNYTDMEAKVREATNNEPWGASTTLMEQISQGTYNMREREEILGMIFR 74

Query: 62  RLNDKGKN-WRHVAKSLTVLDYLVRYGSENCVLWSQENLYIIKTLREFMHEDEMGVDHGQ 120
           RL +K  N WR + K+L +LDYL+R+ SE  +  ++ ++ +IK L  F + D  G D G 
Sbjct: 75  RLTEKRANEWRQIYKALQLLDYLIRHASERFIDDTRSSISLIKMLESFHYIDSQGRDQGI 134

Query: 121 IIRVKAK 127
            +R +AK
Sbjct: 135 NVRNRAK 141

>SAKL0G17952g Chr7 complement(1555520..1556767) [1248 bp, 415 aa]
           {ON} similar to uniprot|P47160 Saccharomyces cerevisiae
           YJR125C ENT3 Protein containing an N-terminal epsin-like
           domain involved in clathrin recruitment and traffic
           between the Golgi and endosomes associates with the
           clathrin adaptor Gga2p
          Length = 415

 Score = 91.3 bits (225), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 46/127 (36%), Positives = 77/127 (60%), Gaps = 1/127 (0%)

Query: 2   SKALLRTAKNVVNGYSSVQVLVRNATSNEPTGPTVDQLDELAEKTYDNVEFFEIMDMLDK 61
           +K   R A+NVV  Y+ ++  VR AT+NEP G +   +++++  TY+  E  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEAKVREATNNEPWGASSTLMEQISAGTYNYREREEILGMIFR 74

Query: 62  RLNDK-GKNWRHVAKSLTVLDYLVRYGSENCVLWSQENLYIIKTLREFMHEDEMGVDHGQ 120
           R  +K    WR + K+L +L+YL+++GSE  +  S+ NL +IK L  F + D  G D G 
Sbjct: 75  RFTEKTASEWRQIYKALQLLEYLIKHGSERFIDDSRANLTLIKMLESFHYTDSQGRDQGI 134

Query: 121 IIRVKAK 127
            +R +A+
Sbjct: 135 NVRNRAQ 141

>KNAG0M00380 Chr13 (56675..57886) [1212 bp, 403 aa] {ON} Anc_4.346
           YJR125C
          Length = 403

 Score = 90.9 bits (224), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 48/127 (37%), Positives = 76/127 (59%), Gaps = 1/127 (0%)

Query: 2   SKALLRTAKNVVNGYSSVQVLVRNATSNEPTGPTVDQLDELAEKTYDNVEFFEIMDMLDK 61
           +K   R A+NVV  ++ ++  VR AT+NEP G +   ++++A+ TY+  E  E+M ML +
Sbjct: 15  AKKYFRKAQNVVFNFTEMESKVREATNNEPWGASSTLMEQIAQGTYNYKEREEVMMMLMR 74

Query: 62  RLNDK-GKNWRHVAKSLTVLDYLVRYGSENCVLWSQENLYIIKTLREFMHEDEMGVDHGQ 120
           R  +K G  WR + K+L +LDYL+R GSE  +   +  L I++ L  F + D  G D G 
Sbjct: 75  RFTEKAGSEWRQIYKALQLLDYLIRRGSEKFIDDVRAALRIVRLLESFHYIDSQGRDQGV 134

Query: 121 IIRVKAK 127
            +R +AK
Sbjct: 135 NVRNRAK 141

>Smik_10.418 Chr10 complement(643833..645062) [1230 bp, 409 aa] {ON}
           YJR125C (REAL)
          Length = 409

 Score = 90.5 bits (223), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 78/127 (61%), Gaps = 1/127 (0%)

Query: 2   SKALLRTAKNVVNGYSSVQVLVRNATSNEPTGPTVDQLDELAEKTYDNVEFFEIMDMLDK 61
           +K   R A+NVV  Y+ ++  VR AT+NEP G +   +D++++ TY+  E  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMDQISQGTYNFREREEILSMIFR 74

Query: 62  RLNDK-GKNWRHVAKSLTVLDYLVRYGSENCVLWSQENLYIIKTLREFMHEDEMGVDHGQ 120
           R  +K G  WR + K+L +LDYL+++GSE  +  ++ ++ +I+ L  F + D  G D G 
Sbjct: 75  RFTEKAGSEWRQIYKALQLLDYLIKHGSERFIDDTRNSINLIRILETFHYIDSQGRDQGI 134

Query: 121 IIRVKAK 127
            +R + K
Sbjct: 135 NVRTRVK 141

>YJR125C Chr10 complement(654737..655963) [1227 bp, 408 aa] {ON}
           ENT3Protein containing an N-terminal epsin-like domain
           involved in clathrin recruitment and traffic between the
           Golgi and endosomes; associates with the clathrin
           adaptor Gga2p
          Length = 408

 Score = 90.5 bits (223), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 78/127 (61%), Gaps = 1/127 (0%)

Query: 2   SKALLRTAKNVVNGYSSVQVLVRNATSNEPTGPTVDQLDELAEKTYDNVEFFEIMDMLDK 61
           +K   R A+NVV  Y+ ++  VR AT+NEP G +   +D++++ TY+  E  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMDQISQGTYNFREREEILSMIFR 74

Query: 62  RLNDK-GKNWRHVAKSLTVLDYLVRYGSENCVLWSQENLYIIKTLREFMHEDEMGVDHGQ 120
           R  +K G  WR + K+L +LDYL+++GSE  +  ++ ++ +I+ L  F + D  G D G 
Sbjct: 75  RFTEKAGSEWRQIYKALQLLDYLIKHGSERFIDDTRNSINLIRILETFHYIDSQGRDQGI 134

Query: 121 IIRVKAK 127
            +R + K
Sbjct: 135 NVRTRVK 141

>KLTH0D16896g Chr4 complement(1395711..1396916) [1206 bp, 401 aa]
           {ON} similar to uniprot|P47160 Saccharomyces cerevisiae
           YJR125C ENT3 Protein containing an N-terminal epsin-like
           domain involved in clathrin recruitment and traffic
           between the Golgi and endosomes associates with the
           clathrin adaptor Gga2p
          Length = 401

 Score = 90.1 bits (222), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 45/126 (35%), Positives = 77/126 (61%), Gaps = 1/126 (0%)

Query: 2   SKALLRTAKNVVNGYSSVQVLVRNATSNEPTGPTVDQLDELAEKTYDNVEFFEIMDMLDK 61
           +K   R A+N+V  Y+ ++  VR AT+NEP G +   ++++++ TY+  E  EI+ M+ +
Sbjct: 15  AKKYFRKAQNMVFNYTEMEAKVREATNNEPWGASSTLMEQISQGTYNYREREEILGMIFR 74

Query: 62  RLNDK-GKNWRHVAKSLTVLDYLVRYGSENCVLWSQENLYIIKTLREFMHEDEMGVDHGQ 120
           R  +K    WR + K+L +LDYL+R+G+E  +  ++ NL +IK L  F + D  G D G 
Sbjct: 75  RFTEKTASEWRQIYKALQLLDYLIRHGAERFIDDTRANLSLIKMLESFHYIDSQGRDQGI 134

Query: 121 IIRVKA 126
            +R +A
Sbjct: 135 NVRNRA 140

>NDAI0D03200 Chr4 complement(764129..765436) [1308 bp, 435 aa] {ON}
           Anc_4.346
          Length = 435

 Score = 90.5 bits (223), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 47/127 (37%), Positives = 79/127 (62%), Gaps = 1/127 (0%)

Query: 2   SKALLRTAKNVVNGYSSVQVLVRNATSNEPTGPTVDQLDELAEKTYDNVEFFEIMDMLDK 61
           +K   R A+NVV  Y+ ++  VR AT+NEP G +   ++++A+ TY+  E +EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMESKVREATNNEPWGASSTLMEQIAQGTYNVRERYEIVGMIFR 74

Query: 62  RLNDK-GKNWRHVAKSLTVLDYLVRYGSENCVLWSQENLYIIKTLREFMHEDEMGVDHGQ 120
           R  +K G  WR + K+L +LDYL+++GSE  +   + +L +I+ L  F + D  G D G 
Sbjct: 75  RFTEKAGSEWRQIYKALQLLDYLIKHGSEPFIDDVRSSLKLIQMLETFHYIDSEGRDQGI 134

Query: 121 IIRVKAK 127
            +R +AK
Sbjct: 135 NVRNRAK 141

>TBLA0E04760 Chr5 complement(1226806..1228086) [1281 bp, 426 aa]
           {ON} Anc_4.346 YJR125C
          Length = 426

 Score = 89.0 bits (219), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 44/127 (34%), Positives = 78/127 (61%), Gaps = 1/127 (0%)

Query: 2   SKALLRTAKNVVNGYSSVQVLVRNATSNEPTGPTVDQLDELAEKTYDNVEFFEIMDMLDK 61
           +K   R A+NVV  Y+ ++  VR AT+NEP G +   ++++A+ TY+  E  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTDMEAKVREATNNEPWGASSTLMEQIAQGTYNPREREEILSMILR 74

Query: 62  RLNDKGKN-WRHVAKSLTVLDYLVRYGSENCVLWSQENLYIIKTLREFMHEDEMGVDHGQ 120
           R  +K  N WR + K+L +L+YL+ +G+E  +  ++ +L +I+ L  F + D  G D G 
Sbjct: 75  RFTEKSGNLWRQIYKALQLLEYLITHGAERFIDEARSSLGLIRMLESFHYVDSEGRDQGA 134

Query: 121 IIRVKAK 127
            +R +A+
Sbjct: 135 NVRSRAQ 141

>KLLA0B04587g Chr2 (411097..412299) [1203 bp, 400 aa] {ON} similar
           to uniprot|P47160 Saccharomyces cerevisiae YJR125C ENT3
           Protein containing an N-terminal epsin-like domain
           involved in clathrin recruitment and traffic between the
           Golgi and endosomes associates with the clathrin adaptor
           Gga2p
          Length = 400

 Score = 88.6 bits (218), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 46/126 (36%), Positives = 75/126 (59%), Gaps = 1/126 (0%)

Query: 2   SKALLRTAKNVVNGYSSVQVLVRNATSNEPTGPTVDQLDELAEKTYDNVEFFEIMDMLDK 61
           +K   R A+NVV  Y+ ++  VR AT+NEP G +   ++ +A+ TY+  E  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEAKVREATNNEPWGASSTLMEHIAQGTYNYREREEILGMIFR 74

Query: 62  RLNDK-GKNWRHVAKSLTVLDYLVRYGSENCVLWSQENLYIIKTLREFMHEDEMGVDHGQ 120
           R  +K    WR + K+L +L+YLV++GSE  +   + NL ++K L  F + D  G D G 
Sbjct: 75  RFTEKTASEWRQIYKALQLLEYLVKHGSERFIDDVRTNLNLVKMLESFHYIDSQGRDQGI 134

Query: 121 IIRVKA 126
            +R +A
Sbjct: 135 NVRNRA 140

>KAFR0B06740 Chr2 (1406075..1407274) [1200 bp, 399 aa] {ON}
           Anc_4.346 YJR125C
          Length = 399

 Score = 88.2 bits (217), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 48/127 (37%), Positives = 77/127 (60%), Gaps = 1/127 (0%)

Query: 2   SKALLRTAKNVVNGYSSVQVLVRNATSNEPTGPTVDQLDELAEKTYDNVEFFEIMDMLDK 61
           +K   R A+NVV  Y+ ++  VR AT+NEP G +   ++++A+ TY+  E  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMEQIAQGTYNLREREEILGMIFR 74

Query: 62  RLNDK-GKNWRHVAKSLTVLDYLVRYGSENCVLWSQENLYIIKTLREFMHEDEMGVDHGQ 120
           R  +K G  WR + KSL +LDYL+R GSE  +   + ++ +I+ L  F + D  G D G 
Sbjct: 75  RFTEKAGSEWRQIYKSLQLLDYLIRRGSERFIDDVRSSIRLIELLETFHYIDSQGRDQGI 134

Query: 121 IIRVKAK 127
            +R +AK
Sbjct: 135 NVRNRAK 141

>CAGL0H04323g Chr8 (407884..409122) [1239 bp, 412 aa] {ON} similar
           to uniprot|P47160 Saccharomyces cerevisiae YJR125c ENT3
           cytoskeletal adaptor
          Length = 412

 Score = 88.2 bits (217), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 44/123 (35%), Positives = 76/123 (61%), Gaps = 1/123 (0%)

Query: 2   SKALLRTAKNVVNGYSSVQVLVRNATSNEPTGPTVDQLDELAEKTYDNVEFFEIMDMLDK 61
           +K   R A+NVV  Y+ ++  VR AT+NEP G +   ++++A+ TY+  E  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVYNYTDMESKVREATNNEPWGASSTLMEQIAQGTYNIREREEILGMIFR 74

Query: 62  RLNDK-GKNWRHVAKSLTVLDYLVRYGSENCVLWSQENLYIIKTLREFMHEDEMGVDHGQ 120
           R  +K G  WR + K+L +L+YL+++GSE  +  ++ ++ I+K L  F + D  G D G 
Sbjct: 75  RFTEKSGSEWRQIYKALQLLEYLIKHGSERFIDDTRNSISIVKLLESFHYIDSQGRDQGV 134

Query: 121 IIR 123
            +R
Sbjct: 135 NVR 137

>ZYRO0B14784g Chr2 complement(1205944..1207218) [1275 bp, 424 aa]
           {ON} similar to uniprot|P47160 Saccharomyces cerevisiae
           YJR125C ENT3 Protein containing an N-terminal epsin-like
           domain involved in clathrin recruitment and traffic
           between the Golgi and endosomes associates with the
           clathrin adaptor Gga2p
          Length = 424

 Score = 87.4 bits (215), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 78/127 (61%), Gaps = 1/127 (0%)

Query: 2   SKALLRTAKNVVNGYSSVQVLVRNATSNEPTGPTVDQLDELAEKTYDNVEFFEIMDMLDK 61
           +K   R A+NVV  Y+ ++  VR AT+NEP G +   ++ +A+ TY+  E  EI+ M+ +
Sbjct: 50  AKKYFRKAQNVVFNYTEMEAKVREATNNEPWGTSSTLMEYIAQGTYNLREREEILGMIFR 109

Query: 62  RLNDKGKN-WRHVAKSLTVLDYLVRYGSENCVLWSQENLYIIKTLREFMHEDEMGVDHGQ 120
           R  +K  N WR + K+L +L+YL+++GSE  +  ++ ++ ++K L  F + D  G D G 
Sbjct: 110 RFTEKTANEWRQIYKALQLLEYLIKHGSERFIDDTRCSISLLKMLESFHYVDSQGRDQGI 169

Query: 121 IIRVKAK 127
            +R +AK
Sbjct: 170 NVRTRAK 176

>NCAS0A06210 Chr1 complement(1229758..1231029) [1272 bp, 423 aa]
           {ON} Anc_4.346
          Length = 423

 Score = 87.0 bits (214), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 44/123 (35%), Positives = 76/123 (61%), Gaps = 1/123 (0%)

Query: 2   SKALLRTAKNVVNGYSSVQVLVRNATSNEPTGPTVDQLDELAEKTYDNVEFFEIMDMLDK 61
           +K   R A+NVV  Y+ ++  VR AT+NEP G +   ++++A+ TY+  E  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMEQIAQGTYNIREREEILSMIFR 74

Query: 62  RLNDK-GKNWRHVAKSLTVLDYLVRYGSENCVLWSQENLYIIKTLREFMHEDEMGVDHGQ 120
           R  +K G  WR + K+L +LDYL+++GSE  +   + ++ ++K L+ F + D  G D G 
Sbjct: 75  RFTEKTGSEWRQIYKALQLLDYLIKHGSEKFIDDVRSSVAVLKLLQTFHYIDAEGRDQGI 134

Query: 121 IIR 123
            +R
Sbjct: 135 NVR 137

>AER155C Chr5 complement(929042..930136) [1095 bp, 364 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJR125C
           (ENT3)
          Length = 364

 Score = 85.5 bits (210), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 46/127 (36%), Positives = 76/127 (59%), Gaps = 1/127 (0%)

Query: 2   SKALLRTAKNVVNGYSSVQVLVRNATSNEPTGPTVDQLDELAEKTYDNVEFFEIMDMLDK 61
           +K   R A+NV+  Y+ ++  VR AT+NEP G +   + ++A+ TY+  E  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVMLNYTGMEAKVREATNNEPWGASSTLMTQIAQGTYNFREREEILAMILR 74

Query: 62  RLNDKGKN-WRHVAKSLTVLDYLVRYGSENCVLWSQENLYIIKTLREFMHEDEMGVDHGQ 120
           R  +K  N WR + KS+ +L+YLV++GSE  +   + NL +I+ L  F + D  G D G 
Sbjct: 75  RFLEKSANEWRQIYKSMQLLEYLVKHGSERFIDDVRSNLNLIRMLETFHYIDSQGRDQGI 134

Query: 121 IIRVKAK 127
            +R + K
Sbjct: 135 NVRNRTK 141

>Kpol_1001.2 s1001 (8057..9313) [1257 bp, 418 aa] {ON} (8057..9313)
           [1257 nt, 419 aa]
          Length = 418

 Score = 85.1 bits (209), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 44/127 (34%), Positives = 77/127 (60%), Gaps = 1/127 (0%)

Query: 2   SKALLRTAKNVVNGYSSVQVLVRNATSNEPTGPTVDQLDELAEKTYDNVEFFEIMDMLDK 61
           +K   R A+NV+  Y+ ++  VR AT+NEP G +   ++++++ TY+  E  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVMFNYTEMEGKVREATNNEPWGASSTLMEQISQGTYNIREREEILSMIFR 74

Query: 62  RLNDK-GKNWRHVAKSLTVLDYLVRYGSENCVLWSQENLYIIKTLREFMHEDEMGVDHGQ 120
           R  +K    WR + K+L +L+YL+++GSE  +   + +L +IK L  F + D  G D G 
Sbjct: 75  RFTEKTASEWRQIYKALQLLEYLIKHGSERFIDDVRSSLSLIKMLESFHYIDSQGRDQGI 134

Query: 121 IIRVKAK 127
            +R KA+
Sbjct: 135 NVRNKAQ 141

>TPHA0B00400 Chr2 (83356..84555) [1200 bp, 399 aa] {ON} Anc_4.346
           YJR125C
          Length = 399

 Score = 83.6 bits (205), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 75/127 (59%), Gaps = 1/127 (0%)

Query: 2   SKALLRTAKNVVNGYSSVQVLVRNATSNEPTGPTVDQLDELAEKTYDNVEFFEIMDMLDK 61
           +K   R A+NV+  Y+ ++  VR AT+NEP G +   + ++A+ TY+  E  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVMFNYTDMEAKVREATNNEPWGASSTLMKQIAQGTYNIREREEILGMVFR 74

Query: 62  RLNDK-GKNWRHVAKSLTVLDYLVRYGSENCVLWSQENLYIIKTLREFMHEDEMGVDHGQ 120
           R  +K    WR + KSL + DYL+++GSE  +   + ++ +IK L  F + D  G D G 
Sbjct: 75  RYTEKTASEWRQIYKSLQLTDYLIKHGSERFIDDVRTSISLIKMLESFHYIDSQGRDQGI 134

Query: 121 IIRVKAK 127
            +R KA+
Sbjct: 135 NVRNKAQ 141

>Ecym_1133 Chr1 (274069..275247) [1179 bp, 392 aa] {ON} similar to
           Ashbya gossypii AER155C
          Length = 392

 Score = 77.4 bits (189), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 43/123 (34%), Positives = 69/123 (56%), Gaps = 1/123 (0%)

Query: 2   SKALLRTAKNVVNGYSSVQVLVRNATSNEPTGPTVDQLDELAEKTYDNVEFFEIMDMLDK 61
           +K   R A+NVV  Y+ ++  VR AT+NE  G     + ++A+ TY+  E  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTGMEAKVREATNNESWGAPSSLMAQIAQGTYNYRERKEILGMIFR 74

Query: 62  RLNDK-GKNWRHVAKSLTVLDYLVRYGSENCVLWSQENLYIIKTLREFMHEDEMGVDHGQ 120
           R  +K    WR + KS+ +L+YL+ +GSE  +   +  L +IK L  F + D  G D G 
Sbjct: 75  RFVEKTASEWRQIYKSVQLLEYLIYHGSEGFIDDVRSGLNLIKMLESFHYIDSQGRDQGI 134

Query: 121 IIR 123
            +R
Sbjct: 135 NVR 137

>Kwal_55.20611 s55 complement(489968..490732) [765 bp, 254 aa] {ON}
           YLL038C (ENT4) - Ent4p [contig 144] FULL
          Length = 254

 Score = 69.3 bits (168), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 43/111 (38%), Positives = 66/111 (59%), Gaps = 8/111 (7%)

Query: 4   ALLRTAKNVVNGYSSVQVLVRNATSN-EPTGPTVDQLDELAEKTYDNVEFFEIMDMLDKR 62
           +LL+T +N+  G SS +V  RNAT++ E  G T   ++EL+  TY      EI  ++ KR
Sbjct: 2   SLLKTVRNI--GQSSTEVKTRNATNDDEHNGATGSLMNELSVLTYSPRTLREITQVIRKR 59

Query: 63  LN-----DKGKNWRHVAKSLTVLDYLVRYGSENCVLWSQENLYIIKTLREF 108
           L+        KN  H+ K+LT++ YL+  GS+  V+W +  LY+I TL+EF
Sbjct: 60  LSGNSRMSSHKNAVHLLKTLTLIAYLINNGSDEFVVWIRSYLYLIDTLKEF 110

>Kpol_388.5 s388 complement(17825..18631) [807 bp, 268 aa] {ON}
           complement(17825..18631) [807 nt, 269 aa]
          Length = 268

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 34/105 (32%), Positives = 60/105 (57%), Gaps = 8/105 (7%)

Query: 17  SSVQVLVRNATS-NEPTGPTVDQLDELAEKTYDNVEFFEIMDMLDKRLNDKGK-----NW 70
           S+ +  V+ AT  NE +G T   ++E++  TY      EI+ +L KRL    K     N 
Sbjct: 13  SATEAKVKEATDDNETSGATGTLMNEISVLTYSPKTLKEIIQVLKKRLTGSSKKSSHRNC 72

Query: 71  RHVAKSLTVLDYLVRYGSENCVLWSQENLYIIKTLREF--MHEDE 113
            H+ K++T++ YL+  GS + + W++ N+ I + L++F  +HED+
Sbjct: 73  VHILKTMTLISYLINNGSNDFIAWARSNIMIFEVLKDFEVIHEDD 117

>SAKL0H25762g Chr8 (2256842..2257630) [789 bp, 262 aa] {ON} some
           similarities with uniprot|Q07872 Saccharomyces
           cerevisiae YLL038C ENT4 Protein of unknown function
           contains an N-terminal epsin-like domain
          Length = 262

 Score = 59.7 bits (143), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 35/111 (31%), Positives = 64/111 (57%), Gaps = 8/111 (7%)

Query: 4   ALLRTAKNVVNGYSSVQVLVRNATSN-EPTGPTVDQLDELAEKTYDNVEFFEIMDMLDKR 62
           + +R+ +N+  G S+ +V V+ AT + E +G T   ++E++  TY      EI  ++ +R
Sbjct: 2   SFIRSVRNM--GQSTTEVKVKKATDDDEYSGATGALMNEISVLTYSAKTLREITQVIHRR 59

Query: 63  LN-----DKGKNWRHVAKSLTVLDYLVRYGSENCVLWSQENLYIIKTLREF 108
           L+        +N  H+ K+LT++ YL+  GS + V W ++  Y++ TLREF
Sbjct: 60  LSGNYRKSSHRNAVHILKTLTLISYLINNGSNDFVSWIRQYAYLVDTLREF 110

>KLTH0E05874g Chr5 complement(530814..531581) [768 bp, 255 aa] {ON}
           similar to uniprot|Q07872 Saccharomyces cerevisiae
           YLL038C ENT4 Protein of unknown function contains an N-
           terminal epsin-like domain
          Length = 255

 Score = 58.5 bits (140), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 37/111 (33%), Positives = 63/111 (56%), Gaps = 8/111 (7%)

Query: 4   ALLRTAKNVVNGYSSVQVLVRNATSN-EPTGPTVDQLDELAEKTYDNVEFFEIMDMLDKR 62
           +LLRT ++   G S  ++  +NAT++ E +G T   ++E++  TY +    EI  ++ KR
Sbjct: 2   SLLRTVRSF--GQSQTEIKTKNATNDDEYSGATGSLMNEISVLTYSSRTLREITAVVRKR 59

Query: 63  LN-----DKGKNWRHVAKSLTVLDYLVRYGSENCVLWSQENLYIIKTLREF 108
           L+        KN  H+ K+LT+  YL+  GS   V W +  +Y+I +L+EF
Sbjct: 60  LSGNNRKSSHKNAVHILKTLTLTAYLINNGSNEFVAWIRSYVYLIDSLKEF 110

>TBLA0B06220 Chr2 (1466908..1467927) [1020 bp, 339 aa] {ON}
           Anc_4.346 YJR125C
          Length = 339

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 38/122 (31%), Positives = 65/122 (53%), Gaps = 1/122 (0%)

Query: 2   SKALLRTAKNVVNGYSSVQVLVRNATSNEPTGPTVDQLDELAEKTYDNVEFFEIMDMLDK 61
           +K   R A+N +   + ++  VR AT+N+P G +V  + ++   T++  +  +I++ML  
Sbjct: 15  AKKFFRMAENFLFNLTDMESKVREATNNDPWGTSVILMAQINAGTFEINQRADIINMLLN 74

Query: 62  RLNDK-GKNWRHVAKSLTVLDYLVRYGSENCVLWSQENLYIIKTLREFMHEDEMGVDHGQ 120
           R  +K G  WR + KS+ +L YL+  GS   V   + NL +IK L  F   D+ G +   
Sbjct: 75  RFLEKNGSQWRQIYKSVLLLQYLLINGSTEFVSEVKLNLTLIKNLMLFEFIDDQGYNQSS 134

Query: 121 II 122
            I
Sbjct: 135 KI 136

>ZYRO0G07876g Chr7 complement(636468..637247) [780 bp, 259 aa] {ON}
           similar to uniprot|Q07872 Saccharomyces cerevisiae
           YLL038C ENT4 Protein of unknown function contains an N-
           terminal epsin-like domain
          Length = 259

 Score = 55.5 bits (132), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 37/100 (37%), Positives = 56/100 (56%), Gaps = 6/100 (6%)

Query: 13  VNGYSSVQVLVRNATS-NEPTGPTVDQLDELAEKTYDNVEFFEIMDMLDKRLNDKG---- 67
           V G SS ++ VR AT+ +E TG T   ++E++  TY      EI  +L +RL+  G    
Sbjct: 9   VFGPSSTELKVRKATNEDEKTGATGTLMNEISVLTYSPKTVREITQVLKRRLSSYGRRTS 68

Query: 68  -KNWRHVAKSLTVLDYLVRYGSENCVLWSQENLYIIKTLR 106
            KN  H+ K+LT++ YL+  GSE  V W + NL   + L+
Sbjct: 69  HKNSIHIVKALTLILYLINNGSEEFVAWVRGNLIYFECLK 108

>TDEL0G01740 Chr7 (342371..343144) [774 bp, 257 aa] {ON} Anc_4.17
           YLL038C
          Length = 257

 Score = 55.1 bits (131), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 39/129 (30%), Positives = 69/129 (53%), Gaps = 8/129 (6%)

Query: 5   LLRTAKNVVNGYSSVQVLVRNAT-SNEPTGPTVDQLDELAEKTYDNVEFFEIMDMLDKRL 63
           LL + + +V   S+ ++ V+ AT  NE +G T   ++E++  TY      EI+ ++ KRL
Sbjct: 3   LLDSVRTLVQ--STTELKVKQATDENESSGATGTLMNEISVLTYSPKTLKEIVQVVRKRL 60

Query: 64  NDKG-----KNWRHVAKSLTVLDYLVRYGSENCVLWSQENLYIIKTLREFMHEDEMGVDH 118
              G     K   H+ K+LT++ YL+  GS + + W + N+ ++  L+EF  +D      
Sbjct: 61  MGHGRRNSHKICIHLVKTLTLVTYLMNNGSNDFIAWVRGNMALVDCLKEFNVQDRNDEKI 120

Query: 119 GQIIRVKAK 127
           GQ IR  ++
Sbjct: 121 GQQIRAMSQ 129

>TBLA0G00650 Chr7 (140678..141949) [1272 bp, 423 aa] {ON} Anc_4.17
           YLL038C
          Length = 423

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 37/124 (29%), Positives = 64/124 (51%), Gaps = 13/124 (10%)

Query: 4   ALLRTAKNVVNGYSSVQVLVRNATS-NEPTGPTVDQLDELAEKTYDNVEFFEIMDMLDKR 62
           A+  + +N V   S  ++ VR AT  NE +G T   ++E++  TY      EI+ +L KR
Sbjct: 2   AIFESVRNFVQ--SPTELKVRTATDDNENSGATGTLMNEISVLTYSTKTNKEIVTVLKKR 59

Query: 63  LNDKGK-----NWRHVAKSLTVLDYLVRYGSENCVLWSQENLYIIKTLREF-----MHED 112
           L   GK     N  H+ K+LT++ YL+  GS   + W  EN  + + ++ F     +H++
Sbjct: 60  LTGYGKKSSHRNCIHIIKTLTLIAYLMNNGSLEFIRWINENQLLFEVMKNFEVSDTIHDE 119

Query: 113 EMGV 116
           +  +
Sbjct: 120 KFAI 123

>KLLA0D03949g Chr4 (333566..334243) [678 bp, 225 aa] {ON} similar to
           uniprot|Q07872 Saccharomyces cerevisiae YLL038C ENT4
           Protein of unknown function contains an N- terminal
           epsin- like domain
          Length = 225

 Score = 52.8 bits (125), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 57/102 (55%), Gaps = 8/102 (7%)

Query: 15  GYSSVQVLVRNAT-SNEPTGPTVDQLDELAEKTYDNVEFFEIMDMLDKRLNDKGKNWR-- 71
           G S+ Q+ V+ AT SNE  G T   ++EL+  TY      EI +++ KRL +     +  
Sbjct: 11  GQSTTQLKVKQATDSNESYGATGTLMNELSVLTYSEKSANEIYEVIRKRLMNGSSRLKNS 70

Query: 72  -----HVAKSLTVLDYLVRYGSENCVLWSQENLYIIKTLREF 108
                 V K+LT+++YL+  GSE  VLW + +L  I+ L+++
Sbjct: 71  HDSVVQVLKTLTLIEYLLYNGSEEFVLWMRRHLAYIEALKDY 112

>TPHA0F00230 Chr6 complement(43589..44431) [843 bp, 280 aa] {ON}
           Anc_4.17 YLL038C
          Length = 280

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 36/121 (29%), Positives = 65/121 (53%), Gaps = 12/121 (9%)

Query: 5   LLRTAKNVVNGYSSVQVLVRNATSN-EPTGPTVDQLDELAEKTYDNVEFFEIMDMLDKRL 63
           L  + +N V   S  +  VR AT + E +G T   ++E++  TY      EI+ +L KRL
Sbjct: 3   LFDSVRNFVQ--SPTESKVRQATDDDETSGATGTLMNEISVLTYSPKTLKEIVQILKKRL 60

Query: 64  N-----DKGKNWRHVAKSLTVLDYLVRYGSENCVLWSQENLYIIKTLREF----MHEDEM 114
                 +  KN  H+ K+LT++ YL+  GS + + W++ N+ + + L+ F    + +++M
Sbjct: 61  TGYSKKNSHKNCVHILKTLTLITYLINNGSNDFIAWTRSNIMLFEYLKNFEVQNLEDEKM 120

Query: 115 G 115
           G
Sbjct: 121 G 121

>ACL061C Chr3 complement(256803..257507) [705 bp, 234 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLL038C
           (ENT4)
          Length = 234

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 54/115 (46%), Gaps = 6/115 (5%)

Query: 15  GYSSVQVLVRNATS-NEPTGPTVDQLDELAEKTYDNVEFFEIMDMLDKRLNDKG-----K 68
           G S     VR AT  NE  G +   + E+   TY      ++  +L KRL+        K
Sbjct: 11  GSSPTAAKVRKATDDNEFVGASSALISEITILTYSCKTLLDVTRVLKKRLSGNANKSSHK 70

Query: 69  NWRHVAKSLTVLDYLVRYGSENCVLWSQENLYIIKTLREFMHEDEMGVDHGQIIR 123
           N  H+ K+LT+ +YL+  GSE+ V W Q    +++ L++F   +E        IR
Sbjct: 71  NAVHILKALTLTNYLIANGSEDFVQWLQGCAVLLRRLKDFTTGNERDSHMASQIR 125

>Ecym_8407 Chr8 (843359..844123) [765 bp, 254 aa] {ON} similar to
           Ashbya gossypii ACL061C
          Length = 254

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 34/104 (32%), Positives = 54/104 (51%), Gaps = 6/104 (5%)

Query: 15  GYSSVQVLVRNATSN-EPTGPTVDQLDELAEKTYDNVEFFEIMDMLDKRL-----NDKGK 68
           G SS  V V+ AT + E  G     ++E+A  TY      EI  +L KRL         K
Sbjct: 11  GSSSTTVKVKKATDDSEHNGAYGSLMNEIAILTYSPNTLREITQVLKKRLVGNYKKTPSK 70

Query: 69  NWRHVAKSLTVLDYLVRYGSENCVLWSQENLYIIKTLREFMHED 112
              ++ K+LT++ +LV  GSE C+ W + +L +I++ ++F   D
Sbjct: 71  RAVNLLKTLTLIRFLVINGSEECIAWLRRHLVLIRSFQDFTLRD 114

>CAGL0E03806g Chr5 (356594..357376) [783 bp, 260 aa] {ON} similar to
           uniprot|Q07872 Saccharomyces cerevisiae YLL038c ENT4
          Length = 260

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 32/111 (28%), Positives = 59/111 (53%), Gaps = 8/111 (7%)

Query: 4   ALLRTAKNVVNGYSSVQVLVRNATS-NEPTGPTVDQLDELAEKTYDNVEFFEIMDMLDKR 62
           +L+ T K  +   S  ++ VR AT  NE  G T   ++E++  TY      +++ ++ KR
Sbjct: 2   SLMHTFKGFL--LSPTELKVRQATDDNELAGATGTLMNEISVLTYSKKTLKDVIQVIRKR 59

Query: 63  LN-----DKGKNWRHVAKSLTVLDYLVRYGSENCVLWSQENLYIIKTLREF 108
           L+     +  +   HV K+LT++ YL+  GS + + W + + Y+I+ L  F
Sbjct: 60  LSGVNKRNSHRTCLHVLKTLTLVSYLLNNGSNDFIAWLKSSKYVIEYLSSF 110

>Suva_10.35 Chr10 complement(70188..70931) [744 bp, 247 aa] {ON}
           YLL038C (REAL)
          Length = 247

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 32/108 (29%), Positives = 58/108 (53%), Gaps = 7/108 (6%)

Query: 23  VRNATS-NEPTGPTVDQLDELAEKTYDNVEFFEIMDMLDKRL------NDKGKNWRHVAK 75
           V+ ATS +E +G T   ++E++  TY      EI+ ++ KRL       +  ++   V K
Sbjct: 19  VKQATSEDETSGATGTLMNEISILTYSPKTVREIIQIVRKRLLLGQNRRNSHRSCIQVMK 78

Query: 76  SLTVLDYLVRYGSENCVLWSQENLYIIKTLREFMHEDEMGVDHGQIIR 123
           +LT++ YL+  GS   + W + N+ +I+ L +F  +D     +G+ IR
Sbjct: 79  TLTLVSYLMNNGSNEFIKWLKGNMILIEILEDFQAQDARDDRNGEEIR 126

>YLL038C Chr12 complement(65775..66518) [744 bp, 247 aa] {ON}
           ENT4Protein of unknown function, contains an N-terminal
           epsin-like domain; proposed to be involved in the
           trafficking of Arn1p in the absence of ferrichrome
          Length = 247

 Score = 46.2 bits (108), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 34/115 (29%), Positives = 61/115 (53%), Gaps = 9/115 (7%)

Query: 5   LLRTAKNVVNGYSSVQVLVRNATS-NEPTGPTVDQLDELAEKTYDNVEFFEIMDMLDKRL 63
           LL T K+ +   S  +  V+ AT+ +E +G T   ++E++  TY      EI+ ++ KRL
Sbjct: 3   LLDTFKSFIQ--SPTESKVKQATNEDETSGATGTLMNEISILTYSPKTVREIIQVIRKRL 60

Query: 64  ------NDKGKNWRHVAKSLTVLDYLVRYGSENCVLWSQENLYIIKTLREFMHED 112
                  +  +N   V K+LT++ YL+  GS   + W + N+ +I+ L +F  +D
Sbjct: 61  LLGQNRRNSHRNCIQVMKTLTLVSYLMNNGSNEFIKWLKGNMILIEILEDFQVQD 115

>Skud_12.30 Chr12 complement(56967..57710) [744 bp, 247 aa] {ON}
           YLL038C (REAL)
          Length = 247

 Score = 45.8 bits (107), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 60/115 (52%), Gaps = 9/115 (7%)

Query: 5   LLRTAKNVVNGYSSVQVLVRNATS-NEPTGPTVDQLDELAEKTYDNVEFFEIMDMLDKRL 63
           LL T K+ +   S  +  V+ ATS +E +G T   ++E++  TY      EI+ ++ KRL
Sbjct: 3   LLDTFKSFIQ--SPTESKVKQATSEDETSGATGTLMNEISILTYSPKTVREIIQVIRKRL 60

Query: 64  ------NDKGKNWRHVAKSLTVLDYLVRYGSENCVLWSQENLYIIKTLREFMHED 112
                  +  +N   V K+LT++ YL+  GS   + W + N+ +I+ L  F  +D
Sbjct: 61  LLGQNRRNSHRNCIQVMKTLTLVSYLMNNGSNEFIKWLKGNMILIEILENFHIQD 115

>Smik_12.19 Chr12 complement(50134..50877) [744 bp, 247 aa] {ON}
           YLL038C (REAL)
          Length = 247

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 33/115 (28%), Positives = 61/115 (53%), Gaps = 9/115 (7%)

Query: 5   LLRTAKNVVNGYSSVQVLVRNATS-NEPTGPTVDQLDELAEKTYDNVEFFEIMDMLDKRL 63
           LL T K+ +   S  +  V+ AT+ +E +G T   ++E++  TY      EI+ ++ KRL
Sbjct: 3   LLDTFKSFIQ--SPTESKVKQATNEDETSGATGTLMNEISILTYSPKTVREIIQVVRKRL 60

Query: 64  ------NDKGKNWRHVAKSLTVLDYLVRYGSENCVLWSQENLYIIKTLREFMHED 112
                  +  +N   V K+LT++ YL+  GS   + W + N+ +++ L +F  +D
Sbjct: 61  LLGQNRRNSHRNCIQVMKTLTLVSYLMNNGSNEFIKWLKSNMILVEILEDFQVQD 115

>NCAS0C05840 Chr3 (1202292..1203095) [804 bp, 267 aa] {ON} Anc_4.17
           YLL038C
          Length = 267

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 60/121 (49%), Gaps = 12/121 (9%)

Query: 5   LLRTAKNVVNGYSSVQVLVRNATS-NEPTGPTVDQLDELAEKTYDNVEFFEIMDMLDKRL 63
           L  T K+ V   S  +  V+ AT+ +E  G T   ++E++  TY      EI+ +L KRL
Sbjct: 3   LFETVKSFVQ--SPTESKVKQATNEDETMGATGTLMNEISVLTYSPKTLKEIVQVLKKRL 60

Query: 64  N-----DKGKNWRHVAKSLTVLDYLVRYGSENCVLWSQENLYIIKTL----REFMHEDEM 114
           +        KN   + K+LT++ YL+  GS   V W + N  +I  L     E+  +D+M
Sbjct: 61  SGYSRKTSHKNCIFIIKTLTLMAYLINNGSNEFVAWIRNNSSLISNLISEKVEYPKDDKM 120

Query: 115 G 115
           G
Sbjct: 121 G 121

>YHR161C Chr8 complement(420373..422286) [1914 bp, 637 aa] {ON}
          YAP1801Protein involved in clathrin cage assembly;
          binds Pan1p and clathrin; homologous to Yap1802p,
          member of the AP180 protein family
          Length = 637

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 39/72 (54%), Gaps = 2/72 (2%)

Query: 22 LVRNATSNEPTGPTVDQLDELAEKTYDNVEFFEIMDMLDKRLNDKGKNWRHVAKSLTVLD 81
          LV+ AT  +   P    LD +   T +  +F+EI+  LD R+ND    W  V KSL V+ 
Sbjct: 7  LVKGATKIKSAPPKQKYLDPILLGTSNEEDFYEIVKGLDSRINDTA--WTIVYKSLLVVH 64

Query: 82 YLVRYGSENCVL 93
           ++R GS++  L
Sbjct: 65 LMIREGSKDVAL 76

>SAKL0H02530g Chr8 (250148..252157) [2010 bp, 669 aa] {ON} weakly
           similar to uniprot|P53309 Saccharomyces cerevisiae
           YGR241C YAP1802 Yeast Assembly Polypeptide, member of
           AP180 protein family, binds Pan1p and clathrin; member
           of clathrin assembly polypeptide AP180 family and weakly
           similar to uniprot|P38856 Saccharomyces cerevisiae
           YHR161C YAP1801 Yeast Assembly Polypeptide member of
           AP180 protein family binds Pan1p and clathrin clathrin
           assembly protein
          Length = 669

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 42/89 (47%), Gaps = 2/89 (2%)

Query: 22  LVRNATSNEPTGPTVDQLDELAEKTYDNVEFFEIMDMLDKRLNDKGKNWRHVAKSLTVLD 81
           LV+ AT  +   P    +D +   T D+ EF EIM  L+ R+ND    W  V KSL V+ 
Sbjct: 7   LVKGATKIKMAPPKQKYIDPILLGTSDSSEFMEIMKALESRINDTA--WTIVYKSLIVIH 64

Query: 82  YLVRYGSENCVLWSQENLYIIKTLREFMH 110
            ++R G  +  +    +      LR+  H
Sbjct: 65  LMMRDGDRDVTIKYLSHHLEFFQLRDVFH 93

>KAFR0B05800 Chr2 complement(1200666..1201814) [1149 bp, 382 aa]
           {ON} Anc_8.335 YDR153C
          Length = 382

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 29/97 (29%), Positives = 45/97 (46%), Gaps = 20/97 (20%)

Query: 7   RTAKNVVNGYSSVQVLVRNATSNEPTGPTVDQLDELAEKTYDNVEFFEIMDMLDKRLNDK 66
           R A+NV+  Y   Q+ VR AT+ +  GPT   L+++    +  V  + + + + KRL D 
Sbjct: 21  RFAQNVIVQYEPYQIDVRRATNTDAWGPTTKHLEKVMRNRF-QVPMYLVTEYILKRLIDH 79

Query: 67  -------------------GKNWRHVAKSLTVLDYLV 84
                              G  WR V K LTV++YL+
Sbjct: 80  IATKPKNLYEKARKEYVNYGSEWRVVLKCLTVIEYLL 116

>CAGL0E01199g Chr5 (108041..109279) [1239 bp, 412 aa] {ON} similar
           to uniprot|Q03769 Saccharomyces cerevisiae YDR153c ENT5
          Length = 412

 Score = 43.5 bits (101), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 31/97 (31%), Positives = 43/97 (44%), Gaps = 20/97 (20%)

Query: 7   RTAKNVVNGYSSVQVLVRNATSNEPTGPTVDQLDELAEKTYDNVEFFEIMDMLDKRLNDK 66
           R A+NV+  Y   QV VR AT+ +  GPT   L ++    Y  V  + I + + KRL D 
Sbjct: 21  RFAQNVIVQYEPYQVDVRRATNTDSWGPTPKHLAKVLRNRY-QVPLYLITEYILKRLIDH 79

Query: 67  -------------------GKNWRHVAKSLTVLDYLV 84
                              G  WR V K L V++YL+
Sbjct: 80  IAQRPKNLYEKARKDYVNYGSEWRVVLKCLVVIEYLL 116

>TBLA0H01210 Chr8 (269471..270946) [1476 bp, 491 aa] {ON} Anc_8.335
           YDR153C
          Length = 491

 Score = 43.9 bits (102), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 30/97 (30%), Positives = 45/97 (46%), Gaps = 20/97 (20%)

Query: 7   RTAKNVVNGYSSVQVLVRNATSNEPTGPTVDQLDELAEKTYDNVEFFEIMDMLDKRLNDK 66
           R A+N++  Y   Q+ +R AT+ +  GPT   LD++     + V   +I+D + KRL D 
Sbjct: 21  RYAQNMIIAYEPYQIDIRQATNTDSWGPTKKHLDQIL-LDRNKVPLRKIVDYIMKRLMDH 79

Query: 67  -------------------GKNWRHVAKSLTVLDYLV 84
                              G  WR V KSL VL +L+
Sbjct: 80  INTRPRNLYDRARKDYVNYGTEWRVVFKSLIVLKFLL 116

>NCAS0B03660 Chr2 complement(653627..654877) [1251 bp, 416 aa] {ON}
           Anc_8.335 YDR153C
          Length = 416

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 45/102 (44%), Gaps = 20/102 (19%)

Query: 7   RTAKNVVNGYSSVQVLVRNATSNEPTGPTVDQLDELAEKTYDNVEFFEIMDMLDKRLNDK 66
           R A+NV+  Y   QV +R AT+ +  GPT   L ++    Y  V  + +++   KRL D 
Sbjct: 21  RFAQNVIVQYEPYQVDIRRATNTDAWGPTPKHLSKVLRNRY-QVPLYLMVEYTLKRLVDH 79

Query: 67  -------------------GKNWRHVAKSLTVLDYLVRYGSE 89
                              G  WR V K L V+D+L+   SE
Sbjct: 80  IASRPKNFYEKARKEYVNYGAEWRVVLKCLVVIDFLILNVSE 121

>AGR046C Chr7 complement(800910..802073) [1164 bp, 387 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR153C
           (ENT5)
          Length = 387

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 55/127 (43%), Gaps = 22/127 (17%)

Query: 7   RTAKNVVNGYSSVQVLVRNATSNEPTGPTVDQLDELAEKTYDNVEFFEIMDMLDKRLNDK 66
           R A+NV+  Y   QV VR AT+ +  GPT  Q+ ++  +  ++V  + I +   KRL D 
Sbjct: 21  RFAQNVIIQYEPYQVDVRRATNTDSWGPTPKQMLKVM-RHKNHVPMYLITEYTMKRLVDH 79

Query: 67  -------------------GKNWRHVAKSLTVLDYLVRYGSENCVLWSQENLYIIKTLRE 107
                              G  WR V K L VL++L+   S    L   + L  I T + 
Sbjct: 80  MAKRPKNLYEKARKQYVNYGHEWRVVLKCLVVLEFLILNSSSGQEL--DQVLSCINTHKH 137

Query: 108 FMHEDEM 114
            +  D M
Sbjct: 138 ILARDTM 144

>NDAI0H00280 Chr8 complement(48177..49109) [933 bp, 310 aa] {ON}
           Anc_4.17 YLL038C
          Length = 310

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 55/110 (50%), Gaps = 11/110 (10%)

Query: 5   LLRTAKNVVNGYSSVQVLVRNATS-NEPTGPTVDQLDELAEKTYDNVEFFEIMDMLDKRL 63
           L  T KN V   +  +  V+ AT  NE TG T   ++E++  TY      +I+ ++ KRL
Sbjct: 3   LFDTVKNFVQ--TPTESKVKQATDDNETTGATGTLMNEISVLTYSPKTLKDIIQVIKKRL 60

Query: 64  ND---KGKNWRH-----VAKSLTVLDYLVRYGSENCVLWSQENLYIIKTL 105
           +      K   H     + K+LT++ YL+  GS   + W + N Y+++ +
Sbjct: 61  SSATSSNKKLSHKTSVYIIKTLTLISYLINNGSNEFIEWLRLNFYLVENI 110

>Skud_8.225 Chr8 complement(391820..393685) [1866 bp, 621 aa] {ON}
          YHR161C (REAL)
          Length = 621

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/87 (33%), Positives = 41/87 (47%), Gaps = 11/87 (12%)

Query: 22 LVRNATSNEPTGPTVDQLDELAEKTYDNVEFFEIMDMLDKRLNDKGKNWRHVAKSLTVL- 80
          LV+ AT  +   P    LD +   T    +F+EI+  LD R+ND    W  V K+L V+ 
Sbjct: 7  LVKGATKIKSAPPKQKYLDPILLATGSEEDFYEIVKALDSRVNDTA--WTIVYKTLLVVH 64

Query: 81 --------DYLVRYGSENCVLWSQENL 99
                  D  +RY S N   +S EN+
Sbjct: 65 LMMREGKKDVALRYYSRNLEFFSIENI 91

>NDAI0J00930 Chr10 (209579..210835) [1257 bp, 418 aa] {ON} Anc_8.335
           YDR153C
          Length = 418

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/97 (30%), Positives = 44/97 (45%), Gaps = 20/97 (20%)

Query: 7   RTAKNVVNGYSSVQVLVRNATSNEPTGPTVDQLDELAEKTYDNVEFFEIMDMLDKRLNDK 66
           R A+NV+  Y   QV +R AT+ +  GPT   L ++    Y  V  + +++   KRL D 
Sbjct: 21  RFAQNVIVQYEPYQVDIRRATNTDAWGPTPKHLQKVLRNRY-QVPLYLMVEYTLKRLVDH 79

Query: 67  -------------------GKNWRHVAKSLTVLDYLV 84
                              G  WR V K LTV++YL+
Sbjct: 80  IAVKPKNFYERARKEYVNYGAEWRVVLKCLTVVEYLM 116

>ZYRO0F13684g Chr6 complement(1125731..1126954) [1224 bp, 407 aa]
           {ON} highly similar to uniprot|Q6Q5U2 Saccharomyces
           cerevisiae YDR153C ENT5 Protein containing an N-terminal
           epsin-like domain involved in clathrin recruitment and
           traffic between the Golgi and endosomes associates with
           the clathrin adaptor Gga2p clathrin adaptor complex AP-1
           and clathrin
          Length = 407

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 31/97 (31%), Positives = 44/97 (45%), Gaps = 20/97 (20%)

Query: 7   RTAKNVVNGYSSVQVLVRNATSNEPTGPTVDQLDELAEKTYDNVEFFEIMDMLDKRLNDK 66
           R A+N++  Y   QV VR AT+ +  GPT   L+++    Y  V  + I +   KRL D 
Sbjct: 21  RFAQNMIVQYEPYQVDVRRATNTDSWGPTPKHLEKVLRNRY-QVPMYLITEYTLKRLIDH 79

Query: 67  -------------------GKNWRHVAKSLTVLDYLV 84
                              G  WR V K LTV++YL+
Sbjct: 80  IATRPKNFYEKARKEYVNYGSEWRVVLKCLTVVEYLL 116

>KLLA0D16654g Chr4 complement(1413507..1414706) [1200 bp, 399 aa]
           {ON} similar to uniprot|Q6Q5U2 Saccharomyces cerevisiae
           YDR153C ENT5 Protein containing an N-terminal epsin-like
           domain involved in clathrin recruitment and traffic
           between the Golgi and endosomes associates with the
           clathrin adaptor Gga2p clathrin adaptor complex AP-1 and
           clathrin
          Length = 399

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/97 (29%), Positives = 43/97 (44%), Gaps = 20/97 (20%)

Query: 7   RTAKNVVNGYSSVQVLVRNATSNEPTGPTVDQLDELAEKTYDNVEFFEIMDMLDKRLNDK 66
           R A+NV+  Y   Q+ +R AT+ +  GPT   L ++    Y+ V  F + +   KRL D 
Sbjct: 21  RFAQNVIVQYEPYQIDIRRATNTDSWGPTPKHLAKVMRHRYE-VSMFLMTEYTLKRLVDH 79

Query: 67  -------------------GKNWRHVAKSLTVLDYLV 84
                              G  WR V K L +L+YL+
Sbjct: 80  MAKRPKNMYEKARKQYVNYGNEWRVVLKCLVLLEYLL 116

>KNAG0A05100 Chr1 (744989..746254) [1266 bp, 421 aa] {ON} Anc_8.335
           YDR153C
          Length = 421

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/97 (29%), Positives = 44/97 (45%), Gaps = 20/97 (20%)

Query: 7   RTAKNVVNGYSSVQVLVRNATSNEPTGPTVDQLDELAEKTYDNVEFFEIMDMLDKRLNDK 66
           R A+NV+  Y   QV +R AT+ +  GPT   L ++    Y  V  + + + + KRL D 
Sbjct: 21  RFAQNVIVQYEPYQVDIRRATNTDAWGPTPKHLSKVLRHRY-QVPMYLMTEYILKRLVDH 79

Query: 67  -------------------GKNWRHVAKSLTVLDYLV 84
                              G  WR V K LTV+++L+
Sbjct: 80  IATRPKNLYEKARKDYVNYGAEWRVVLKCLTVIEFLM 116

>Smik_8.245 Chr8 complement(397342..399225) [1884 bp, 627 aa] {ON}
          YHR161C (REAL)
          Length = 627

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 38/72 (52%), Gaps = 2/72 (2%)

Query: 22 LVRNATSNEPTGPTVDQLDELAEKTYDNVEFFEIMDMLDKRLNDKGKNWRHVAKSLTVLD 81
          LV+ AT  +   P    LD +   T    +F+EI+  L+ R+ND    W  V KSL V+ 
Sbjct: 7  LVKGATKIKSAPPKQKYLDPILLGTSSEEDFYEIVKGLNFRINDTA--WTIVYKSLLVVH 64

Query: 82 YLVRYGSENCVL 93
           ++R G+++  L
Sbjct: 65 LMIREGAKDVAL 76

>TBLA0A04040 Chr1 complement(1004703..1005950) [1248 bp, 415 aa]
           {ON} Anc_8.335 YDR153C
          Length = 415

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 49/114 (42%), Gaps = 28/114 (24%)

Query: 7   RTAKNVVNGYSSVQVLVRNATSNEPTGPTVDQLDELAEKTYDNVEFFEIMDMLDKRLNDK 66
           R A+NV+  Y   Q+ +R AT+ +  GPT   L ++    Y  V  + + + + KR+ D 
Sbjct: 21  RFAQNVIVQYEPYQIDIRRATNTDAWGPTSKHLAKVLRNRY-QVPLYLMTEYILKRIVDH 79

Query: 67  -------------------GKNWRHVAKSLTVLDYL---VRYGSE-----NCVL 93
                              G  WR V K L V+D+L   V  G E     +C+L
Sbjct: 80  IAVRPKNFYEKARKDYVNYGAEWRVVLKCLVVIDFLFLNVEEGEELNQVKSCML 133

>KLTH0G11902g Chr7 (1002588..1003787) [1200 bp, 399 aa] {ON} similar
           to uniprot|Q6Q5U2 Saccharomyces cerevisiae YDR153C ENT5
           Protein containing an N-terminal epsin-like domain
           involved in clathrin recruitment and traffic between the
           Golgi and endosomes associates with the clathrin adaptor
           Gga2p clathrin adaptor complex AP-1 and clathrin
          Length = 399

 Score = 40.4 bits (93), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 36/114 (31%), Positives = 48/114 (42%), Gaps = 28/114 (24%)

Query: 7   RTAKNVVNGYSSVQVLVRNATSNEPTGPTVDQLDELAEKTYDNVEFFEIMDMLDKRLNDK 66
           R A+NV+  Y   QV +R AT+ +  GPT   L ++    Y  V    + +   KRL D 
Sbjct: 21  RFAQNVIVQYEPYQVDIRRATNTDSWGPTPKHLFKVMRNKY-QVPLHLMTEYTLKRLVDH 79

Query: 67  -------------------GKNWRHVAKSLTVLDYL---VRYGSE-----NCVL 93
                              G  WR V K L VL+YL   V  GSE     +C+L
Sbjct: 80  IASRPKNFYEKARKQYVNYGSEWRVVLKCLVVLEYLLLNVDNGSELDQVTSCLL 133

>Kwal_YGOB_27.11261 s27 complement(716644..717033,717035..717859)
           [1215 bp, 404 aa] {ON} ANNOTATED BY YGOB -
          Length = 404

 Score = 40.0 bits (92), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 30/97 (30%), Positives = 41/97 (42%), Gaps = 20/97 (20%)

Query: 7   RTAKNVVNGYSSVQVLVRNATSNEPTGPTVDQLDELAEKTYDNVEFFEIMDMLDKRLNDK 66
           R A+NV+  Y   QV +R AT+ +  GPT   L ++    Y  V    + +   KRL D 
Sbjct: 21  RFAQNVIVQYEPYQVDIRRATNTDSWGPTPKHLFKVMRNKY-QVPLHLMTEYTLKRLVDH 79

Query: 67  -------------------GKNWRHVAKSLTVLDYLV 84
                              G  WR V K L VL+YL+
Sbjct: 80  IASRPKNLYEKARKQYVNYGNEWRVVLKCLVVLEYLL 116

>Kwal_27.11263 s27 complement(717032..717859) [828 bp, 275 aa] {OFF}
           YDR153C - Hypothetical ORF [contig 29] FULL
          Length = 275

 Score = 39.3 bits (90), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 30/97 (30%), Positives = 41/97 (42%), Gaps = 20/97 (20%)

Query: 7   RTAKNVVNGYSSVQVLVRNATSNEPTGPTVDQLDELAEKTYDNVEFFEIMDMLDKRLNDK 66
           R A+NV+  Y   QV +R AT+ +  GPT   L ++    Y  V    + +   KRL D 
Sbjct: 21  RFAQNVIVQYEPYQVDIRRATNTDSWGPTPKHLFKVMRNKY-QVPLHLMTEYTLKRLVDH 79

Query: 67  -------------------GKNWRHVAKSLTVLDYLV 84
                              G  WR V K L VL+YL+
Sbjct: 80  IASRPKNLYEKARKQYVNYGNEWRVVLKCLVVLEYLL 116

>Suva_2.315 Chr2
           complement(560767..560940,560968..561033,561037..562005)
           [1209 bp, 403 aa] {ON} YDR153C (REAL)
          Length = 403

 Score = 39.3 bits (90), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 42/97 (43%), Gaps = 20/97 (20%)

Query: 7   RTAKNVVNGYSSVQVLVRNATSNEPTGPTVDQLDELAEKTYDNVEFFEIMDMLDKRLNDK 66
           R A+NV+  Y   QV +R AT+ +  GPT   L ++    Y  V  + + +   KRL D 
Sbjct: 21  RFAQNVIVQYEPYQVDIRRATNTDAWGPTPKHLAKVLRNRY-QVPLYLMTEYTLKRLVDH 79

Query: 67  -------------------GKNWRHVAKSLTVLDYLV 84
                              G  WR V K L V+++L+
Sbjct: 80  IATRPKNLYEKARKDYVNYGSEWRVVLKCLVVVEFLL 116

>SAKL0H15290g Chr8 (1322030..1323211) [1182 bp, 393 aa] {ON} similar
           to uniprot|Q6Q5U2 Saccharomyces cerevisiae YDR153C ENT5
           Protein containing an N-terminal epsin-like domain
           involved in clathrin recruitment and traffic between the
           Golgi and endosomes associates with the clathrin adaptor
           Gga2p clathrin adaptor complex AP-1 and clathrin
          Length = 393

 Score = 39.3 bits (90), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 39/150 (26%), Positives = 68/150 (45%), Gaps = 31/150 (20%)

Query: 7   RTAKNVVNGYSSVQVLVRNATSNEPTGPTVDQLDELAEKTYDNVEFFEIMDMLDKRLNDK 66
           R A+N++  Y   QV +R AT+ +  GPT   L ++    +  V  + + + + KRL D 
Sbjct: 21  RFAQNMIVQYEPYQVDIRRATNTDSWGPTPKHLSKVMRNRF-QVPLYLMTEYILKRLVDH 79

Query: 67  -------------------GKNWRHVAKSLTVLDYL---VRYGSE-----NCVLWSQENL 99
                              G  WR V K L +L+++   V  G+E     NC+L  +  L
Sbjct: 80  IATRPKNLYEKARKQYVNYGNEWRVVLKCLVLLEHMLLNVDVGNELDQVVNCILTHKHIL 139

Query: 100 Y--IIKTLREFMHEDEMGVDHGQIIRVKAK 127
              I++   +F ++ +M V H + I+ K +
Sbjct: 140 TRDIMQYHVDFSNDGKMEV-HERGIKKKCE 168

>TDEL0F04590 Chr6 complement(864567..865652) [1086 bp, 361 aa] {ON}
           Anc_8.335 YDR153C
          Length = 361

 Score = 38.5 bits (88), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 26/97 (26%), Positives = 43/97 (44%), Gaps = 20/97 (20%)

Query: 7   RTAKNVVNGYSSVQVLVRNATSNEPTGPTVDQLDELAEKTYDNVEFFEIMDMLDKRLNDK 66
           R A+N++  Y   Q+ +R AT+ +  GPT   L+++    Y  V  + + +   KRL D 
Sbjct: 21  RFAQNMIVQYEPYQIDIRRATNTDAWGPTPKHLEKVLRNRY-QVPLYLLTEYTLKRLVDH 79

Query: 67  -------------------GKNWRHVAKSLTVLDYLV 84
                              G  WR V K L V+++L+
Sbjct: 80  VATRPKNLYEKARKDYVNYGSEWRVVLKCLVVIEFLL 116

>Skud_4.412 Chr4 complement(736255..737475) [1221 bp, 406 aa] {ON}
           YDR153C (REAL)
          Length = 406

 Score = 38.1 bits (87), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 42/97 (43%), Gaps = 20/97 (20%)

Query: 7   RTAKNVVNGYSSVQVLVRNATSNEPTGPTVDQLDELAEKTYDNVEFFEIMDMLDKRLNDK 66
           R A+NV+  Y   QV +R AT+ +  GPT   L ++    Y  V  + + +   KRL D 
Sbjct: 21  RFAQNVIVQYEPYQVDIRRATNTDAWGPTPKHLAKVLRNRY-QVPLYLMTEYTLKRLVDH 79

Query: 67  -------------------GKNWRHVAKSLTVLDYLV 84
                              G  WR V K L V+++L+
Sbjct: 80  IASRPKNLYEKARKDYVNYGSEWRVVLKCLVVVEFLL 116

>Kpol_1036.76 s1036 complement(205197..206303) [1107 bp, 368 aa]
           {ON} complement(205197..206303) [1107 nt, 369 aa]
          Length = 368

 Score = 38.1 bits (87), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 25/97 (25%), Positives = 44/97 (45%), Gaps = 20/97 (20%)

Query: 7   RTAKNVVNGYSSVQVLVRNATSNEPTGPTVDQLDELAEKTYDNVEFFEIMDMLDKRLNDK 66
           R A+N++  Y   Q+ +R AT+ +  GPT   L ++    Y +V  + + + + KRL D 
Sbjct: 21  RFAQNMIVQYEPYQIDIRTATNTDSWGPTSKHLQKVIRHKY-HVPVYLMTEYILKRLIDH 79

Query: 67  -------------------GKNWRHVAKSLTVLDYLV 84
                              G  WR V K L ++++L+
Sbjct: 80  IASKPKNFYEKARKEYVNYGNEWRVVMKCLILIEFLL 116

>Smik_4.398 Chr4 complement(724753..726003) [1251 bp, 416 aa] {ON}
           YDR153C (REAL)
          Length = 416

 Score = 38.1 bits (87), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 42/97 (43%), Gaps = 20/97 (20%)

Query: 7   RTAKNVVNGYSSVQVLVRNATSNEPTGPTVDQLDELAEKTYDNVEFFEIMDMLDKRLNDK 66
           R A+NV+  Y   Q+ +R AT+ +  GPT   L ++    Y  V  + + +   KRL D 
Sbjct: 21  RFAQNVIVQYEPYQIDIRRATNTDAWGPTPKHLAKVLRNRY-QVPLYLMTEYTLKRLVDH 79

Query: 67  -------------------GKNWRHVAKSLTVLDYLV 84
                              G  WR V K L V+++L+
Sbjct: 80  IATRPKNFYEKARKDYVNYGSEWRVVLKCLAVIEFLL 116

>YDR153C Chr4 complement(766736..767971) [1236 bp, 411 aa] {ON}
           ENT5Protein containing an N-terminal epsin-like domain
           involved in clathrin recruitment and traffic between the
           Golgi and endosomes; associates with the clathrin
           adaptor Gga2p, clathrin adaptor complex AP-1, and
           clathrin
          Length = 411

 Score = 38.1 bits (87), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 42/97 (43%), Gaps = 20/97 (20%)

Query: 7   RTAKNVVNGYSSVQVLVRNATSNEPTGPTVDQLDELAEKTYDNVEFFEIMDMLDKRLNDK 66
           R A+NV+  Y   Q+ +R AT+ +  GPT   L ++    Y  V  + + +   KRL D 
Sbjct: 21  RFAQNVIVQYEPYQIDIRRATNTDAWGPTPKHLAKVLRNRY-QVPLYLMTEYTLKRLVDH 79

Query: 67  -------------------GKNWRHVAKSLTVLDYLV 84
                              G  WR V K L V+++L+
Sbjct: 80  IATRPKNLYEKARKDYVNYGSEWRVVLKCLVVIEFLL 116

>Kpol_344.8 s344 complement(20765..21919) [1155 bp, 384 aa] {ON}
           complement(20765..21919) [1155 nt, 385 aa]
          Length = 384

 Score = 38.1 bits (87), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 26/102 (25%), Positives = 45/102 (44%), Gaps = 20/102 (19%)

Query: 7   RTAKNVVNGYSSVQVLVRNATSNEPTGPTVDQLDELAEKTYDNVEFFEIMDMLDKRLNDK 66
           R  +N++  Y   Q+ +R AT+ +  GPT   L ++    Y +V  + + + + KR+ D 
Sbjct: 21  RFMQNMIVQYEPYQIDIRRATNTDAWGPTTKHLQKVIRNKY-SVPLYLMTEYVLKRIVDH 79

Query: 67  -------------------GKNWRHVAKSLTVLDYLVRYGSE 89
                              G  WR + K L V++YL+   SE
Sbjct: 80  LAKRPKNLYEKARKEYVNYGSEWRIILKCLIVIEYLLLNVSE 121

>TPHA0C00740 Chr3 (144476..145633) [1158 bp, 385 aa] {ON} Anc_8.335
           YDR153C
          Length = 385

 Score = 37.4 bits (85), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 42/97 (43%), Gaps = 20/97 (20%)

Query: 7   RTAKNVVNGYSSVQVLVRNATSNEPTGPTVDQLDELAEKTYDNVEFFEIMDMLDKRLNDK 66
           R  +N++  Y   Q+ VR A++ +  GPT   L ++    Y +V  + I +   KRL D 
Sbjct: 21  RFMQNMIVQYEPYQIDVRRASNTDAWGPTSKHLQKVLRHKY-SVPLYLITEYTLKRLIDH 79

Query: 67  -------------------GKNWRHVAKSLTVLDYLV 84
                              G  WR V K L +LD+L+
Sbjct: 80  IATNSKNVYEKARKEYVNFGSEWRVVFKCLVILDFLL 116

>TBLA0B05770 Chr2 complement(1364772..1366814) [2043 bp, 680 aa]
          {ON} Anc_5.84 YGR241C
          Length = 680

 Score = 37.0 bits (84), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 35/72 (48%), Gaps = 2/72 (2%)

Query: 22 LVRNATSNEPTGPTVDQLDELAEKTYDNVEFFEIMDMLDKRLNDKGKNWRHVAKSLTVLD 81
          LV+ AT  +   P    +D +   + D  +F EI+  L  R++D    W  V KSL V  
Sbjct: 7  LVKGATKIKMAPPKQKYIDPILMGSTDPRDFHEIIRALYSRISDSA--WTVVYKSLIVTH 64

Query: 82 YLVRYGSENCVL 93
           L+R G ++  L
Sbjct: 65 LLIREGEKDITL 76

>NDAI0A02830 Chr1 (636619..638040) [1422 bp, 473 aa] {ON} Anc_5.84
          YGR241C
          Length = 473

 Score = 35.8 bits (81), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 39/77 (50%), Gaps = 1/77 (1%)

Query: 17 SSVQVLVRNATSNEPTGPTVDQLDELAEKTYDNVEFFEIMDMLDKRLNDKGKNWRHVAKS 76
          +S + LV+ AT  +   P    +D +   T +N+EF +I+  L  R+N+    W  + K+
Sbjct: 2  TSYKKLVKGATKIKMAPPKQKYVDPILLGTSNNIEFQQIVSELTSRINNCNI-WSVIYKT 60

Query: 77 LTVLDYLVRYGSENCVL 93
          L V+  ++  G  N  L
Sbjct: 61 LIVVHLMISIGEPNVTL 77

>KNAG0E00610 Chr5 complement(102826..104640) [1815 bp, 604 aa]
          {ON} Anc_5.84 YGR241C
          Length = 604

 Score = 35.4 bits (80), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 32/72 (44%), Gaps = 2/72 (2%)

Query: 22 LVRNATSNEPTGPTVDQLDELAEKTYDNVEFFEIMDMLDKRLNDKGKNWRHVAKSLTVLD 81
          LV+ AT  +   P    +D +   T    +F EI+  L  R+ D    W  V KSL V  
Sbjct: 7  LVKGATKIKMAPPKAKYVDPILLGTAQRDDFREIVGALRTRVGDSA--WTVVYKSLLVCH 64

Query: 82 YLVRYGSENCVL 93
           + R G E  VL
Sbjct: 65 LMFREGDEQIVL 76

>KAFR0I01460 Chr9 (304865..305692) [828 bp, 275 aa] {ON} Anc_4.17
           YLL038C
          Length = 275

 Score = 34.7 bits (78), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 55/114 (48%), Gaps = 14/114 (12%)

Query: 4   ALLRTAKNVVNGYSSVQVLVRNAT-SNEPTGPTVDQLDELAEKTYDNVEFFEIMDMLDKR 62
           +   + +N+V  YS  ++ VR AT  NE    T   ++E++  TY      EI+ +L K+
Sbjct: 2   SFFNSVRNLV--YSQTELKVRQATDENEIIRSTGTLMNEISVLTYSAKTLKEIIGILKKK 59

Query: 63  L-------NDKG----KNWRHVAKSLTVLDYLVRYGSENCVLWSQENLYIIKTL 105
           L       N  G    K    V K+ T++ YL+  GS + + W + N  +++ L
Sbjct: 60  LSLLYGLKNGNGIISHKVCVQVLKTFTLISYLLNNGSNDFINWLKLNNGVLQIL 113

>Ecym_4264 Chr4 complement(558142..559368) [1227 bp, 408 aa] {ON}
          similar to Ashbya gossypii AGR046C
          Length = 408

 Score = 33.9 bits (76), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 35/69 (50%), Gaps = 7/69 (10%)

Query: 7  RTAKNVVNGYSSVQVLVRNATSNEPTGPTVDQLDELAEKTYDNVEFFEIMDMLDKRLNDK 66
          R A+N++  Y   QV +R AT+ +  GPT  QL ++    Y  V  + I +   KRL D 
Sbjct: 21 RFAQNMIIQYEPYQVDIRRATNTDSWGPTPKQLAKVMRNRY-QVPMYLITEYTMKRLVD- 78

Query: 67 GKNWRHVAK 75
               H+AK
Sbjct: 79 -----HMAK 82

>NCAS0A03200 Chr1 complement(627997..633363) [5367 bp, 1788 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1788

 Score = 32.7 bits (73), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 24/100 (24%), Positives = 48/100 (48%), Gaps = 19/100 (19%)

Query: 21  VLVRNATSNEPTGPTVDQLDELAEKTYDNVEFFEIMDMLDKRLNDKGKNWRHVAKSLTVL 80
           +L+  +  N+  GP           + + V F  I D+LD   N++  + + V     + 
Sbjct: 472 ILIHTSVQNDSNGPL----------SAEEVRF--IQDILDNESNEESSDSQQV-----IS 514

Query: 81  DYLVRYGSENCVLWSQENLYIIKTLREFMHEDEMGVDHGQ 120
           + LV +  +N V   Q+N+ ++K++RE   + E+  +H Q
Sbjct: 515 ERLVTF--QNIVELQQKNIDLLKSVRELARKLELQEEHQQ 552

>NCAS0E03820 Chr5 (750631..751917) [1287 bp, 428 aa] {ON} Anc_5.84
          YGR241C
          Length = 428

 Score = 32.0 bits (71), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 35/72 (48%), Gaps = 1/72 (1%)

Query: 22 LVRNATSNEPTGPTVDQLDELAEKTYDNVEFFEIMDMLDKRLNDKGKNWRHVAKSLTVLD 81
          LV+ AT  +   P    +D +   T + +EF +I+  L  R+N+    W  V K+L V+ 
Sbjct: 7  LVKGATKVKMAPPKQKYVDPILLGTANPMEFEQIVSQLTARINNCNI-WSVVYKTLIVVH 65

Query: 82 YLVRYGSENCVL 93
           ++  G +   L
Sbjct: 66 LMISIGEQGVTL 77

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.132    0.379 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 37,921,468
Number of extensions: 1371593
Number of successful extensions: 3249
Number of sequences better than 10.0: 112
Number of HSP's gapped: 3222
Number of HSP's successfully gapped: 162
Length of query: 498
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 384
Effective length of database: 40,409,475
Effective search space: 15517238400
Effective search space used: 15517238400
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 68 (30.8 bits)