Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0F10912g7.343ON69369334140.0
Kwal_56.246167.343ON71570825370.0
KLTH0H01408g7.343ON72371425040.0
TDEL0C020407.343ON70568725020.0
NCAS0A141107.343ON75360924660.0
ZYRO0F11572g7.343ON73160824590.0
CAGL0I03410g7.343ON72470724320.0
NDAI0A019407.343ON76560224120.0
KNAG0C037407.343ON72761024090.0
Kpol_2001.717.343ON72669923930.0
Suva_4.827.343ON75561923880.0
Smik_4.747.343ON84561323690.0
YDL164C (CDC9)7.343ON75561323600.0
KLLA0D12496g7.343ON70069423480.0
Skud_4.937.343ON75561323380.0
KAFR0B008307.343ON71070423080.0
ACL155W7.343ON69769122690.0
TBLA0E020507.343ON72068921370.0
TPHA0D045707.343ON73670521310.0
TPHA0M002606.18ON9664032772e-24
Smik_15.1746.18ON9454352763e-24
KNAG0F028706.18ON9542672753e-24
TDEL0G045106.18ON9694092692e-23
ZYRO0C07854g6.18ON9442702673e-23
ACR008W6.18ON9814032673e-23
KLLA0D01089g6.18ON9073832646e-23
Suva_15.1806.18ON9484422647e-23
YOR005C (DNL4)6.18ON9444102593e-22
TBLA0G010406.18ON9722432583e-22
KAFR0A050506.18ON9482552541e-21
NCAS0D026506.18ON9502692512e-21
NDAI0I022606.18ON9672702512e-21
Skud_15.1666.18ON9472682503e-21
CAGL0E02695g6.18ON9462432494e-21
KLTH0C11286g6.18ON9513902405e-20
Kwal_56.224146.18ON9632592361e-19
Kpol_1032.76.18ON9652092227e-18
Smik_8.2884.369ON30961800.46
CAGL0C01683g6.161ON1115127800.53
NCAS0A086602.662ON105783734.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0F10912g
         (693 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0F10912g Chr6 complement(854430..856511) [2082 bp, 693 aa] {...  1319   0.0  
Kwal_56.24616 s56 (1076178..1078325) [2148 bp, 715 aa] {ON} YDL1...   981   0.0  
KLTH0H01408g Chr8 complement(129752..131923) [2172 bp, 723 aa] {...   969   0.0  
TDEL0C02040 Chr3 complement(352579..354696) [2118 bp, 705 aa] {O...   968   0.0  
NCAS0A14110 Chr1 (2774465..2776726) [2262 bp, 753 aa] {ON} Anc_7...   954   0.0  
ZYRO0F11572g Chr6 (949236..951431) [2196 bp, 731 aa] {ON} simila...   951   0.0  
CAGL0I03410g Chr9 complement(289606..291780) [2175 bp, 724 aa] {...   941   0.0  
NDAI0A01940 Chr1 complement(432302..434599) [2298 bp, 765 aa] {O...   933   0.0  
KNAG0C03740 Chr3 (737968..740151) [2184 bp, 727 aa] {ON} Anc_7.3...   932   0.0  
Kpol_2001.71 s2001 (195103..197283) [2181 bp, 726 aa] {ON} (1951...   926   0.0  
Suva_4.82 Chr4 complement(152544..154811) [2268 bp, 755 aa] {ON}...   924   0.0  
Smik_4.74 Chr4 complement(141744..144281) [2538 bp, 845 aa] {ON}...   917   0.0  
YDL164C Chr4 complement(164987..167254) [2268 bp, 755 aa] {ON}  ...   913   0.0  
KLLA0D12496g Chr4 complement(1059684..1061786) [2103 bp, 700 aa]...   909   0.0  
Skud_4.93 Chr4 complement(160642..162909) [2268 bp, 755 aa] {ON}...   905   0.0  
KAFR0B00830 Chr2 (157155..159287) [2133 bp, 710 aa] {ON} Anc_7.3...   893   0.0  
ACL155W Chr3 (81492..83585) [2094 bp, 697 aa] {ON} Syntenic homo...   878   0.0  
TBLA0E02050 Chr5 (498038..500200) [2163 bp, 720 aa] {ON} Anc_7.3...   827   0.0  
TPHA0D04570 Chr4 (996539..998749) [2211 bp, 736 aa] {ON} Anc_7.3...   825   0.0  
TPHA0M00260 Chr13 complement(50326..53226) [2901 bp, 966 aa] {ON...   111   2e-24
Smik_15.174 Chr15 complement(301851..304688) [2838 bp, 945 aa] {...   110   3e-24
KNAG0F02870 Chr6 (543177..546041) [2865 bp, 954 aa] {ON} Anc_6.1...   110   3e-24
TDEL0G04510 Chr7 (819479..822388) [2910 bp, 969 aa] {ON} Anc_6.1...   108   2e-23
ZYRO0C07854g Chr3 (595546..598380) [2835 bp, 944 aa] {ON} simila...   107   3e-23
ACR008W Chr3 (368913..371858) [2946 bp, 981 aa] {ON} Syntenic ho...   107   3e-23
KLLA0D01089g Chr4 complement(97438..100161) [2724 bp, 907 aa] {O...   106   6e-23
Suva_15.180 Chr15 complement(308983..311829) [2847 bp, 948 aa] {...   106   7e-23
YOR005C Chr15 complement(334509..337343) [2835 bp, 944 aa] {ON} ...   104   3e-22
TBLA0G01040 Chr7 complement(258966..261884) [2919 bp, 972 aa] {O...   103   3e-22
KAFR0A05050 Chr1 (1003515..1006361) [2847 bp, 948 aa] {ON} Anc_6...   102   1e-21
NCAS0D02650 Chr4 (508606..511458) [2853 bp, 950 aa] {ON} Anc_6.1...   101   2e-21
NDAI0I02260 Chr9 complement(514711..517614) [2904 bp, 967 aa] {O...   101   2e-21
Skud_15.166 Chr15 complement(294550..297393) [2844 bp, 947 aa] {...   100   3e-21
CAGL0E02695g Chr5 complement(254591..257431) [2841 bp, 946 aa] {...   100   4e-21
KLTH0C11286g Chr3 (926742..929597) [2856 bp, 951 aa] {ON} simila...    97   5e-20
Kwal_56.22414 s56 complement(117198..120089) [2892 bp, 963 aa] {...    96   1e-19
Kpol_1032.7 s1032 complement(12295..15192) [2898 bp, 965 aa] {ON...    90   7e-18
Smik_8.288 Chr8 complement(472376..473305) [930 bp, 309 aa] {ON}...    35   0.46 
CAGL0C01683g Chr3 (178695..182042) [3348 bp, 1115 aa] {ON} highl...    35   0.53 
NCAS0A08660 Chr1 complement(1710032..1713205) [3174 bp, 1057 aa]...    33   4.0  

>SAKL0F10912g Chr6 complement(854430..856511) [2082 bp, 693 aa] {ON}
           similar to uniprot|P04819 Saccharomyces cerevisiae
           YDL164C CDC9 DNA ligase found in the nucleus and
           mitochondria an essential enzyme that joins Okazaki
           fragments during DNA replication also acts in nucleotide
           excision repair base excision repair and recombination
          Length = 693

 Score = 1319 bits (3414), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 646/693 (93%), Positives = 646/693 (93%)

Query: 1   MLKNPLRIMSTKKQVTLARFFSSAKKGGNKEDKLEPQAKRAKVDPANTSELITNEAXXXX 60
           MLKNPLRIMSTKKQVTLARFFSSAKKGGNKEDKLEPQAKRAKVDPANTSELITNEA    
Sbjct: 1   MLKNPLRIMSTKKQVTLARFFSSAKKGGNKEDKLEPQAKRAKVDPANTSELITNEAVARS 60

Query: 61  XXXXXXXXXXXXXXXXXTPVMAPVHHSKIPYSDVCNIFSEIESTSSRLSIVKICSNFFYS 120
                            TPVMAPVHHSKIPYSDVCNIFSEIESTSSRLSIVKICSNFFYS
Sbjct: 61  VSPPTPVVPVAPIISTSTPVMAPVHHSKIPYSDVCNIFSEIESTSSRLSIVKICSNFFYS 120

Query: 121 VLKQNPSNLVPITYLFINRLGPDYEPXXXXXXXXXXXMKTIAESCGKSLQQVRAKYREIG 180
           VLKQNPSNLVPITYLFINRLGPDYEP           MKTIAESCGKSLQQVRAKYREIG
Sbjct: 121 VLKQNPSNLVPITYLFINRLGPDYEPGLELGLGEGLLMKTIAESCGKSLQQVRAKYREIG 180

Query: 181 DLGEVAQEARAVQPTMFKPKPLTVGEVFNNLKSIAKSQGKDSQTRKIQLIKRMLTACQGV 240
           DLGEVAQEARAVQPTMFKPKPLTVGEVFNNLKSIAKSQGKDSQTRKIQLIKRMLTACQGV
Sbjct: 181 DLGEVAQEARAVQPTMFKPKPLTVGEVFNNLKSIAKSQGKDSQTRKIQLIKRMLTACQGV 240

Query: 241 EAKFLIRSLESKLRIGLAEKTVLISLSKALLSYEHDGEEPSSELVENAEQRVRDAFCQVP 300
           EAKFLIRSLESKLRIGLAEKTVLISLSKALLSYEHDGEEPSSELVENAEQRVRDAFCQVP
Sbjct: 241 EAKFLIRSLESKLRIGLAEKTVLISLSKALLSYEHDGEEPSSELVENAEQRVRDAFCQVP 300

Query: 301 NYEIVINTCLEHGIMEVNKHCVLKPGIPLKPMLAKPSKSITEVLDRFHGEKFTCEYKYDG 360
           NYEIVINTCLEHGIMEVNKHCVLKPGIPLKPMLAKPSKSITEVLDRFHGEKFTCEYKYDG
Sbjct: 301 NYEIVINTCLEHGIMEVNKHCVLKPGIPLKPMLAKPSKSITEVLDRFHGEKFTCEYKYDG 360

Query: 361 ERAQVHLLPDGSMNIYSRNGENMTERYPELHIRDYLADPETTHSLILDCEAVAWDTEQGK 420
           ERAQVHLLPDGSMNIYSRNGENMTERYPELHIRDYLADPETTHSLILDCEAVAWDTEQGK
Sbjct: 361 ERAQVHLLPDGSMNIYSRNGENMTERYPELHIRDYLADPETTHSLILDCEAVAWDTEQGK 420

Query: 421 ILPFQILSTRKRKGVEAKDVKVRVCLFAFDMLCYNGQSLINNSLLERREYLQRVLKPVTG 480
           ILPFQILSTRKRKGVEAKDVKVRVCLFAFDMLCYNGQSLINNSLLERREYLQRVLKPVTG
Sbjct: 421 ILPFQILSTRKRKGVEAKDVKVRVCLFAFDMLCYNGQSLINNSLLERREYLQRVLKPVTG 480

Query: 481 QFQFANELNSSNLEDVQKYLEQSVKDACEGLMVKVLEGEESHYEPSKRSRNWLKLKKDYL 540
           QFQFANELNSSNLEDVQKYLEQSVKDACEGLMVKVLEGEESHYEPSKRSRNWLKLKKDYL
Sbjct: 481 QFQFANELNSSNLEDVQKYLEQSVKDACEGLMVKVLEGEESHYEPSKRSRNWLKLKKDYL 540

Query: 541 QGVGDSLDLCVLXXXXXXXXXXXXXXXFLLGCYNQDTGEFETCCKIGTGFSDEMLVSLYE 600
           QGVGDSLDLCVL               FLLGCYNQDTGEFETCCKIGTGFSDEMLVSLYE
Sbjct: 541 QGVGDSLDLCVLGAYYGRGKRTGTYGGFLLGCYNQDTGEFETCCKIGTGFSDEMLVSLYE 600

Query: 601 KLKPSSLEQPKAFYVYDSSAEPDVWFEPTMLFEVLTADLSLSPIYKAGNSAYGKGISLRF 660
           KLKPSSLEQPKAFYVYDSSAEPDVWFEPTMLFEVLTADLSLSPIYKAGNSAYGKGISLRF
Sbjct: 601 KLKPSSLEQPKAFYVYDSSAEPDVWFEPTMLFEVLTADLSLSPIYKAGNSAYGKGISLRF 660

Query: 661 PRFIRIRDDKDVEDATSSEQIVELYESQVNLQK 693
           PRFIRIRDDKDVEDATSSEQIVELYESQVNLQK
Sbjct: 661 PRFIRIRDDKDVEDATSSEQIVELYESQVNLQK 693

>Kwal_56.24616 s56 (1076178..1078325) [2148 bp, 715 aa] {ON} YDL164C
           (CDC9) - DNA ligase [contig 161] FULL
          Length = 715

 Score =  981 bits (2537), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 471/708 (66%), Positives = 559/708 (78%), Gaps = 22/708 (3%)

Query: 6   LRIMSTKKQVTLARFFSSAKKGGNKEDKLEPQAKR-------AKVDPANTSELITNEAXX 58
           L + S KKQ TLA+FFSS K+  ++++  +  AK+       AK + +  S+   +E   
Sbjct: 7   LSMSSAKKQATLAKFFSSKKRSNDEKEGPQESAKKSQLNAIDAKPESSKGSQPNVDETNH 66

Query: 59  XXXXXXXXXXXXXXXXXXXTPVMAPVHHS---------------KIPYSDVCNIFSEIES 103
                               P    V  S                + YS++C++F+EIE 
Sbjct: 67  ETLQKPQLSAAEPKTEFAMNPAKLAVEKSHGDVAKIGISAPKDSNVMYSEMCSVFNEIEG 126

Query: 104 TSSRLSIVKICSNFFYSVLKQNPSNLVPITYLFINRLGPDYEPXXXXXXXXXXXMKTIAE 163
           TSSRL IVK+CS+F YSVL +   +LVPITYL IN+LGPDY+P           MKTI+E
Sbjct: 127 TSSRLQIVKLCSDFLYSVLTKTRKDLVPITYLLINKLGPDYQPGLELGLGEGLLMKTISE 186

Query: 164 SCGKSLQQVRAKYREIGDLGEVAQEARAVQPTMFKPKPLTVGEVFNNLKSIAKSQGKDSQ 223
           SCGKSLQQV+A+YRE+GDLG +AQEAR+VQPTMFKPKPLT G VF NL+ IA++QGKDSQ
Sbjct: 187 SCGKSLQQVKARYRELGDLGRIAQEARSVQPTMFKPKPLTTGMVFANLQDIARAQGKDSQ 246

Query: 224 TRKIQLIKRMLTACQGVEAKFLIRSLESKLRIGLAEKTVLISLSKALLSYEHDGEEPSSE 283
            RK+QLIK+MLTAC+GVEAKFLIRSLESKLRIGLAEK+VL++LSKA+L++EH G+EPSS+
Sbjct: 247 LRKVQLIKKMLTACEGVEAKFLIRSLESKLRIGLAEKSVLVALSKAILTHEHGGKEPSSD 306

Query: 284 LVENAEQRVRDAFCQVPNYEIVINTCLEHGIMEVNKHCVLKPGIPLKPMLAKPSKSITEV 343
           LV+ AEQ++RDAFCQVPNYEIVIN  LEHGIME+ KHCVL PGIPLKPMLAKPSKSI+EV
Sbjct: 307 LVDAAEQKIRDAFCQVPNYEIVINAALEHGIMELEKHCVLTPGIPLKPMLAKPSKSISEV 366

Query: 344 LDRFHGEKFTCEYKYDGERAQVHLLPDGSMNIYSRNGENMTERYPELHIRDYLADPETTH 403
           LDRF G++FTCEYKYDGERAQVHLLPDGSM IYSRNGENMTERYPE++I D++A P+ TH
Sbjct: 367 LDRFQGQRFTCEYKYDGERAQVHLLPDGSMRIYSRNGENMTERYPEINISDFVAHPDETH 426

Query: 404 SLILDCEAVAWDTEQGKILPFQILSTRKRKGVEAKDVKVRVCLFAFDMLCYNGQSLINNS 463
           +LILDCEAVAWD ++  ILPFQ+LSTRKRKGV A+DVKVRVCLFAFD+LCYN + LIN S
Sbjct: 427 TLILDCEAVAWDKDKNVILPFQVLSTRKRKGVVAEDVKVRVCLFAFDILCYNDEPLINKS 486

Query: 464 LLERREYLQRVLKPVTGQFQFANELNSSNLEDVQKYLEQSVKDACEGLMVKVLEGEESHY 523
           L ERR YL+R+LKPV G+ Q A+E+ + +L+++Q YL+QSVKD CEGLMVKVL+GEESHY
Sbjct: 487 LAERRTYLERILKPVPGELQLASEVTTMSLDEMQLYLDQSVKDCCEGLMVKVLDGEESHY 546

Query: 524 EPSKRSRNWLKLKKDYLQGVGDSLDLCVLXXXXXXXXXXXXXXXFLLGCYNQDTGEFETC 583
           EPSKRSRNWLKLKKDYLQGVGDSLDLCVL               FLLGCYNQDTGEFETC
Sbjct: 547 EPSKRSRNWLKLKKDYLQGVGDSLDLCVLGAYYGRGKRTGTYGGFLLGCYNQDTGEFETC 606

Query: 584 CKIGTGFSDEMLVSLYEKLKPSSLEQPKAFYVYDSSAEPDVWFEPTMLFEVLTADLSLSP 643
           CKIGTGFSDEML +LYEKL P+ + +PKAFYVY  SA+PDVW EP+MLFEVLTADLSLSP
Sbjct: 607 CKIGTGFSDEMLQNLYEKLSPTEIPEPKAFYVYSESAQPDVWLEPSMLFEVLTADLSLSP 666

Query: 644 IYKAGNSAYGKGISLRFPRFIRIRDDKDVEDATSSEQIVELYESQVNL 691
           +YKAG S+YGKGISLRFPRFIRIRDDK VEDATSSEQ++E YESQ ++
Sbjct: 667 VYKAGGSSYGKGISLRFPRFIRIRDDKSVEDATSSEQVIEFYESQSHI 714

>KLTH0H01408g Chr8 complement(129752..131923) [2172 bp, 723 aa] {ON}
           similar to uniprot|P04819 Saccharomyces cerevisiae
           YDL164C CDC9 DNA ligase found in the nucleus and
           mitochondria an essential enzyme that joins Okazaki
           fragments during DNA replication also acts in nucleotide
           excision repair base excision repair and recombination
          Length = 723

 Score =  969 bits (2504), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 467/714 (65%), Positives = 556/714 (77%), Gaps = 34/714 (4%)

Query: 10  STKKQVTLARFFSSAKKGGNKEDKLEPQAKRAKVDP--------ANTSELITNEAXXXXX 61
           S KKQ TLA+FFSS K+   +E   EP AK+   DP        +++  L T  +     
Sbjct: 11  SIKKQATLAKFFSSKKRSVEEEKSHEP-AKKLHSDPIGAGSGSPSSSPPLATGSSDAGSV 69

Query: 62  XXXXXXXXXXXXXXXXTPVM------------------------APVHHSKIPYSDVCNI 97
                           TP +                        AP   SKI Y+++CN+
Sbjct: 70  KVETSATSTGENTKAGTPTLPDSDEPAKRAVAATKGDPAKLGASAP-KDSKILYAEMCNV 128

Query: 98  FSEIESTSSRLSIVKICSNFFYSVLKQNPSNLVPITYLFINRLGPDYEPXXXXXXXXXXX 157
           F+EIE TSSRL IVK+C +F YSVL +   ++VPITYL IN+LGPDY+P           
Sbjct: 129 FNEIEGTSSRLQIVKLCGDFLYSVLLKARKDIVPITYLLINKLGPDYQPGLELGLGEGLL 188

Query: 158 MKTIAESCGKSLQQVRAKYREIGDLGEVAQEARAVQPTMFKPKPLTVGEVFNNLKSIAKS 217
           MKTI+ESCGKSLQQ++A+YRE+GDLG +AQEARAVQPTMFKPKPLT GEVF+NL++IA+S
Sbjct: 189 MKTISESCGKSLQQIKARYRELGDLGRIAQEARAVQPTMFKPKPLTTGEVFSNLQAIARS 248

Query: 218 QGKDSQTRKIQLIKRMLTACQGVEAKFLIRSLESKLRIGLAEKTVLISLSKALLSYEHDG 277
           QGKDSQ RK+QLIKRMLTACQG+EAKFLIRSLESKLRIGLAEK+VL++LSKALL+YEH+G
Sbjct: 249 QGKDSQLRKVQLIKRMLTACQGLEAKFLIRSLESKLRIGLAEKSVLVALSKALLTYEHNG 308

Query: 278 EEPSSELVENAEQRVRDAFCQVPNYEIVINTCLEHGIMEVNKHCVLKPGIPLKPMLAKPS 337
           +EPSSELV+ AEQ++RDAFCQVPNY+IVI T LEHGIME++KHCVL PGIPLKPMLAKPS
Sbjct: 309 KEPSSELVDTAEQKIRDAFCQVPNYQIVIETALEHGIMELDKHCVLTPGIPLKPMLAKPS 368

Query: 338 KSITEVLDRFHGEKFTCEYKYDGERAQVHLLPDGSMNIYSRNGENMTERYPELHIRDYLA 397
           KSI+EVLDRF G++FTCEYKYDGERAQVHLLPDGSM IYSRNGENMTERYPE+ I D++A
Sbjct: 369 KSISEVLDRFQGQRFTCEYKYDGERAQVHLLPDGSMRIYSRNGENMTERYPEIRISDFIA 428

Query: 398 DPETTHSLILDCEAVAWDTEQGKILPFQILSTRKRKGVEAKDVKVRVCLFAFDMLCYNGQ 457
           DP  TH+LILDCEAVAWD E+  ILPFQ+LSTRKRKGV  +DVKVRVCLFAFD+LCYN +
Sbjct: 429 DPARTHTLILDCEAVAWDKEKNTILPFQVLSTRKRKGVAVEDVKVRVCLFAFDILCYNDE 488

Query: 458 SLINNSLLERREYLQRVLKPVTGQFQFANELNSSNLEDVQKYLEQSVKDACEGLMVKVLE 517
            LI   L ERR  L+R L PV G+ Q A+E+ + +L+++Q YL+Q+V+D CEGLMVK+LE
Sbjct: 489 PLITRPLAERRACLERALVPVPGELQLASEVTTMSLDELQHYLDQAVRDCCEGLMVKILE 548

Query: 518 GEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVLXXXXXXXXXXXXXXXFLLGCYNQDT 577
           GEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVL               FLLGCYNQD+
Sbjct: 549 GEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVLGAYYGRGKRTGTYGGFLLGCYNQDS 608

Query: 578 GEFETCCKIGTGFSDEMLVSLYEKLKPSSLEQPKAFYVYDSSAEPDVWFEPTMLFEVLTA 637
           GE+ETCCKIGTGFS+EML +L+++L P+++  PKAFYV+  SA PDVWFEPT+LFEVLTA
Sbjct: 609 GEYETCCKIGTGFSEEMLQTLFDRLSPTAIPTPKAFYVHSESAPPDVWFEPTLLFEVLTA 668

Query: 638 DLSLSPIYKAGNSAYGKGISLRFPRFIRIRDDKDVEDATSSEQIVELYESQVNL 691
           DLSLSP+YKAG S+YGKGISLRFPRFIR+RDDK  E+ATSSEQ+VE YESQ ++
Sbjct: 669 DLSLSPVYKAGTSSYGKGISLRFPRFIRLRDDKTPEEATSSEQVVEFYESQSHV 722

>TDEL0C02040 Chr3 complement(352579..354696) [2118 bp, 705 aa] {ON}
           Anc_7.343 YDL164C
          Length = 705

 Score =  968 bits (2502), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 474/687 (68%), Positives = 549/687 (79%), Gaps = 7/687 (1%)

Query: 10  STKKQVTLARFFSSAKKGGNKEDKLEPQAK----RAKVDPANTSELITNEAXXXXXXXXX 65
           S KKQ TLARFFS+ +K   KE K+    K    R   D   T +  ++ +         
Sbjct: 20  SGKKQATLARFFSAVQKDDTKE-KVNGDVKIIESRDNQDEPVTKKFKSS-SPVKLQTSSL 77

Query: 66  XXXXXXXXXXXXTPVMAPVHHSKIPYSDVCNIFSEIESTSSRLSIVKICSNFFYSVLKQN 125
                        PV   +++SK+PYSDVCN+F EIE TSSRLSI+KICS FF  ++K N
Sbjct: 78  SPVKSAGVESGDKPVSPDLYYSKVPYSDVCNVFQEIEGTSSRLSIIKICSEFFSRIMKDN 137

Query: 126 PSNLVPITYLFINRLGPDYEPXXXXXXXXXXXMKTIAESCGKSLQQVRAKYREIGDLGEV 185
           P NL+P TYLFINRLGPDYEP           MKTI+E+CGKSL QV+ +YRE+GDLG++
Sbjct: 138 PQNLIPTTYLFINRLGPDYEPGLELGLGEGLLMKTISEACGKSLVQVKNRYREMGDLGQI 197

Query: 186 AQEARAVQPTMFKPKPLTVGEVFNNLKSIAKSQGKDSQTRKIQLIKRMLTACQGVEAKFL 245
           A EAR VQPTMFKPKPLTVGEVF NL++IA SQGKDSQTRKI+LIKRMLTAC+GVEAKFL
Sbjct: 198 ALEARNVQPTMFKPKPLTVGEVFENLRAIAHSQGKDSQTRKIKLIKRMLTACEGVEAKFL 257

Query: 246 IRSLESKLRIGLAEKTVLISLSKALLSYEHD-GEEPSSELVENAEQRVRDAFCQVPNYEI 304
           IRSLESKLRIGLAEKTVLISLSKALL+ E + G+EPS ELVE AE ++RDAFCQVPNYEI
Sbjct: 258 IRSLESKLRIGLAEKTVLISLSKALLTNEGETGKEPSMELVEQAEAKIRDAFCQVPNYEI 317

Query: 305 VINTCLEHGIMEVNKHCVLKPGIPLKPMLAKPSKSITEVLDRFHGEKFTCEYKYDGERAQ 364
           VIN CL++GIME++KHC L+PGIPLKPMLAKP+KSITEVLDRF G+ FT EYKYDGERAQ
Sbjct: 318 VINACLDYGIMELDKHCRLRPGIPLKPMLAKPTKSITEVLDRFQGQTFTSEYKYDGERAQ 377

Query: 365 VHLLPDGSMNIYSRNGENMTERYPELHIRDYLADPETTHSLILDCEAVAWDTEQGKILPF 424
           VHLL DG+M IYSRNGENMTERYPE+ IRD++AD E T +LILDCEAVAWD  Q KILPF
Sbjct: 378 VHLLEDGTMRIYSRNGENMTERYPEISIRDFVADLEHTKTLILDCEAVAWDKVQQKILPF 437

Query: 425 QILSTRKRKGVEAKDVKVRVCLFAFDMLCYNGQSLINNSLLERREYLQRVLKPVTGQFQF 484
           Q+LSTRKRK VEAKDVKVRVCLFAFD++C+NG+  IN SL ERRE L +V KPV G+FQ+
Sbjct: 438 QVLSTRKRKDVEAKDVKVRVCLFAFDIICHNGERQINKSLRERRELLAQVTKPVAGEFQY 497

Query: 485 ANELNSSNLEDVQKYLEQSVKDACEGLMVKVLEGEESHYEPSKRSRNWLKLKKDYLQGVG 544
           A EL +S++E++QK+L+QSVKD+CEGLMVK+L+G ESHYEPSKRSRNWLKLKKDYL GVG
Sbjct: 498 AVELTTSSVEELQKFLDQSVKDSCEGLMVKMLDGPESHYEPSKRSRNWLKLKKDYLDGVG 557

Query: 545 DSLDLCVLXXXXXXXXXXXXXXXFLLGCYNQDTGEFETCCKIGTGFSDEMLVSLYEKLKP 604
           DSLDLCVL               FLLGCYNQD+GEFETCCKIGTGFSDEML  LYE+   
Sbjct: 558 DSLDLCVLGAYYGRGKRTGTYGGFLLGCYNQDSGEFETCCKIGTGFSDEMLQQLYERFSK 617

Query: 605 SSLEQPKAFYVYDSSAEPDVWFEPTMLFEVLTADLSLSPIYKAGNSAYGKGISLRFPRFI 664
           ++L+ PKA YV+DSSAEPDVWFEPT LFEVLTADLSLSP+YKAG S Y KG+SLRFPRF+
Sbjct: 618 TTLDGPKATYVFDSSAEPDVWFEPTTLFEVLTADLSLSPVYKAGASTYDKGVSLRFPRFV 677

Query: 665 RIRDDKDVEDATSSEQIVELYESQVNL 691
           R+RDDK VEDATSS QIVELY+ Q ++
Sbjct: 678 RLRDDKSVEDATSSAQIVELYQDQSHV 704

>NCAS0A14110 Chr1 (2774465..2776726) [2262 bp, 753 aa] {ON}
           Anc_7.343 YDL164C
          Length = 753

 Score =  954 bits (2466), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 448/609 (73%), Positives = 520/609 (85%), Gaps = 1/609 (0%)

Query: 85  HHSKIPYSDVCNIFSEIESTSSRLSIVKICSNFFYSVLKQNPSNLVPITYLFINRLGPDY 144
           + S IPY +VCN+F EIESTSSRL+I+K+CS+FF  ++K+NP NL+P+TYLFIN+LGPDY
Sbjct: 145 YFSSIPYREVCNLFQEIESTSSRLAIIKLCSDFFIKIMKENPQNLIPVTYLFINKLGPDY 204

Query: 145 EPXXXXXXXXXXXMKTIAESCGKSLQQVRAKYREIGDLGEVAQEARAVQPTMFKPKPLTV 204
           EP           MKTI+ESCGKSL QVR KYRE+GDLG++A +AR VQPTMFKPKPLTV
Sbjct: 205 EPGLELGLGEGLLMKTISESCGKSLAQVRNKYRELGDLGQIAMDARNVQPTMFKPKPLTV 264

Query: 205 GEVFNNLKSIAKSQGKDSQTRKIQLIKRMLTACQGVEAKFLIRSLESKLRIGLAEKTVLI 264
           GEVF NL+ IAKS+GKDSQTRKI+LIKRMLTAC+G EAKFLIRSLESKLRIGLAEKTVLI
Sbjct: 265 GEVFENLRLIAKSEGKDSQTRKIKLIKRMLTACEGTEAKFLIRSLESKLRIGLAEKTVLI 324

Query: 265 SLSKALLSYE-HDGEEPSSELVENAEQRVRDAFCQVPNYEIVINTCLEHGIMEVNKHCVL 323
           SLSKALL +E  D ++   EL+E AEQ++RDAFCQVPNYEIVIN+CL++GIME+  HC L
Sbjct: 325 SLSKALLVHECKDNKDFDMELLETAEQKIRDAFCQVPNYEIVINSCLKYGIMELETHCSL 384

Query: 324 KPGIPLKPMLAKPSKSITEVLDRFHGEKFTCEYKYDGERAQVHLLPDGSMNIYSRNGENM 383
           +PGIPLKPMLAKP+K+I E+LDRF GE FT EYKYDGERAQVHLL DG+M IYSRNGENM
Sbjct: 385 RPGIPLKPMLAKPTKAINEILDRFQGEIFTSEYKYDGERAQVHLLSDGTMRIYSRNGENM 444

Query: 384 TERYPELHIRDYLADPETTHSLILDCEAVAWDTEQGKILPFQILSTRKRKGVEAKDVKVR 443
           TERYPE+HIRD++ADP  T +LILDCEAVAWD EQ KILPFQ+LSTRKRK V+ KDVKV+
Sbjct: 445 TERYPEIHIRDFIADPLVTSTLILDCEAVAWDNEQNKILPFQVLSTRKRKDVDLKDVKVK 504

Query: 444 VCLFAFDMLCYNGQSLINNSLLERREYLQRVLKPVTGQFQFANELNSSNLEDVQKYLEQS 503
           VCLFAFD+LC+N + LIN SL ERR+ LQ V K VTG+FQ+A E+ SSNL+++QK+L+QS
Sbjct: 505 VCLFAFDILCHNDEKLINKSLRERRQILQEVTKSVTGEFQYATEMTSSNLDELQKFLDQS 564

Query: 504 VKDACEGLMVKVLEGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVLXXXXXXXXXXX 563
           V D+CEGLMVK+L+G ESHYEPSKRSRNWLKLKKDYL+G+GDSLDLCV+           
Sbjct: 565 VHDSCEGLMVKMLDGIESHYEPSKRSRNWLKLKKDYLEGIGDSLDLCVIGAYYGRGKRTG 624

Query: 564 XXXXFLLGCYNQDTGEFETCCKIGTGFSDEMLVSLYEKLKPSSLEQPKAFYVYDSSAEPD 623
               FLLGCYNQDTGEFETCCKIGTGFSDEML  LY +L P+ L+ PKA +VYDSSAEPD
Sbjct: 625 MYGGFLLGCYNQDTGEFETCCKIGTGFSDEMLQQLYTRLTPTVLDGPKATFVYDSSAEPD 684

Query: 624 VWFEPTMLFEVLTADLSLSPIYKAGNSAYGKGISLRFPRFIRIRDDKDVEDATSSEQIVE 683
           VWFEPT+LFEVLTADLSLSPIYKAG+S Y KGISLRFPRFIR R+DK VEDATSSEQI+E
Sbjct: 685 VWFEPTLLFEVLTADLSLSPIYKAGSSTYDKGISLRFPRFIRTREDKGVEDATSSEQIIE 744

Query: 684 LYESQVNLQ 692
           LYE+Q + Q
Sbjct: 745 LYENQAHTQ 753

>ZYRO0F11572g Chr6 (949236..951431) [2196 bp, 731 aa] {ON} similar
           to uniprot|P04819 Saccharomyces cerevisiae YDL164C CDC9
           DNA ligase found in the nucleus and mitochondria an
           essential enzyme that joins Okazaki fragments during DNA
           replication also acts in nucleotide excision repair base
           excision repair and recombination
          Length = 731

 Score =  951 bits (2459), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 446/608 (73%), Positives = 524/608 (86%), Gaps = 2/608 (0%)

Query: 85  HHSKIPYSDVCNIFSEIESTSSRLSIVKICSNFFYSVLKQNPSNLVPITYLFINRLGPDY 144
           H S +PY+DVCNIF EIESTSSRLSI+KICS+FF  ++K++  NLVP TYLFIN+LGPDY
Sbjct: 124 HFSTVPYADVCNIFQEIESTSSRLSIIKICSDFFTQIVKEDSRNLVPTTYLFINKLGPDY 183

Query: 145 EPXXXXXXXXXXXMKTIAESCGKSLQQVRAKYREIGDLGEVAQEARAVQPTMFKPKPLTV 204
           EP           MKTI+ESCGKSL QV+ +YRE+GDLG++A EAR VQPTMFKPKPLTV
Sbjct: 184 EPGMELGLGEGLLMKTISESCGKSLAQVKNRYREMGDLGQIAMEARNVQPTMFKPKPLTV 243

Query: 205 GEVFNNLKSIAKSQGKDSQTRKIQLIKRMLTACQGVEAKFLIRSLESKLRIGLAEKTVLI 264
           GEVF NL++IA +QGKDSQ +KI+LIKRMLTACQGVEAKFLIRSLESKLRIGLAEKTVLI
Sbjct: 244 GEVFVNLRNIANAQGKDSQNKKIKLIKRMLTACQGVEAKFLIRSLESKLRIGLAEKTVLI 303

Query: 265 SLSKALLSYEHDGE-EPSSELVENAEQRVRDAFCQVPNYEIVINTCLEHGIMEVNKHCVL 323
           SLS ALL +E   + EPS E V+ AEQ +RDAFCQVPNYEIVINTCLEHGI +++KHC L
Sbjct: 304 SLSNALLRHEQGLDVEPSDEAVDKAEQSIRDAFCQVPNYEIVINTCLEHGISQLHKHCQL 363

Query: 324 KPGIPLKPMLAKPSKSITEVLDRFHGEKFTCEYKYDGERAQVHLLPDGSMNIYSRNGENM 383
            PGIPLKPMLAKP+K+ITEVLDRF G+ F  EYKYDGERAQ+HLLPDG+M IYSRNGENM
Sbjct: 364 TPGIPLKPMLAKPTKAITEVLDRFQGQLFVSEYKYDGERAQLHLLPDGTMRIYSRNGENM 423

Query: 384 TERYPELHIRDYLADPETTHSLILDCEAVAWDTEQGKILPFQILSTRKRKGVEAKDVKVR 443
           TERYPE+ IRD+L+DP +T SLILDCEAVAWD EQGKILPFQ+LSTRKRK V+AKDVKVR
Sbjct: 424 TERYPEIDIRDFLSDP-STESLILDCEAVAWDKEQGKILPFQVLSTRKRKDVDAKDVKVR 482

Query: 444 VCLFAFDMLCYNGQSLINNSLLERREYLQRVLKPVTGQFQFANELNSSNLEDVQKYLEQS 503
           VCLFAFD+LC+NG+ LIN SL ER++ LQ+V KPV G+F++AN+L ++N+E++Q +L+QS
Sbjct: 483 VCLFAFDLLCHNGEPLINKSLRERQDDLQKVTKPVDGEFRYANKLITANIEELQHFLDQS 542

Query: 504 VKDACEGLMVKVLEGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVLXXXXXXXXXXX 563
           VKD+CEGLMVK+L+G ESHYEPSKRSRNWLKLKKDYL GVGDSLDLCVL           
Sbjct: 543 VKDSCEGLMVKMLDGPESHYEPSKRSRNWLKLKKDYLNGVGDSLDLCVLGAYYGRGKRTG 602

Query: 564 XXXXFLLGCYNQDTGEFETCCKIGTGFSDEMLVSLYEKLKPSSLEQPKAFYVYDSSAEPD 623
               FLLGCYNQDTGE+ETCCKIGTGFS+E+L  LY++LKP+++E P AFYVYDS+ +PD
Sbjct: 603 TYGGFLLGCYNQDTGEYETCCKIGTGFSEELLQQLYDRLKPTAMEAPAAFYVYDSAQQPD 662

Query: 624 VWFEPTMLFEVLTADLSLSPIYKAGNSAYGKGISLRFPRFIRIRDDKDVEDATSSEQIVE 683
           VWFEPT+LFEVL ADLSLSP+YKAG++ Y KGISLRFPRF+RIRDDK VE+ATSSEQ+V+
Sbjct: 663 VWFEPTLLFEVLAADLSLSPVYKAGSAQYDKGISLRFPRFLRIRDDKSVEEATSSEQVVD 722

Query: 684 LYESQVNL 691
           LYE+Q +L
Sbjct: 723 LYEAQAHL 730

>CAGL0I03410g Chr9 complement(289606..291780) [2175 bp, 724 aa] {ON}
           highly similar to uniprot|P04819 Saccharomyces
           cerevisiae YDL164c CDC9 DNA ligase
          Length = 724

 Score =  941 bits (2432), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 454/707 (64%), Positives = 555/707 (78%), Gaps = 16/707 (2%)

Query: 1   MLKNPLR-IMSTKKQVTLARFFSSAKKGGNKEDKLE-PQAKRAKVD------PANTSELI 52
           ++K P R ++  K+Q TLARFFSS KK  + + K E    K A VD       AN S L 
Sbjct: 16  IIKEPTRPLIVMKRQATLARFFSSVKKDADGDKKGEQADVKTAAVDLNSHEVDANKSPLK 75

Query: 53  TNEAXXXXXXXXXXXXXXXXXXXXXTPVMAPVHH------SKIPYSDVCNIFSEIESTSS 106
             +                      TP+ +           K+PYSD+CN+F EIE TSS
Sbjct: 76  KMKLESTGSLTATKNGNQGKEEHEGTPIASTPRQVDSKFFCKVPYSDLCNLFEEIEGTSS 135

Query: 107 RLSIVKICSNFFYSVLKQNPSNLVPITYLFINRLGPDYEPXXXXXXXXXXXMKTIAESCG 166
           RL+I+K+CS+FF  ++K++P NL+P+TYLFIN+LGPDYEP           MKTI+ESCG
Sbjct: 136 RLAIIKLCSDFFIKIMKEDPQNLIPVTYLFINKLGPDYEPGLELGLGENLLMKTISESCG 195

Query: 167 KSLQQVRAKYREIGDLGEVAQEARAVQPTMFKPKPLTVGEVFNNLKSIAKSQGKDSQTRK 226
           KS+QQ++ +YREIGDLG++A EAR VQPTMFKPKPL VGEVF NLK+IAKSQGKDSQT+K
Sbjct: 196 KSMQQIKNQYREIGDLGQIALEARNVQPTMFKPKPLVVGEVFENLKTIAKSQGKDSQTKK 255

Query: 227 IQLIKRMLTACQGVEAKFLIRSLESKLRIGLAEKTVLISLSKALLSYE--HDGEEPSSEL 284
           ++LIKRMLTACQG EAKFLIRSLESKLRIGLAEKTVLI+LSKALL ++  +  +EPS ++
Sbjct: 256 MKLIKRMLTACQGTEAKFLIRSLESKLRIGLAEKTVLIALSKALLIHDEKYSNKEPSMDV 315

Query: 285 VENAEQRVRDAFCQVPNYEIVINTCLEHGIMEVNKHCVLKPGIPLKPMLAKPSKSITEVL 344
           VE AEQ++RDAFCQVPNYE+VIN CL++GIM++++HC ++PGIPLKPMLAKP+K+I EVL
Sbjct: 316 VEQAEQKIRDAFCQVPNYELVINACLDYGIMKLDEHCTIQPGIPLKPMLAKPTKAINEVL 375

Query: 345 DRFHGEKFTCEYKYDGERAQVHLLPDGSMNIYSRNGENMTERYPELHIRDYLADPETTHS 404
           DRF G+ FT EYKYDGERAQVHLL DG+M IYSRNGENMTERYPE+ I+D+LADP +T S
Sbjct: 376 DRFQGQTFTSEYKYDGERAQVHLLKDGTMRIYSRNGENMTERYPEIQIKDFLADPASTTS 435

Query: 405 LILDCEAVAWDTEQGKILPFQILSTRKRKGVEAKDVKVRVCLFAFDMLCYNGQSLINNSL 464
           LILDCEAVAWD EQ KILPFQ+L+TRKRK V   +VKVRVCLFAFD+L +N   LIN  L
Sbjct: 436 LILDCEAVAWDKEQNKILPFQVLTTRKRKDVNINEVKVRVCLFAFDILLHNDMRLINEPL 495

Query: 465 LERREYLQRVLKPVTGQFQFANELNSSNLEDVQKYLEQSVKDACEGLMVKVLEGEESHYE 524
            +RRE L  V KPV G+FQ+A ++ +SNL+++QK+L++SVK++CEGLMVK+++G ES+YE
Sbjct: 496 SKRREVLHEVTKPVEGEFQYATQMTTSNLDELQKFLDESVKNSCEGLMVKMMDGVESYYE 555

Query: 525 PSKRSRNWLKLKKDYLQGVGDSLDLCVLXXXXXXXXXXXXXXXFLLGCYNQDTGEFETCC 584
           PSKRSRNWLKLKKDYL+GVGDSLDLCVL               FLLGCYN D+ +FETCC
Sbjct: 556 PSKRSRNWLKLKKDYLEGVGDSLDLCVLGAYFGRGKRTGTYGGFLLGCYNADSEDFETCC 615

Query: 585 KIGTGFSDEMLVSLYEKLKPSSLEQPKAFYVYDSSAEPDVWFEPTMLFEVLTADLSLSPI 644
           KIGTGFS+EML +LYEKL P+ ++ PK  YV+DSSAEPDVWFEPTMLFEVLTADLSLSPI
Sbjct: 616 KIGTGFSEEMLQTLYEKLSPTVIDGPKGTYVFDSSAEPDVWFEPTMLFEVLTADLSLSPI 675

Query: 645 YKAGNSAYGKGISLRFPRFIRIRDDKDVEDATSSEQIVELYESQVNL 691
           YKAG+S Y KGISLRFPRF+RIRDDK VEDATSSEQI+E+Y++Q ++
Sbjct: 676 YKAGSSVYDKGISLRFPRFLRIRDDKSVEDATSSEQIIEMYQNQSHV 722

>NDAI0A01940 Chr1 complement(432302..434599) [2298 bp, 765 aa] {ON}
           Anc_7.343 YDL164C
          Length = 765

 Score =  933 bits (2412), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 443/602 (73%), Positives = 511/602 (84%), Gaps = 2/602 (0%)

Query: 89  IPYSDVCNIFSEIESTSSRLSIVKICSNFFYSVLKQNPSNLVPITYLFINRLGPDYEPXX 148
           IPY +VC +F EIE+TSSRLSI+K+CS+F   ++KQ+P NL+P+TYLFIN+LGPDYEP  
Sbjct: 159 IPYKEVCQLFQEIETTSSRLSIIKLCSDFLIKIMKQDPQNLIPVTYLFINKLGPDYEPGL 218

Query: 149 XXXXXXXXXMKTIAESCGKSLQQVRAKYREIGDLGEVAQEARAVQPTMFKPKPLTVGEVF 208
                    MKTI+ESCGKSL Q+RA+YRE+GDLG++A EAR VQPTMFKPKPLTVGEVF
Sbjct: 219 ELGLGEGLLMKTISESCGKSLTQIRAQYRELGDLGQIALEARNVQPTMFKPKPLTVGEVF 278

Query: 209 NNLKSIAKSQGKDSQTRKIQLIKRMLTACQ-GVEAKFLIRSLESKLRIGLAEKTVLISLS 267
           NNLK IAK+ GKDSQT+KI+LIKRMLTAC+ GVEAKFLIRSLESKLRIGLAEKTVLISLS
Sbjct: 279 NNLKMIAKAAGKDSQTKKIKLIKRMLTACEDGVEAKFLIRSLESKLRIGLAEKTVLISLS 338

Query: 268 KALLSYEHDGEEP-SSELVENAEQRVRDAFCQVPNYEIVINTCLEHGIMEVNKHCVLKPG 326
           KALL  E D  +    EL+E AE ++RDAFCQVPNYEIVIN+CL++GIM +N+HC L+PG
Sbjct: 339 KALLVKEFDANKDFDMELLETAEGKIRDAFCQVPNYEIVINSCLQYGIMNLNEHCSLRPG 398

Query: 327 IPLKPMLAKPSKSITEVLDRFHGEKFTCEYKYDGERAQVHLLPDGSMNIYSRNGENMTER 386
           IPLKPMLAKP+K+I E+LDRF GE FT EYKYDGERAQVHLL DG+M IYSRNGENMTER
Sbjct: 399 IPLKPMLAKPTKAINEILDRFQGETFTSEYKYDGERAQVHLLEDGTMRIYSRNGENMTER 458

Query: 387 YPELHIRDYLADPETTHSLILDCEAVAWDTEQGKILPFQILSTRKRKGVEAKDVKVRVCL 446
           YPE+HI D++ D   T +LILDCEAVAWD EQ KILPFQ+LSTRKRK V AKDVKVRVCL
Sbjct: 459 YPEIHIGDFVKDRNETKTLILDCEAVAWDKEQQKILPFQVLSTRKRKDVLAKDVKVRVCL 518

Query: 447 FAFDMLCYNGQSLINNSLLERREYLQRVLKPVTGQFQFANELNSSNLEDVQKYLEQSVKD 506
           FAFD+LC+N   LIN SL ERRE L RV  P  G+FQ+A EL +SNL+++QK+L+QSV D
Sbjct: 519 FAFDILCHNSNKLINYSLKERREILHRVTTPAPGEFQYATELTTSNLDELQKFLDQSVND 578

Query: 507 ACEGLMVKVLEGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVLXXXXXXXXXXXXXX 566
           +CEGLMVK+LEGEESHYEPSKRSRNWLKLKKDYL+G+GDSLDLCVL              
Sbjct: 579 SCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLEGIGDSLDLCVLGAYYGRGKRTGTYG 638

Query: 567 XFLLGCYNQDTGEFETCCKIGTGFSDEMLVSLYEKLKPSSLEQPKAFYVYDSSAEPDVWF 626
            FLLGCYN +TGEFETCCKIGTGFSDEML  L+EKLK + ++ PKA Y+YDSSAEPDVWF
Sbjct: 639 GFLLGCYNDNTGEFETCCKIGTGFSDEMLQQLHEKLKATVIDGPKATYIYDSSAEPDVWF 698

Query: 627 EPTMLFEVLTADLSLSPIYKAGNSAYGKGISLRFPRFIRIRDDKDVEDATSSEQIVELYE 686
           EP++LFEVLTADLSLSPIYKAG+SAY KG+SLRFPRFIRIR+DK VEDATSSEQI+ELYE
Sbjct: 699 EPSLLFEVLTADLSLSPIYKAGSSAYDKGVSLRFPRFIRIREDKGVEDATSSEQIIELYE 758

Query: 687 SQ 688
           +Q
Sbjct: 759 NQ 760

>KNAG0C03740 Chr3 (737968..740151) [2184 bp, 727 aa] {ON} Anc_7.343
           YDL164C
          Length = 727

 Score =  932 bits (2409), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 435/610 (71%), Positives = 516/610 (84%), Gaps = 2/610 (0%)

Query: 86  HSKIPYSDVCNIFSEIESTSSRLSIVKICSNFFYSVLKQNPSNLVPITYLFINRLGPDYE 145
           +S +PY+D+CN+F EIE  SSRL+I+K+CS+F  SV+K +P NL+P+TYLFIN+LGPDY 
Sbjct: 118 YSTVPYADLCNLFQEIEGISSRLAIIKLCSSFLISVMKLDPRNLIPMTYLFINKLGPDYM 177

Query: 146 PXXXXXXXXXXXMKTIAESCGKSLQQVRAKYREIGDLGEVAQEARAVQPTMFKPKPLTVG 205
           P           +KTIAESCG+SLQQ++ KY EIGDLG++A EAR VQPTMFKPKPLTVG
Sbjct: 178 PGLELGLGENLLIKTIAESCGRSLQQIKTKYHEIGDLGQIALEARKVQPTMFKPKPLTVG 237

Query: 206 EVFNNLKSIAKSQGKDSQTRKIQLIKRMLTACQGVEAKFLIRSLESKLRIGLAEKTVLIS 265
           EVF NLKSIA SQGKDSQT+KI+LIKRMLT+CQGVEAKFLIRSLESKLRIGLAEKTVLIS
Sbjct: 238 EVFQNLKSIASSQGKDSQTKKIKLIKRMLTSCQGVEAKFLIRSLESKLRIGLAEKTVLIS 297

Query: 266 LSKALLSYEH--DGEEPSSELVENAEQRVRDAFCQVPNYEIVINTCLEHGIMEVNKHCVL 323
           LSKALL YE+    ++   E VENAEQ++RDAFCQVPNYE+VI++CL+HGIM +++HC L
Sbjct: 298 LSKALLVYEYGESDKDIDMETVENAEQKIRDAFCQVPNYEVVIDSCLKHGIMNLDQHCSL 357

Query: 324 KPGIPLKPMLAKPSKSITEVLDRFHGEKFTCEYKYDGERAQVHLLPDGSMNIYSRNGENM 383
           +P IPLKPMLAKP+KSI+E+ DRF  +KFTCEYKYDGERAQVHLL DG+M IYSRNGENM
Sbjct: 358 RPAIPLKPMLAKPTKSISEIFDRFQDQKFTCEYKYDGERAQVHLLEDGTMRIYSRNGENM 417

Query: 384 TERYPELHIRDYLADPETTHSLILDCEAVAWDTEQGKILPFQILSTRKRKGVEAKDVKVR 443
           TERYPE+HIRD++ D   T SLILDCEAVAWD EQ KILPFQ+LSTRKRK V+  ++KVR
Sbjct: 418 TERYPEIHIRDFVTDLSHTKSLILDCEAVAWDKEQNKILPFQVLSTRKRKDVDINEIKVR 477

Query: 444 VCLFAFDMLCYNGQSLINNSLLERREYLQRVLKPVTGQFQFANELNSSNLEDVQKYLEQS 503
           VCLFAFD+L +N + LIN SL ERR+ L  + K VTG+FQFA E+ ++NLE++Q +L+QS
Sbjct: 478 VCLFAFDILLHNDEKLINKSLQERRDILHSITKEVTGEFQFATEMTTTNLEELQSFLDQS 537

Query: 504 VKDACEGLMVKVLEGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVLXXXXXXXXXXX 563
           VK++CEGLMVK+LEGEESHYEPSKRSRNWLKLKKDYL GVGDSLDLCVL           
Sbjct: 538 VKNSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLAGVGDSLDLCVLGAYFGRGKRTG 597

Query: 564 XXXXFLLGCYNQDTGEFETCCKIGTGFSDEMLVSLYEKLKPSSLEQPKAFYVYDSSAEPD 623
               FLLGCYNQDTGEFET CKIGTGFSDE+L  L+E+LK + ++ PKA YV+D SAEPD
Sbjct: 598 NYGGFLLGCYNQDTGEFETACKIGTGFSDEVLQQLHERLKSTVIDLPKATYVFDPSAEPD 657

Query: 624 VWFEPTMLFEVLTADLSLSPIYKAGNSAYGKGISLRFPRFIRIRDDKDVEDATSSEQIVE 683
           VWFEPT+LFEVLTADLSLSP+YKAG+S Y KG+SLRFPRF+R+R+DK VEDATSSEQIVE
Sbjct: 658 VWFEPTLLFEVLTADLSLSPVYKAGSSTYDKGVSLRFPRFLRLREDKGVEDATSSEQIVE 717

Query: 684 LYESQVNLQK 693
           +YE+Q NLQ+
Sbjct: 718 MYENQANLQQ 727

>Kpol_2001.71 s2001 (195103..197283) [2181 bp, 726 aa] {ON}
           (195103..197283) [2181 nt, 727 aa]
          Length = 726

 Score =  926 bits (2393), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 452/699 (64%), Positives = 539/699 (77%), Gaps = 18/699 (2%)

Query: 12  KKQVTLARFFSSAKKGGNKEDKLEPQAKRAKVDPANTSELI---TNEAXXXXXXXXXXXX 68
           KKQ TLARFFSS  K    +D         K D ++TS+ I   ++E             
Sbjct: 27  KKQATLARFFSSMPKRKIDDDSSTDSTTINKDDDSDTSKKIKLNSDETPTTSAGSVTSKD 86

Query: 69  XXXXXXXXXTPVMAPVH----------HSKIPYSDVCNIFSEIESTSSRLSIVKICSNFF 118
                     P++ P             S +PY+D+C +F E+ESTSSRLSI+KICS+F 
Sbjct: 87  EPSLTSSPQKPIVTPAKVPSNTKPVKFFSTVPYADLCEVFQEVESTSSRLSIIKICSDFL 146

Query: 119 YSVLKQNPSNLVPITYLFINRLGPDYEPXXXXXXXXXXXMKTIAESCGKSLQQVRAKYRE 178
             V+KQ+P NLVPITYLFIN+LGPDYEP           MKTI+ESCGKS+QQ++ +YRE
Sbjct: 147 IKVMKQDPQNLVPITYLFINKLGPDYEPGLELGLGEGLLMKTISESCGKSMQQLKNQYRE 206

Query: 179 IGDLGEVAQEARAVQPTMFKPKPLTVGEVFNNLKSIAKSQGKDSQTRKIQLIKRMLTACQ 238
           IGDLG++AQ+AR VQPTMFKPKPLTVGEVF NLK IA+SQGKDSQ RK++LIKRMLTAC+
Sbjct: 207 IGDLGQIAQDARNVQPTMFKPKPLTVGEVFQNLKDIAQSQGKDSQQRKMRLIKRMLTACK 266

Query: 239 GVEAKFLIRSLESKLRIGLAEKTVLISLSKALLSYEHD-GEEPSSELVENAEQRVRDAFC 297
           GVEAKFLIRSLESKLRIGLAEKTVLISLSKALL  E++  ++PS EL+E AE+++RDAFC
Sbjct: 267 GVEAKFLIRSLESKLRIGLAEKTVLISLSKALLLNEYETSKDPSMELIETAEEKIRDAFC 326

Query: 298 QVPNYEIVINTCLEHGIMEVNKHCVLKPGIPLKPMLAKPSKSITEVLDRFHGEKFTCEYK 357
           QVPNYEI+I +CL  GIME++ +C L+PGIPLKPMLAKP+K+I EVLD F GE+FTCEYK
Sbjct: 327 QVPNYEIIIQSCLNDGIMELDNNCKLRPGIPLKPMLAKPTKAINEVLDAFQGEEFTCEYK 386

Query: 358 YDGERAQVHLLPDGSMNIYSRNGENMTERYPELHIRDYLADPETTH----SLILDCEAVA 413
           YDGER QVHLL +G M IYSRNGENMTERYPELHI D+L   E+      SLILDCE VA
Sbjct: 387 YDGERGQVHLLSNGEMRIYSRNGENMTERYPELHIEDFLVKDESNTDKEVSLILDCEVVA 446

Query: 414 WDTEQGKILPFQILSTRKRKGVEAKDVKVRVCLFAFDMLCYNGQSLINNSLLERREYLQR 473
           WD EQ KILPFQ+LSTRKRKGVE KDVKVRVCLFAFD+L YNG+ LI  +L ERR+ L  
Sbjct: 447 WDNEQNKILPFQVLSTRKRKGVELKDVKVRVCLFAFDILYYNGEGLITKTLRERRKILHE 506

Query: 474 VLKPVTGQFQFANELNSSNLEDVQKYLEQSVKDACEGLMVKVLEGEESHYEPSKRSRNWL 533
           V K V G+FQ+A  L ++ L+++QK+L+Q++KD+CEGLMVK+L+GEES YEPSKRSRNWL
Sbjct: 507 VTKCVPGEFQYATSLITAELDEIQKFLDQAIKDSCEGLMVKILDGEESRYEPSKRSRNWL 566

Query: 534 KLKKDYLQGVGDSLDLCVLXXXXXXXXXXXXXXXFLLGCYNQDTGEFETCCKIGTGFSDE 593
           KLKKDYL GVGDSLDLCV+               FLLGCYNQD+GE+ETCCKIGTGFSDE
Sbjct: 567 KLKKDYLAGVGDSLDLCVMGAYYGKGKRTGTYGGFLLGCYNQDSGEYETCCKIGTGFSDE 626

Query: 594 MLVSLYEKLKPSSLEQPKAFYVYDSSAEPDVWFEPTMLFEVLTADLSLSPIYKAGNSAYG 653
           ML  LYE  +   +E PK+FY +DSSAEPD+WFEP +LFEVLTADLSLSPIYKAG++ Y 
Sbjct: 627 MLTKLYELFREEEIEVPKSFYNFDSSAEPDIWFEPKVLFEVLTADLSLSPIYKAGSATYD 686

Query: 654 KGISLRFPRFIRIRDDKDVEDATSSEQIVELYESQVNLQ 692
           KGISLRFPRF+RIRDDK VEDATSS+QI+E+YE+Q ++Q
Sbjct: 687 KGISLRFPRFLRIRDDKSVEDATSSDQIIEMYENQSHIQ 725

>Suva_4.82 Chr4 complement(152544..154811) [2268 bp, 755 aa] {ON}
           YDL164C (REAL)
          Length = 755

 Score =  924 bits (2388), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 437/619 (70%), Positives = 515/619 (83%), Gaps = 5/619 (0%)

Query: 79  PVMAPVHHSKIPYSDVCNIFSEIESTSSRLSIVKICSNFFYSVLKQNPSNLVPITYLFIN 138
           P+    + S IPYS+VC +F+EIE+ SSRL I++ICS+FF  ++KQ+  NL+P TYLFIN
Sbjct: 136 PIDNDHYSSNIPYSEVCEVFNEIEAISSRLEIIRICSDFFIKIMKQSSKNLIPTTYLFIN 195

Query: 139 RLGPDYEPXXXXXXXXXXXMKTIAESCGKSLQQVRAKYREIGDLGEVAQEARAVQPTMFK 198
           RLGPDYEP           MKTI+ESCGKS+ Q++ KY+EIGDLGE+A  AR VQPTMFK
Sbjct: 196 RLGPDYEPGLELGLGENLLMKTISESCGKSMNQIKLKYKEIGDLGEIAMGARNVQPTMFK 255

Query: 199 PKPLTVGEVFNNLKSIAKSQGKDSQTRKIQLIKRMLTACQGVEAKFLIRSLESKLRIGLA 258
           PKPLTVGEVF NL+SIAK+QGKDSQ RK++LIKRMLTACQGVEAKFLIRSLESKLRIGLA
Sbjct: 256 PKPLTVGEVFKNLRSIAKTQGKDSQLRKMKLIKRMLTACQGVEAKFLIRSLESKLRIGLA 315

Query: 259 EKTVLISLSKALLSYEHDGEEPS-----SELVENAEQRVRDAFCQVPNYEIVINTCLEHG 313
           EKTVLISLSKALL +  +GE         +++E+A+Q++RDAFCQVPNYEIVIN+CLEHG
Sbjct: 316 EKTVLISLSKALLLHGGNGENSHVNDIPMDVLESAQQKIRDAFCQVPNYEIVINSCLEHG 375

Query: 314 IMEVNKHCVLKPGIPLKPMLAKPSKSITEVLDRFHGEKFTCEYKYDGERAQVHLLPDGSM 373
           IM ++K C LKPGIPLKPMLAKP+K+I EVLDRF GE FT EYKYDGERAQVHLL DG+M
Sbjct: 376 IMNLDKFCTLKPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLDDGTM 435

Query: 374 NIYSRNGENMTERYPELHIRDYLADPETTHSLILDCEAVAWDTEQGKILPFQILSTRKRK 433
            IYSRNGENMTERYPE+ I D++ D + T +LILDCEAVAWD EQGKILPFQ+LSTRKRK
Sbjct: 436 RIYSRNGENMTERYPEIKITDFIQDLDATKNLILDCEAVAWDKEQGKILPFQVLSTRKRK 495

Query: 434 GVEAKDVKVRVCLFAFDMLCYNGQSLINNSLLERREYLQRVLKPVTGQFQFANELNSSNL 493
            VE  DVKVRVCLFAFD+LC+NG+ LIN SL ERRE L +V K V G+FQ+A ++ + NL
Sbjct: 496 DVELSDVKVRVCLFAFDVLCHNGERLINKSLRERRECLTKVTKVVPGEFQYATQIVTDNL 555

Query: 494 EDVQKYLEQSVKDACEGLMVKVLEGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVLX 553
           +++QK+L++SV  +CEGLMVK+LEG ESHYEPSKRSRNWLKLKKDYL+GVGDSLDLCVL 
Sbjct: 556 DELQKFLDESVNQSCEGLMVKMLEGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLG 615

Query: 554 XXXXXXXXXXXXXXFLLGCYNQDTGEFETCCKIGTGFSDEMLVSLYEKLKPSSLEQPKAF 613
                         FLLGCYNQDTGEFETCCKIGTGFSDE L  L+E+L P+ ++ PKA 
Sbjct: 616 AYYGRGKRTGTYGGFLLGCYNQDTGEFETCCKIGTGFSDESLQQLHERLTPTIIDGPKAT 675

Query: 614 YVYDSSAEPDVWFEPTMLFEVLTADLSLSPIYKAGNSAYGKGISLRFPRFIRIRDDKDVE 673
           +V+DSSAEPDVWFEPT LFEVLTADLSLSPIYKAG++ + KG+SLRFPRF+RIR+DK VE
Sbjct: 676 FVFDSSAEPDVWFEPTTLFEVLTADLSLSPIYKAGSTTFAKGVSLRFPRFLRIREDKGVE 735

Query: 674 DATSSEQIVELYESQVNLQ 692
           DATSSEQIVELYE+Q ++Q
Sbjct: 736 DATSSEQIVELYENQSHVQ 754

>Smik_4.74 Chr4 complement(141744..144281) [2538 bp, 845 aa] {ON}
           YDL164C (REAL)
          Length = 845

 Score =  917 bits (2369), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 431/613 (70%), Positives = 514/613 (83%), Gaps = 5/613 (0%)

Query: 85  HHSKIPYSDVCNIFSEIESTSSRLSIVKICSNFFYSVLKQNPSNLVPITYLFINRLGPDY 144
           + S IPYSDVC +F++IE+ SSRL I++ICS+FF  V+KQ+  NL+P TYLFINRLGPDY
Sbjct: 232 YSSNIPYSDVCEVFNQIEAISSRLEIIRICSDFFIKVMKQSSKNLIPTTYLFINRLGPDY 291

Query: 145 EPXXXXXXXXXXXMKTIAESCGKSLQQVRAKYREIGDLGEVAQEARAVQPTMFKPKPLTV 204
           E            MKTI+ESCGKS+ Q++ KY+EIGDLGE+A  AR VQPTMFKPKPLTV
Sbjct: 292 EAGLELGLGENLLMKTISESCGKSMSQIKLKYKEIGDLGEIAMGARNVQPTMFKPKPLTV 351

Query: 205 GEVFNNLKSIAKSQGKDSQTRKIQLIKRMLTACQGVEAKFLIRSLESKLRIGLAEKTVLI 264
           GEVF NL++IAK+QGKDSQ RKI+LIKRMLTACQGVEAKFLIRSLESKLRIGLAEKTVLI
Sbjct: 352 GEVFKNLRTIAKTQGKDSQLRKIKLIKRMLTACQGVEAKFLIRSLESKLRIGLAEKTVLI 411

Query: 265 SLSKALLSYEHDGEEPSS-----ELVENAEQRVRDAFCQVPNYEIVINTCLEHGIMEVNK 319
           SLSKALL ++ + E  +      +++E+A+Q++RDAFCQVPNYEIVIN+CLEHGIM ++K
Sbjct: 412 SLSKALLLHDENRENSADKDIPMDVLESAQQKIRDAFCQVPNYEIVINSCLEHGIMNLDK 471

Query: 320 HCVLKPGIPLKPMLAKPSKSITEVLDRFHGEKFTCEYKYDGERAQVHLLPDGSMNIYSRN 379
           +C L+PGIPLKPMLAKP+K+I EVLDRF GE FT EYKYDGERAQVHLL DG+M IYSRN
Sbjct: 472 YCTLRPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDGTMRIYSRN 531

Query: 380 GENMTERYPELHIRDYLADPETTHSLILDCEAVAWDTEQGKILPFQILSTRKRKGVEAKD 439
           GENMTERYPE+ I D++ D + T +LILDCEAVAWD +Q KILPFQ+LSTRKRK VE  D
Sbjct: 532 GENMTERYPEIKITDFIQDLDITKNLILDCEAVAWDKDQAKILPFQVLSTRKRKDVELND 591

Query: 440 VKVRVCLFAFDMLCYNGQSLINNSLLERREYLQRVLKPVTGQFQFANELNSSNLEDVQKY 499
           VKVRVCLFAFD+LC+N + LIN SL ERREYL +V K V G+FQ+A ++ ++NL+++QK+
Sbjct: 592 VKVRVCLFAFDILCHNDERLINMSLRERREYLTKVTKVVPGEFQYATQIITNNLDELQKF 651

Query: 500 LEQSVKDACEGLMVKVLEGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVLXXXXXXX 559
           L++SV  +CEGLMVK+L+G ESHYEPSKRSRNWLKLKKDYL+GVGDSLDLCVL       
Sbjct: 652 LDESVNHSCEGLMVKMLDGSESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLGAYYGRG 711

Query: 560 XXXXXXXXFLLGCYNQDTGEFETCCKIGTGFSDEMLVSLYEKLKPSSLEQPKAFYVYDSS 619
                   FLLGCYNQDTGEFETCCKIGTGFSDEML  L+ +L P+ ++ PKA YV+DSS
Sbjct: 712 KRTGTYGGFLLGCYNQDTGEFETCCKIGTGFSDEMLQLLHARLTPTIIDGPKATYVFDSS 771

Query: 620 AEPDVWFEPTMLFEVLTADLSLSPIYKAGNSAYGKGISLRFPRFIRIRDDKDVEDATSSE 679
           AEPDVWFEPT LFEVLTADLSLSPIYKAG++ + KG+SLRFPRF+RIR+DK VEDATSS+
Sbjct: 772 AEPDVWFEPTTLFEVLTADLSLSPIYKAGSTTFDKGVSLRFPRFLRIREDKGVEDATSSD 831

Query: 680 QIVELYESQVNLQ 692
           QIVELYE+Q ++Q
Sbjct: 832 QIVELYENQSHVQ 844

>YDL164C Chr4 complement(164987..167254) [2268 bp, 755 aa] {ON}
           CDC9DNA ligase found in the nucleus and mitochondria, an
           essential enzyme that joins Okazaki fragments during DNA
           replication; also acts in nucleotide excision repair,
           base excision repair, and recombination
          Length = 755

 Score =  913 bits (2360), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 425/613 (69%), Positives = 518/613 (84%), Gaps = 5/613 (0%)

Query: 85  HHSKIPYSDVCNIFSEIESTSSRLSIVKICSNFFYSVLKQNPSNLVPITYLFINRLGPDY 144
           + S IPYS+VC +F++IE+ SSRL I++ICS+FF  ++KQ+  NL+P TYLFINRLGPDY
Sbjct: 142 YSSNIPYSEVCEVFNKIEAISSRLEIIRICSDFFIKIMKQSSKNLIPTTYLFINRLGPDY 201

Query: 145 EPXXXXXXXXXXXMKTIAESCGKSLQQVRAKYREIGDLGEVAQEARAVQPTMFKPKPLTV 204
           E            MKTI+E+CGKS+ Q++ KY++IGDLGE+A  AR VQPTMFKPKPLTV
Sbjct: 202 EAGLELGLGENLLMKTISETCGKSMSQIKLKYKDIGDLGEIAMGARNVQPTMFKPKPLTV 261

Query: 205 GEVFNNLKSIAKSQGKDSQTRKIQLIKRMLTACQGVEAKFLIRSLESKLRIGLAEKTVLI 264
           GEVF NL++IAK+QGKDSQ +K++LIKRMLTAC+G+EAKFLIRSLESKLRIGLAEKTVLI
Sbjct: 262 GEVFKNLRAIAKTQGKDSQLKKMKLIKRMLTACKGIEAKFLIRSLESKLRIGLAEKTVLI 321

Query: 265 SLSKALLSYEHDGEEPSS-----ELVENAEQRVRDAFCQVPNYEIVINTCLEHGIMEVNK 319
           SLSKALL ++ + E+        +++E+A+Q++RDAFCQVPNYEIVIN+CLEHGIM ++K
Sbjct: 322 SLSKALLLHDENREDSPDKDVPMDVLESAQQKIRDAFCQVPNYEIVINSCLEHGIMNLDK 381

Query: 320 HCVLKPGIPLKPMLAKPSKSITEVLDRFHGEKFTCEYKYDGERAQVHLLPDGSMNIYSRN 379
           +C L+PGIPLKPMLAKP+K+I EVLDRF GE FT EYKYDGERAQVHLL DG+M IYSRN
Sbjct: 382 YCTLRPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDGTMRIYSRN 441

Query: 380 GENMTERYPELHIRDYLADPETTHSLILDCEAVAWDTEQGKILPFQILSTRKRKGVEAKD 439
           GENMTERYPE++I D++ D +TT +LILDCEAVAWD +QGKILPFQ+LSTRKRK VE  D
Sbjct: 442 GENMTERYPEINITDFIQDLDTTKNLILDCEAVAWDKDQGKILPFQVLSTRKRKDVELND 501

Query: 440 VKVRVCLFAFDMLCYNGQSLINNSLLERREYLQRVLKPVTGQFQFANELNSSNLEDVQKY 499
           VKV+VCLFAFD+LCYN + LIN SL ERREYL +V K V G+FQ+A ++ ++NL+++QK+
Sbjct: 502 VKVKVCLFAFDILCYNDERLINKSLKERREYLTKVTKVVPGEFQYATQITTNNLDELQKF 561

Query: 500 LEQSVKDACEGLMVKVLEGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVLXXXXXXX 559
           L++SV  +CEGLMVK+LEG ESHYEPSKRSRNWLKLKKDYL+GVGDSLDLCVL       
Sbjct: 562 LDESVNHSCEGLMVKMLEGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLGAYYGRG 621

Query: 560 XXXXXXXXFLLGCYNQDTGEFETCCKIGTGFSDEMLVSLYEKLKPSSLEQPKAFYVYDSS 619
                   FLLGCYNQDTGEFETCCKIGTGFSDEML  L+++L P+ ++ PKA +V+DSS
Sbjct: 622 KRTGTYGGFLLGCYNQDTGEFETCCKIGTGFSDEMLQLLHDRLTPTIIDGPKATFVFDSS 681

Query: 620 AEPDVWFEPTMLFEVLTADLSLSPIYKAGNSAYGKGISLRFPRFIRIRDDKDVEDATSSE 679
           AEPDVWFEPT LFEVLTADLSLSPIYKAG++ + KG+SLRFPRF+RIR+DK VEDATSS+
Sbjct: 682 AEPDVWFEPTTLFEVLTADLSLSPIYKAGSATFDKGVSLRFPRFLRIREDKGVEDATSSD 741

Query: 680 QIVELYESQVNLQ 692
           QIVELYE+Q ++Q
Sbjct: 742 QIVELYENQSHMQ 754

>KLLA0D12496g Chr4 complement(1059684..1061786) [2103 bp, 700 aa]
           {ON} similar to uniprot|P04819 Saccharomyces cerevisiae
           YDL164C CDC9 DNA ligase found in the nucleus and
           mitochondria an essential enzyme that joins Okazaki
           fragments during DNA replication also acts in nucleotide
           excision repair base excision repair and recombination,
          Length = 700

 Score =  909 bits (2348), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 445/694 (64%), Positives = 534/694 (76%), Gaps = 14/694 (2%)

Query: 2   LKNPLRIMSTK--KQVTLARFFSSAKKGGNKEDKLEPQAKRAKVDPANTSELITNEAXXX 59
            K P + MSTK  KQ+TL  F        NK+ K++ +   A  D    +  + +E+   
Sbjct: 18  FKVPSQQMSTKRSKQLTLDGFLRP-----NKKQKVDEEGDSAMPDETAAAPPVKSESSLS 72

Query: 60  XXXXXXXXXXXXXXXXXXTPVMAPVH-HSKIPYSDVCNIFSEIESTSSRLSIVKICSNFF 118
                             TPV + +  HS IP++++C+ F  IE TSSRL+I  ICS F 
Sbjct: 73  NITPPKSRGETL------TPVPSKLKFHSNIPFAELCDTFQAIEVTSSRLAITAICSKFL 126

Query: 119 YSVLKQNPSNLVPITYLFINRLGPDYEPXXXXXXXXXXXMKTIAESCGKSLQQVRAKYRE 178
           YSVL+++P +LVPITYLFI++LGPDYEP           +KTI+E+CGKS+QQ+R KYRE
Sbjct: 127 YSVLERDPESLVPITYLFIHKLGPDYEPGLELGLGESLLIKTISEACGKSIQQIRNKYRE 186

Query: 179 IGDLGEVAQEARAVQPTMFKPKPLTVGEVFNNLKSIAKSQGKDSQTRKIQLIKRMLTACQ 238
           IGDLGE+A +AR VQPTMFKPKPLTVGEVFNNL SIAKS GKDSQ+RK  LIK+MLTAC+
Sbjct: 187 IGDLGEIAMQARNVQPTMFKPKPLTVGEVFNNLVSIAKSNGKDSQSRKGSLIKKMLTACK 246

Query: 239 GVEAKFLIRSLESKLRIGLAEKTVLISLSKALLSYEHDGEEPSSELVENAEQRVRDAFCQ 298
           G EAKFLIRSLESKLRIGLAEKTVLIS+SKA+L++EH+G+EPS+E+VE AE  +RDAFCQ
Sbjct: 247 GYEAKFLIRSLESKLRIGLAEKTVLISVSKAILTHEHNGQEPSTEMVEQAESLIRDAFCQ 306

Query: 299 VPNYEIVINTCLEHGIMEVNKHCVLKPGIPLKPMLAKPSKSITEVLDRFHGEKFTCEYKY 358
           VPNYE++IN  L++GIM +N+H  L+PGIPL+PMLAKP+KSI+EVLDRF G KFTCEYKY
Sbjct: 307 VPNYEMIINVALQYGIMNLNQHIKLRPGIPLQPMLAKPTKSISEVLDRFQGTKFTCEYKY 366

Query: 359 DGERAQVHLLPDGSMNIYSRNGENMTERYPELHIRDYLADPETTHSLILDCEAVAWDTEQ 418
           DGERAQVHL  DGSM IYSRNGE+MTERYPE+ ++ Y+ D   T S I+D EAVAWD EQ
Sbjct: 367 DGERAQVHLCRDGSMKIYSRNGEDMTERYPEIDVKHYVKDLGATKSFIVDSEAVAWDQEQ 426

Query: 419 GKILPFQILSTRKRKGVEAKDVKVRVCLFAFDMLCYNGQSLINNSLLERREYLQRVLKPV 478
           GKILPFQ+LSTRKRKGVE KDVKVRVCL+AFD+LC N + LIN S  ERR+ L       
Sbjct: 427 GKILPFQVLSTRKRKGVELKDVKVRVCLYAFDILCLNDEPLINKSFHERRQILLDTFNGT 486

Query: 479 TGQFQFANELNSSNLEDVQKYLEQSVKDACEGLMVKVLEGEESHYEPSKRSRNWLKLKKD 538
            GQF FANEL ++N +++QKYL+QSVKD+CEGLMVK+LEGEESHYEPSKRSRNWLKLKKD
Sbjct: 487 QGQFDFANELTTTNFDELQKYLDQSVKDSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKD 546

Query: 539 YLQGVGDSLDLCVLXXXXXXXXXXXXXXXFLLGCYNQDTGEFETCCKIGTGFSDEMLVSL 598
           YL+GVGDSLDL VL               FLLGCYN D+ EFETCCKIGTGFSDEML  L
Sbjct: 547 YLEGVGDSLDLVVLGAYYGRGKRTGTYGGFLLGCYNLDSEEFETCCKIGTGFSDEMLQDL 606

Query: 599 YEKLKPSSLEQPKAFYVYDSSAEPDVWFEPTMLFEVLTADLSLSPIYKAGNSAYGKGISL 658
           Y KLK +++E P    +YDSSA  DVWFEP+MLFEVLTADLSLSP+YKAG  A+GKGISL
Sbjct: 607 YTKLKDTTVEHPSTNVIYDSSAPADVWFEPSMLFEVLTADLSLSPVYKAGFEAFGKGISL 666

Query: 659 RFPRFIRIRDDKDVEDATSSEQIVELYESQVNLQ 692
           RFPRF+RIRDDK+V DATSS+Q++E YESQ +++
Sbjct: 667 RFPRFVRIRDDKNVTDATSSDQVIEFYESQAHMK 700

>Skud_4.93 Chr4 complement(160642..162909) [2268 bp, 755 aa] {ON}
           YDL164C (REAL)
          Length = 755

 Score =  905 bits (2338), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 426/613 (69%), Positives = 513/613 (83%), Gaps = 5/613 (0%)

Query: 85  HHSKIPYSDVCNIFSEIESTSSRLSIVKICSNFFYSVLKQNPSNLVPITYLFINRLGPDY 144
           + S IPYS+VC +F++IE+ SSRL I++ICS+FF  ++ Q+  NL+P TYLFINRLGPDY
Sbjct: 142 YSSNIPYSEVCEVFNKIEAISSRLEIIRICSDFFIKIMNQSSKNLIPTTYLFINRLGPDY 201

Query: 145 EPXXXXXXXXXXXMKTIAESCGKSLQQVRAKYREIGDLGEVAQEARAVQPTMFKPKPLTV 204
           E            MKTI+ESCGKS+ Q++ KY+E+GDLGE+A  AR VQPTMFKPK LTV
Sbjct: 202 EAGLELGLGENLLMKTISESCGKSMSQIKLKYKEMGDLGEIAMGARNVQPTMFKPKALTV 261

Query: 205 GEVFNNLKSIAKSQGKDSQTRKIQLIKRMLTACQGVEAKFLIRSLESKLRIGLAEKTVLI 264
           GEVF NL++IAK+QGKDSQ RK++LIKRMLTACQGVEAKFLIRSLESKLRIGLAEKTVLI
Sbjct: 262 GEVFKNLRTIAKTQGKDSQLRKMKLIKRMLTACQGVEAKFLIRSLESKLRIGLAEKTVLI 321

Query: 265 SLSKALLSYEHDGEE-PSSEL----VENAEQRVRDAFCQVPNYEIVINTCLEHGIMEVNK 319
           SLSKALL ++ + E  P  E+    +E+A+QR+RDAFCQVPNYEIVIN+CL HGIM ++K
Sbjct: 322 SLSKALLLHDENKENSPDKEIPMDVLESAQQRIRDAFCQVPNYEIVINSCLNHGIMNLDK 381

Query: 320 HCVLKPGIPLKPMLAKPSKSITEVLDRFHGEKFTCEYKYDGERAQVHLLPDGSMNIYSRN 379
           +C L+PGIPLKPMLAKP+K+I EVLDRF GE FT EYKYDGERAQVHLL DG+M IYSRN
Sbjct: 382 YCTLRPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDGTMRIYSRN 441

Query: 380 GENMTERYPELHIRDYLADPETTHSLILDCEAVAWDTEQGKILPFQILSTRKRKGVEAKD 439
           GENMTERYPE+ I D++ D  +T +LILDCEAVAWD EQ KILPFQILSTRKRK VE  D
Sbjct: 442 GENMTERYPEIKITDFIQDLNSTKNLILDCEAVAWDKEQKKILPFQILSTRKRKDVELHD 501

Query: 440 VKVRVCLFAFDMLCYNGQSLINNSLLERREYLQRVLKPVTGQFQFANELNSSNLEDVQKY 499
           VKV+VCLFAFD+LCYN + LIN SL ERRE+L +V K V G+FQ+A ++ ++NL+++QK+
Sbjct: 502 VKVKVCLFAFDILCYNDERLINKSLRERREHLAKVTKVVPGEFQYATQIITNNLDELQKF 561

Query: 500 LEQSVKDACEGLMVKVLEGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVLXXXXXXX 559
           L++SV ++CEGLMVK+L+G ESHYEPSKRSRNWLKLKKDYL+GVGDSLDLCVL       
Sbjct: 562 LDESVNNSCEGLMVKMLDGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLGAYYGRG 621

Query: 560 XXXXXXXXFLLGCYNQDTGEFETCCKIGTGFSDEMLVSLYEKLKPSSLEQPKAFYVYDSS 619
                   FLLGCYNQDTGEFETCCKIGTGFSDEML  L+E+L P+ ++ PKA +V+D+S
Sbjct: 622 KRTGTYGGFLLGCYNQDTGEFETCCKIGTGFSDEMLQLLHERLTPTIIDGPKATFVFDAS 681

Query: 620 AEPDVWFEPTMLFEVLTADLSLSPIYKAGNSAYGKGISLRFPRFIRIRDDKDVEDATSSE 679
           AEPDVWFEPT LFEVLTADLSLSPIYKAG++ + KG+SLRFPRF+RIR+DK VEDATSS+
Sbjct: 682 AEPDVWFEPTTLFEVLTADLSLSPIYKAGSATFDKGVSLRFPRFLRIREDKGVEDATSSD 741

Query: 680 QIVELYESQVNLQ 692
           QI+ELYE+Q ++Q
Sbjct: 742 QIIELYENQSHVQ 754

>KAFR0B00830 Chr2 (157155..159287) [2133 bp, 710 aa] {ON} Anc_7.343
           YDL164C
          Length = 710

 Score =  893 bits (2308), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 437/704 (62%), Positives = 537/704 (76%), Gaps = 36/704 (5%)

Query: 8   IMST--KKQVTLARFFSSAKKGGNKEDKLEPQAKRAKVDPANTSELITNEAXXXXXXXXX 65
           IMS+  K+Q TLARFF+S K   + ++     +       +++S      +         
Sbjct: 25  IMSSNSKRQATLARFFTSIKPSADDQNSKTSSSPVPPPSSSSSSTTANGSSPLKK----- 79

Query: 66  XXXXXXXXXXXXTPVMAPVHHSK---------------IPYSDVCNIFSEIESTSSRLSI 110
                        P ++P+  SK               IPY+DVC +F EIE+ SSRL I
Sbjct: 80  -------------PKLSPIESSKTDSSETTVKQEFVCDIPYADVCVLFQEIENISSRLQI 126

Query: 111 VKICSNFFYSVLKQNPSNLVPITYLFINRLGPDYEPXXXXXXXXXXXMKTIAESCGKSLQ 170
           +K+CS FF   +KQN +NL+P+TYLFIN+LGPDYE            MKTI+ESCGKSLQ
Sbjct: 127 IKLCSEFFTKAMKQNTANLIPLTYLFINKLGPDYEMGLELGLGENLLMKTISESCGKSLQ 186

Query: 171 QVRAKYREIGDLGEVAQEARAVQPTMFKPKPLTVGEVFNNLKSIAKSQGKDSQTRKIQLI 230
           QV+  Y++IGDLG +A  AR VQPTMFKPKPLTVG VF NLK IAKS GKDSQ +KI+LI
Sbjct: 187 QVKLDYKDIGDLGTIAMNARNVQPTMFKPKPLTVGYVFQNLKLIAKSSGKDSQLKKIRLI 246

Query: 231 KRMLTACQGVEAKFLIRSLESKLRIGLAEKTVLISLSKALLSYEHDGE-EPSSELVENAE 289
           K++LTAC+G+EAK+LIRSLESKLRIGLAEK+VLISLSKALL  E++   +P  EL+E AE
Sbjct: 247 KKLLTACKGIEAKYLIRSLESKLRIGLAEKSVLISLSKALLINEYNNTLDPDMELIEKAE 306

Query: 290 QRVRDAFCQVPNYEIVINTCLEHGIMEVNKHCVLKPGIPLKPMLAKPSKSITEVLDRFHG 349
           Q++RDAFCQ+PNYEIVIN+CL++GIM +++HC L+PGIPLKPMLAKP+K+I EV DRF  
Sbjct: 307 QKIRDAFCQIPNYEIVINSCLKYGIMNLDEHCSLRPGIPLKPMLAKPTKTIMEVFDRFQN 366

Query: 350 EKFTCEYKYDGERAQVHLLPDGSMNIYSRNGENMTERYPELHIRDYLADPETTHSLILDC 409
             FT EYKYDGERAQVHL+ DGSM IYSRNGENMTERYPE+++ D++ D   T SLI+DC
Sbjct: 367 IHFTSEYKYDGERAQVHLMNDGSMRIYSRNGENMTERYPEINVTDFIKDLNLTKSLIIDC 426

Query: 410 EAVAWDTEQGKILPFQILSTRKRKGVEAKDVKVRVCLFAFDMLCYNGQSLINNSLLERRE 469
           EAVAWD E+ KILPFQ+LSTRKRK V+ KD+KVR+CLFAFD+LC+N + LIN SL ERRE
Sbjct: 427 EAVAWDREEKKILPFQVLSTRKRKDVDIKDIKVRICLFAFDILCHNDEKLINKSLRERRE 486

Query: 470 YLQRVLKPVTGQFQFANELNSSNLEDVQKYLEQSVKDACEGLMVKVLEGEESHYEPSKRS 529
            L  V + V G+F +A EL+++NL+++Q +L+QSVKD+CEGLMVKVL+GE+SHYEPSKRS
Sbjct: 487 ILHSVTREVHGEFTYAKELSTNNLDELQLFLDQSVKDSCEGLMVKVLDGEDSHYEPSKRS 546

Query: 530 RNWLKLKKDYLQGVGDSLDLCVLXXXXXXXXXXXXXXXFLLGCYNQDTGEFETCCKIGTG 589
           RNWLKLKKDYL GVGDSLDLCVL               FLLGCYNQDTGEFET CKIGTG
Sbjct: 547 RNWLKLKKDYLDGVGDSLDLCVLGAFYGRGKRTGTYGGFLLGCYNQDTGEFETACKIGTG 606

Query: 590 FSDEMLVSLYEKLKPSSLEQPKAFYVYDSSAEPDVWFEPTMLFEVLTADLSLSPIYKAGN 649
           FSDE+L SLY++LK ++++ PKA Y+YDSSA+PDVWFEPT+LFEVLTADLS+SPIYKAG 
Sbjct: 607 FSDEVLQSLYDRLKSTTIDGPKATYIYDSSAQPDVWFEPTLLFEVLTADLSMSPIYKAGA 666

Query: 650 SAYGKGISLRFPRFIRIRDDKDVEDATSSEQIVELYESQVNLQK 693
           S Y KGISLRFPRFIR+R+DK VE+ATSSEQI+ELYE+Q ++ K
Sbjct: 667 STYSKGISLRFPRFIRLREDKSVEEATSSEQIIELYENQSHVAK 710

>ACL155W Chr3 (81492..83585) [2094 bp, 697 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YDL164C (CDC9)
          Length = 697

 Score =  878 bits (2269), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 426/691 (61%), Positives = 520/691 (75%), Gaps = 13/691 (1%)

Query: 12  KKQVTLARFFSSAKKGGN--------KEDKLEPQ----AKRAKVDPANTSELITNEAXXX 59
           KKQ TL RFF++ K+  +        K+ K+E      A       A     +   A   
Sbjct: 5   KKQATLGRFFTALKRPQDGATAAATVKKSKVEAAECLAAPAGHEQDAEVKNSLPELADKP 64

Query: 60  XXXXXXXXXXXXXXXXXXTPVMAPVHHSKIPYSDVCNIFSEIESTSSRLSIVKICSNFFY 119
                             +PV  P   + + Y+D+C +F  +E+TSSRLSI K+C++F Y
Sbjct: 65  APGGVLPQAASAVPRAQSSPV-KPAASTSVMYADLCAVFEAVEATSSRLSITKLCADFMY 123

Query: 120 SVLKQNPSNLVPITYLFINRLGPDYEPXXXXXXXXXXXMKTIAESCGKSLQQVRAKYREI 179
           SVLK +P +L+P+TYLFINRLGPDYEP           +KTI+++CGKS  QVR+ YRE 
Sbjct: 124 SVLKCDPGHLIPVTYLFINRLGPDYEPGLELGLGEGILIKTISDACGKSAAQVRSSYREC 183

Query: 180 GDLGEVAQEARAVQPTMFKPKPLTVGEVFNNLKSIAKSQGKDSQTRKIQLIKRMLTACQG 239
           GDLG VAQ+AR VQPTMFKPKPLTV +VF+ L++IA+++GKDSQ +KI+LIK+MLTACQG
Sbjct: 184 GDLGTVAQQARVVQPTMFKPKPLTVRDVFSTLQAIAQAEGKDSQGKKIRLIKKMLTACQG 243

Query: 240 VEAKFLIRSLESKLRIGLAEKTVLISLSKALLSYEHDGEEPSSELVENAEQRVRDAFCQV 299
           +EAK+LIRSLESKLRIGLAEKTVL++LSKA+L++EHDG+EPS E V+ AE  VRD FCQV
Sbjct: 244 MEAKYLIRSLESKLRIGLAEKTVLVALSKAILTHEHDGKEPSPEQVDAAEALVRDTFCQV 303

Query: 300 PNYEIVINTCLEHGIMEVNKHCVLKPGIPLKPMLAKPSKSITEVLDRFHGEKFTCEYKYD 359
           PNYE++IN  L++GIM + +HCVL PGIPLKPMLAKP+KSITEVLDRF G++FTCEYKYD
Sbjct: 304 PNYEMIINAALQYGIMNLPQHCVLTPGIPLKPMLAKPTKSITEVLDRFQGQRFTCEYKYD 363

Query: 360 GERAQVHLLPDGSMNIYSRNGENMTERYPELHIRDYLADPETTHSLILDCEAVAWDTEQG 419
           GERAQVHL+ DG++ IYSRN ENMTERYPE+    +LA+P+TT SLI+DCEAVAWD E+ 
Sbjct: 364 GERAQVHLMEDGTIRIYSRNSENMTERYPEIQFHQFLANPQTTRSLIIDCEAVAWDNEKQ 423

Query: 420 KILPFQILSTRKRKGVEAKDVKVRVCLFAFDMLCYNGQSLINNSLLERREYLQRVLKPVT 479
           KILPFQ+LSTRKRKGVE KDVKVRVCLFAFD+L  NG+SL+  SL +RR++L  VLK V 
Sbjct: 424 KILPFQVLSTRKRKGVELKDVKVRVCLFAFDLLYLNGESLLKCSLADRRKHLYSVLKVVP 483

Query: 480 GQFQFANELNSSNLEDVQKYLEQSVKDACEGLMVKVLEGEESHYEPSKRSRNWLKLKKDY 539
           G+ QFANE+ +  L ++Q YLEQSV  +CEGLMVK+L+GEES YEPSKRSRNWLKLKKDY
Sbjct: 484 GELQFANEITTMELSELQTYLEQSVSASCEGLMVKMLDGEESQYEPSKRSRNWLKLKKDY 543

Query: 540 LQGVGDSLDLCVLXXXXXXXXXXXXXXXFLLGCYNQDTGEFETCCKIGTGFSDEMLVSLY 599
           L+GVGDSLDL VL               FLLGCYN D  EFETCCKIGTGFS+E+L SL+
Sbjct: 544 LEGVGDSLDLAVLGAYYGRGKRTGTYGGFLLGCYNPDLEEFETCCKIGTGFSEEVLQSLH 603

Query: 600 EKLKPSSLEQPKAFYVYDSSAEPDVWFEPTMLFEVLTADLSLSPIYKAGNSAYGKGISLR 659
            +LK + +  P+    YD S+ PDVWFEP MLFEVLTADLSLSP+YKAG   YGKGISLR
Sbjct: 604 AQLKDTVIAAPRGDVSYDDSSPPDVWFEPAMLFEVLTADLSLSPVYKAGRDVYGKGISLR 663

Query: 660 FPRFIRIRDDKDVEDATSSEQIVELYESQVN 690
           FPRF+RIR+DK V DATSS+QIVE Y+ Q N
Sbjct: 664 FPRFLRIREDKSVTDATSSDQIVEFYQRQAN 694

>TBLA0E02050 Chr5 (498038..500200) [2163 bp, 720 aa] {ON} Anc_7.343
           YDL164C
          Length = 720

 Score =  827 bits (2137), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 408/689 (59%), Positives = 503/689 (73%), Gaps = 14/689 (2%)

Query: 11  TKKQVTLARFFSSAKKGGNKEDKLEPQAKRAKVDPANTSELITNEAXXXXXXXXXXXXXX 70
           +KKQVTLARFF+       +E K E +   + V      +    +               
Sbjct: 38  SKKQVTLARFFA------KREPKDEEKQSSSPVKEQVQIQGQPQQEQVKIQPQEQKQIVV 91

Query: 71  XXXXXXXTPVMAPVHHSK-----IPYSDVCNIFSEIESTSSRLSIVKICSNFFYSVLKQN 125
                  T    P   SK     +PY+D+C +F  IES SSRL+I  +C+ FF   L+ +
Sbjct: 92  PQEVTTSTQTPRPTKKSKPATSSLPYADLCQLFETIESESSRLTITNLCTAFFSRTLQLD 151

Query: 126 PSNLVPITYLFINRLGPDYEPXXXXXXXXXXXMKTIAESCGKSLQQVRAKYREIGDLGEV 185
           PS LVP+TYL IN+LGPDY             +K I  +CG S QQ++ +YR++GDLG++
Sbjct: 152 PSLLVPVTYLCINKLGPDYS-GVELGLGEGLLLKAIGSACGVSQQQLKLQYRKLGDLGQL 210

Query: 186 AQEARAVQPT--MFKPKPLTVGEVFNNLKSIAKSQGKDSQTRKIQLIKRMLTACQGVEAK 243
           A   R +QPT  MFK +PLT+ +VF+ L  IA SQGKDSQ +KI +IKR+LT+CQGVEAK
Sbjct: 211 AMSTRVLQPTITMFKLEPLTITKVFDTLAKIAASQGKDSQNQKINMIKRLLTSCQGVEAK 270

Query: 244 FLIRSLESKLRIGLAEKTVLISLSKALLSYEHDGEEPSSELVENAEQRVRDAFCQVPNYE 303
           FLIRSLESKLRIGLAEKTVL SL++AL+ +E   +    +   NAEQ ++D+FCQ+PNYE
Sbjct: 271 FLIRSLESKLRIGLAEKTVLTSLARALVIHEKGNDNIQDDDYSNAEQIIKDSFCQIPNYE 330

Query: 304 IVINTCLEHGIMEVNKHCVLKPGIPLKPMLAKPSKSITEVLDRFHGEKFTCEYKYDGERA 363
           I+I T L++G+ ++  H  L PGIPLKPMLAKP+KSI+EVLD F   +FT EYKYDGERA
Sbjct: 331 IIITTSLQYGVSQLASHIKLTPGIPLKPMLAKPTKSISEVLDTFQNIQFTSEYKYDGERA 390

Query: 364 QVHLLPDGSMNIYSRNGENMTERYPELHIRDYLADPETTHSLILDCEAVAWDTEQGKILP 423
           QVHLLPDGSM IYSRNGE+MT+RYPEL+I+DYL D  TT  LILDCEAVAWD E  KILP
Sbjct: 391 QVHLLPDGSMRIYSRNGEDMTQRYPELNIQDYLVDSTTTTQLILDCEAVAWDVELQKILP 450

Query: 424 FQILSTRKRKGVEAKDVKVRVCLFAFDMLCYNGQSLINNSLLERREYLQRVLKPVTGQFQ 483
           FQ+LSTRKRK V+ KD+KVRVCLFAFD+L +N  SLINN+L ERR+ L  + KP  GQFQ
Sbjct: 451 FQVLSTRKRKSVDLKDIKVRVCLFAFDILRHNNDSLINNTLRERRDILHSITKPCPGQFQ 510

Query: 484 FANELNSSNLEDVQKYLEQSVKDACEGLMVKVLEGEESHYEPSKRSRNWLKLKKDYLQGV 543
           FA EL +SNL+++Q +L++++KD+CEGLMVK L+G +SHYEPSKRSRNWLKLKKDYLQG+
Sbjct: 511 FATELTTSNLDELQTFLDKAIKDSCEGLMVKSLDGTDSHYEPSKRSRNWLKLKKDYLQGM 570

Query: 544 GDSLDLCVLXXXXXXXXXXXXXXXFLLGCYNQDTGEFETCCKIGTGFSDEMLVSLYEKLK 603
           GDSLDLCVL               FLL CYNQDT EFETCCKIGTGFSDEML +LY  LK
Sbjct: 571 GDSLDLCVLGAYYGRGKRTGTYGGFLLACYNQDTEEFETCCKIGTGFSDEMLQTLYNGLK 630

Query: 604 PSSLEQPKAFYVYDSSAEPDVWFEPTMLFEVLTADLSLSPIYKAGNSAYGKGISLRFPRF 663
            +++E P+A +V+DSSAEPDVWF PTM+FEVLTADLSLSPIYKAG++ YGKGISLRFPRF
Sbjct: 631 ETAIESPRANFVFDSSAEPDVWFNPTMVFEVLTADLSLSPIYKAGSTVYGKGISLRFPRF 690

Query: 664 IRIRDDKDVEDATSSEQIVELYESQVNLQ 692
           IRIR DK V DATSSEQ+++ YE+Q +LQ
Sbjct: 691 IRIRTDKSVNDATSSEQVIDFYENQSHLQ 719

>TPHA0D04570 Chr4 (996539..998749) [2211 bp, 736 aa] {ON} Anc_7.343
           YDL164C
          Length = 736

 Score =  825 bits (2131), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 412/705 (58%), Positives = 514/705 (72%), Gaps = 36/705 (5%)

Query: 11  TKKQVTLARFFSSAKKGGNKEDKLEPQAKRAKVDPANTSELITNEAXXXXXXXXXXXXXX 70
           +KKQ TLARFF+S  K      K  P      V+ A   E   N                
Sbjct: 44  SKKQATLARFFTSMGK------KTPPA-----VEVATKQESPENHVDKKRKVEVHPSQSV 92

Query: 71  XXXXXXXTPVMAPVHHSKIPYSDVCNIFSEIESTSSRLSIVKICSNFFYSVLKQNPSNLV 130
                  +P       S + YS+VCN+F +IE TSSRL+I+K+CS FF  V+K NPS+++
Sbjct: 93  GASEKAESP--PDQTKSTVLYSEVCNLFQQIEETSSRLAIIKLCSEFFIRVIKNNPSDII 150

Query: 131 PITYLFINRLGPDYEPXXXXXXXXXXXMKTIAESCGKSLQQVRAKYREIGDLGEVAQEAR 190
            + YLFINRLGPDYEP           +KTI+E+ GKS++Q++ + +E GDLG +A++AR
Sbjct: 151 IVAYLFINRLGPDYEPGLELGLGENLLIKTISEAYGKSIKQIKLELKETGDLGTIARDAR 210

Query: 191 AVQPTMFKPKPLTVGEVFNNLKSIAKSQGKDSQTRKIQLIKRMLTACQGVEAKFLIRSLE 250
            +QPTMFKPKPLT+ +VFNNLK IA + GKDSQ RKI+LIK+ML+A +G+EAKFLIRSLE
Sbjct: 211 NIQPTMFKPKPLTISDVFNNLKKIASATGKDSQLRKIKLIKQMLSASKGLEAKFLIRSLE 270

Query: 251 SKLRIGLAEKTVLISLSKALLSYEHDGEEPSS----------ELVENAEQRVRDAFCQVP 300
           SKLRIGLAEKTVLISLSKALL +EH  E+  S          +L+E AE ++R+A CQVP
Sbjct: 271 SKLRIGLAEKTVLISLSKALLLHEHWKEKGESKFDEEDVESMDLIEQAEAKLREAHCQVP 330

Query: 301 NYEIVINTCLEHGIMEVNKHCVLKPGIPLKPMLAKPSKSITEVLDRFHGEKFTCEYKYDG 360
           NYEIVIN CL+ GI+ ++K C L+PGIPLKPMLAKP+K+ITEVL+ F G++F  EYKYDG
Sbjct: 331 NYEIVINLCLQDGILNIDKTCTLRPGIPLKPMLAKPTKAITEVLNAFQGKEFISEYKYDG 390

Query: 361 ERAQVHLLPDGSMNIYSRNGENMTERYPELHIRDYLA-------DPETTHSL------IL 407
           ERAQVHLL  G M IYSRNGENMTERYPEL ++D+L        D E  +++      IL
Sbjct: 391 ERAQVHLLEGGEMRIYSRNGENMTERYPELDVKDFLCVVKAITNDQEGENAIQPVKDIIL 450

Query: 408 DCEAVAWDTEQGKILPFQILSTRKRKGVEAKDVKVRVCLFAFDMLCYNGQSLINNSLLER 467
           DCE VAWD EQ KILPFQ+L+TRKRK V+ KDVKVRVCLFAFD+L  N + +IN SL ER
Sbjct: 451 DCEVVAWDVEQKKILPFQVLTTRKRKNVDLKDVKVRVCLFAFDLLYLNNEGMINKSLRER 510

Query: 468 REYLQRVLKPVTGQFQFANELNSSNLEDVQKYLEQSVKDACEGLMVKVLEGEESHYEPSK 527
           +E L++V   V G+FQ+A  L +S+++++Q +L+Q+VK++CEGLMVK+L+GEESHYEPSK
Sbjct: 511 QEILRKVTVLVPGEFQYATSLITSDMDELQTFLDQAVKNSCEGLMVKMLDGEESHYEPSK 570

Query: 528 RSRNWLKLKKDYLQGVGDSLDLCVLXXXXXXXXXXXXXXXFLLGCYNQDTGEFETCCKIG 587
           RSRNWLKLKKDYL GVGDSLDL V+               FLLGCYN+DT EFETCCKIG
Sbjct: 571 RSRNWLKLKKDYLDGVGDSLDLVVMGAYFGKGKRTGSYGGFLLGCYNEDTQEFETCCKIG 630

Query: 588 TGFSDEMLVSLYEKLKPSSLEQPKAFYVYDSSAEPDVWFEPTMLFEVLTADLSLSPIYKA 647
           TGFSDEML +L+  L+P+ ++ P   Y+YDSSAEPDVWF+  +LFEVLTADLSLSP+YKA
Sbjct: 631 TGFSDEMLGNLHTLLQPTEIDNPPMTYIYDSSAEPDVWFQAKVLFEVLTADLSLSPVYKA 690

Query: 648 GNSAYGKGISLRFPRFIRIRDDKDVEDATSSEQIVELYESQVNLQ 692
           GNS Y KGISLRFPRF+RIR+DKDV D T+SE I+E YESQ ++Q
Sbjct: 691 GNSRYDKGISLRFPRFLRIREDKDVTDGTTSEDIIEFYESQSHIQ 735

>TPHA0M00260 Chr13 complement(50326..53226) [2901 bp, 966 aa] {ON}
           Anc_6.18 YOR005C
          Length = 966

 Score =  111 bits (277), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 108/403 (26%), Positives = 168/403 (41%), Gaps = 59/403 (14%)

Query: 329 LKPMLAKPSKSITEVLDRFHGEKFTCEYKYDGERAQVHLLPDG-SMNIYSRNGENMTERY 387
            +P LAK      EVL R    KFT E K DGER Q+H +  G  +  +SR G + T  Y
Sbjct: 264 FEPQLAKKVNLSYEVLSRRMNNKFTIEEKMDGERIQIHYMDYGHQIKYFSRRGNDYTYLY 323

Query: 388 PE----LHIRDYLADPETTHSLILDCEAVAWDTEQGKILPFQILSTRKRKGVEAKDVKVR 443
            +      I  YL   E     ILD E V++D  +  ILPF ++ +     ++   ++  
Sbjct: 324 GKDKSTATISKYLQLNEDVKECILDGEMVSYDKSRNCILPFGMVKSGAANSLKIDGLEND 383

Query: 444 VC---LFAFDMLCYNGQSLINNSLLERREYLQRVLKPVTGQFQFANELNSSNLEDVQKYL 500
           +C      FD+L  NG  L N  L +R+EYL  +L P     +      + + E ++  L
Sbjct: 384 LCSPLFIVFDVLFLNGSPLTNLPLYQRKEYLSNILTPKKSHIEILKFSIAHDSESIRSAL 443

Query: 501 EQSVKDACEGLMVKVLEGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVLXXXXXXXX 560
           + ++    EG+   VL+  +S Y    R+ +W+K+K +YL+  G++LDL V+        
Sbjct: 444 QAAISVGSEGI---VLKKYDSLYSVGDRNNDWIKVKPEYLEQFGENLDLIVIGRDPGKKD 500

Query: 561 XXXXXXXFL----------------LGCYNQDT---------------GEFETCCKIGTG 589
                   L                L   + D+                +F + C I  G
Sbjct: 501 SLMCGVAVLENEESYEKILQEEVITLTSDDDDSQNNIPEDKPIRTKRITKFISFCVIANG 560

Query: 590 FSDEMLVSLYEK----LKPSSLEQPKAFYVYDSSAEPDVWFEP--TMLFEV----LTADL 639
            S+E    +  K     K  S E P   Y+   +  P  W  P  +++ EV    L  + 
Sbjct: 561 ISNEEFKEIDRKTFGCWKKFSDEAPPTDYLEFGTRLPVEWINPHDSVVLEVKARSLENNE 620

Query: 640 SLSPIYKAGNSAYGKGISLRFPRFIRIRDDKDVEDATSSEQIV 682
           +L   +K G + YG      + R  RIR DKD  D  +   +V
Sbjct: 621 ALRDKFKTGYTLYGA-----YCR--RIRTDKDFNDCYTFSDLV 656

>Smik_15.174 Chr15 complement(301851..304688) [2838 bp, 945 aa] {ON}
           YOR005C (REAL)
          Length = 945

 Score =  110 bits (276), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 110/435 (25%), Positives = 175/435 (40%), Gaps = 49/435 (11%)

Query: 293 RDAFCQVPNYEIVINTCLEHGIMEVNKHCVLKPGIPLKPMLAKPSKSITEVLDRFHGEKF 352
           +D    V + ++V +   +  +   N    +K G    P LAK      E + R     F
Sbjct: 218 QDYLSVVSDLKVVASKLYDPRVRLKNDDLTIKVGFAFAPQLAKKVNLPYEKICRALHNDF 277

Query: 353 TCEYKYDGERAQVHLLPDG-SMNIYSRNGENMTERY----PELHIRDYLADPETTHSLIL 407
             E K DGER QVH +  G S+  YSR G + T  Y        I  +L   +     +L
Sbjct: 278 LVEEKMDGERIQVHYMNYGKSVRFYSRRGIDYTYLYGASLSSGTISHHLDFTDNVRECVL 337

Query: 408 DCEAVAWDTEQGKILPFQILSTRKRKGVE---AKDVKVRVCLFAFDMLCYNGQSLINNSL 464
           D E V +D  +  ILPF ++    +  +      +V        FD+L  NG SL    L
Sbjct: 338 DGEMVTFDARRKVILPFGLVKGSAKDALSFNSINNVDFHPLYVVFDLLYLNGTSLTPLPL 397

Query: 465 LERREYLQRVLKPVTGQFQFANELNSSNLEDVQKYLEQSVKDACEGLMVKVLEGEESHYE 524
            +R+EYL+ +L PV    +        N+E ++K LE ++    EG+++K      S Y 
Sbjct: 398 HQRKEYLESILTPVKNVVEMVRTSRCYNVESIKKSLEVAISLGSEGVVLKYY---NSSYN 454

Query: 525 PSKRSRNWLKLKKDYLQGVGDSLDLCVLXXXXXXXXXXXXXXXFL-------------LG 571
            + R+ NW+K+K +YL+  G++LDL ++                L              G
Sbjct: 455 VASRNNNWIKVKPEYLEEFGENLDLVIIGRDPGKKDSFMLGLLLLNEKEMDKRDQEVSSG 514

Query: 572 CYNQDTGE-----------FETCCKIGTGFSDEMLVSLYEKL-----KPSSLEQPKAFYV 615
             N    E             + C +  G S E    +  K      K S +  P + + 
Sbjct: 515 IANNSKNENILYSQKKVKKILSFCSVANGISQEEFKEIDRKTRGCWKKTSEVAPPASIFE 574

Query: 616 YDSSAEPDVWFEP--TMLFEVLTADLSLSPIYKAGNSAYGKGISLRFPRFIRIRDDKDVE 673
           + S   P  W EP  +++ E+ +  L  +   +     Y    +L      RIR DKD  
Sbjct: 575 FGSKI-PAEWIEPNESIVLEIKSRSLDNT---ETNMQKYATSCTLYGGYCKRIRFDKDWT 630

Query: 674 DATSSEQIVELYESQ 688
           D  +   + ELY+S+
Sbjct: 631 DCFT---LNELYDSR 642

>KNAG0F02870 Chr6 (543177..546041) [2865 bp, 954 aa] {ON} Anc_6.18
           YOR005C
          Length = 954

 Score =  110 bits (275), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 78/267 (29%), Positives = 126/267 (47%), Gaps = 11/267 (4%)

Query: 294 DAFCQVPNYEIVINTCLEHGIMEVNKHCVLKPGIPLKPMLAKPSKSITEVLDRFHGEKFT 353
           D F  V +   V     E  +   N+   LK G    P LAK      E + +  G  F+
Sbjct: 220 DYFSVVSDLSSVTKKLYEPSVRLRNEDLTLKIGSAFAPHLAKRLNISYEKILKKLGSDFS 279

Query: 354 CEYKYDGERAQVHLLPDGS-MNIYSRNGENMTERY----PELHIRDYLADPETTHSLILD 408
            E K DGER Q+H +  G+ +   SR G + T  Y        I  YL   E     ILD
Sbjct: 280 IEEKMDGERIQIHYMDYGNEIKFLSRRGTDYTYLYGGDTSTGTIACYLKLNENVKECILD 339

Query: 409 CEAVAWDTEQGKILPFQILSTRKRKGVEAKDVK---VRVCLFAFDMLCYNGQSLINNSLL 465
            E V +D E+  ILPF ++ +  +  +  + +          AFD++  NG SL++  L 
Sbjct: 340 GEMVTYDQEKQMILPFGLVKSSAKNFLSKESISNGSYHPLFMAFDLVYLNGTSLVDLPLY 399

Query: 466 ERREYLQRVLKPVTGQFQFANELNSSNLEDVQKYLEQSVKDACEGLMVKVLEGEESHYEP 525
           +R++YL ++L    G     +    +NLE + K L  ++    EG+++K L    S Y  
Sbjct: 400 QRKDYLSKILTKCNGFVDIVSFARCNNLESITKSLAAAISVGSEGIILKKL---NSRYMV 456

Query: 526 SKRSRNWLKLKKDYLQGVGDSLDLCVL 552
           + R+ +W+K+K  YL+  G+++DL ++
Sbjct: 457 ASRNDSWIKIKPQYLKQFGENMDLIII 483

>TDEL0G04510 Chr7 (819479..822388) [2910 bp, 969 aa] {ON} Anc_6.18
           YOR005C
          Length = 969

 Score =  108 bits (269), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 102/409 (24%), Positives = 171/409 (41%), Gaps = 55/409 (13%)

Query: 326 GIPLKPMLAKPSKSITEVLDRFHGEKFTCEYKYDGERAQVHLLPDGS-MNIYSRNGENMT 384
           G    P LAK      E +       F  E K DGER QVH +  G+ +   SR G + T
Sbjct: 268 GYAFVPQLAKKMTISYEKICTKLNNDFLIEEKMDGERIQVHYMDYGAKIRFLSRRGVDYT 327

Query: 385 ERYPE----LHIRDYLADPETTHSLILDCEAVAWDTEQGKILPFQILSTRKRKGVEAKDV 440
           + Y E      + +YL         +LD E + +DT++  +LPF ++ +  R+ +  + +
Sbjct: 328 QLYGENLQSGTVANYLNFDSNVRDCVLDGEMITFDTDRNVVLPFGMVKSSARQALSTEGI 387

Query: 441 ---KVRVCLFAFDMLCYNGQSLINNSLLERREYLQRVLKPVTGQFQFANELNSSNLEDVQ 497
                R  L   D++  NG SLI   L +R+E+L RVLKP     +    +  S    ++
Sbjct: 388 CSQGHRPMLMVLDLVYLNGVSLIKLPLYQRKEFLNRVLKPCPHAVEILPYVRCSEHTAIR 447

Query: 498 KYLEQSVKDACEGLMVKVLEGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVLXXXXX 557
           K LE+S+    EG+   VL+  ++ YE   R+  W+K+K +YL+  G++LDL ++     
Sbjct: 448 KSLEKSISMGSEGI---VLKSYKARYEIGARNDYWIKVKPEYLEQFGENLDLVIIGRTPG 504

Query: 558 XXXXXXXXXXFLLGCYNQDTGEFE------------------------------TCCKIG 587
                        G   +D  E E                              + C I 
Sbjct: 505 KKDSLMCGLAVYEG--EEDLNEIEAKRESAIVNLDSEGDELDDTDGKKIIKYFISFCVIA 562

Query: 588 TGFSDEMLVSLYEKLKPSSLEQ----PKAFYVYDSSAEPDVWFEP--TMLFEVLTADLSL 641
            G S +    +  K + + ++     P A  +   S  P+ W +P  +++ EV    L  
Sbjct: 563 NGISQQEFKEIDRKTRGAWVKSDQRLPSADLLRFGSKIPEEWIDPKNSIMLEVKARSLDN 622

Query: 642 SPIYKAGNSAYGKGISLRFPRFIRIRDDKDVEDATSSEQIVELYESQVN 690
           +   ++    +  G +L      RIRDDK   D T      EL++ +++
Sbjct: 623 T---ESSKKKFAAGCTLHGGYCRRIRDDK---DWTGCYSFSELWQERLH 665

>ZYRO0C07854g Chr3 (595546..598380) [2835 bp, 944 aa] {ON} similar
           to uniprot|Q08387 Saccharomyces cerevisiae YOR005C DNL4
           DNA ligase required for nonhomologous end- joining
           (NHEJ) forms stable heterodimer with required cofactor
           Lif1p catalyzes DNA ligation as part of a complex with
           Lif1p and Nej1p involved in meiosis not essential for
           vegetative growth
          Length = 944

 Score =  107 bits (267), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 78/270 (28%), Positives = 128/270 (47%), Gaps = 13/270 (4%)

Query: 292 VRDAFCQVPNYEIVINTCLEHGIMEVNKHCVLKPGIPLKPMLAKP-SKSITEVLDRFHGE 350
            RD    V + + V +   +      N    +  G+P  P LAK    S  +V  R   +
Sbjct: 219 ARDYLSVVSDLKTVADKLWDPSHRLKNDDLGVNLGLPFAPFLAKRLYISYDKVALRLKSD 278

Query: 351 KFTCEYKYDGERAQVHLLPDG-SMNIYSRNGENMTERYPE----LHIRDYLADPETTHSL 405
            F  E K DGER Q+H +  G  +  +SR G + T  Y E      +  YL         
Sbjct: 279 -FYIEEKMDGERIQLHYMDYGRKLKWFSRRGNDYTYLYGEDIGTGTVAKYLQLDPKVREC 337

Query: 406 ILDCEAVAWDTEQGKILPFQILSTRKRKGVEAKDV---KVRVCLFAFDMLCYNGQSLINN 462
           +LD E +++DTE+  +LPF ++ +  R  + A+ +     R      D L  NG SLIN 
Sbjct: 338 VLDGEMISFDTEENSVLPFGLVKSSARDSLTAEGILTQGYRPLYMVIDFLYLNGVSLINV 397

Query: 463 SLLERREYLQRVLKPVTGQFQFANELNSSNLEDVQKYLEQSVKDACEGLMVKVLEGEESH 522
            L  R++YL  +L P     +    ++  +   ++  LE+++    EG+++K  +   S 
Sbjct: 398 PLNTRKQYLSAILNPCPHAVEIIQSMHCYDDTSIKSSLEKAIMMGSEGIILKHFK---SK 454

Query: 523 YEPSKRSRNWLKLKKDYLQGVGDSLDLCVL 552
           YE   R+ NW+K+K +YL+  G++LDL V+
Sbjct: 455 YEIGARTDNWIKIKPEYLEQFGENLDLLVI 484

>ACR008W Chr3 (368913..371858) [2946 bp, 981 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR005C (DNL4)
          Length = 981

 Score =  107 bits (267), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 105/403 (26%), Positives = 164/403 (40%), Gaps = 64/403 (15%)

Query: 323 LKPGIPLKPMLAKPSKSITEVLDRFHGEKFTCEYKYDGERAQVHLLPDG-SMNIYSRNGE 381
           ++ G    P +A+  K   E +    G  F  E K DG+R QVH +  G S+  +SRNG 
Sbjct: 288 VRIGYAFAPHMAQRVKIPYEKVSTKLGNDFYVEEKMDGDRIQVHYMDYGNSIAYFSRNGI 347

Query: 382 NMTERYPE----LHIRDYLADPETTHSLILDCEAVAWDTEQGKILPFQILSTRKRKGVEA 437
           N T  Y E      I ++L   E     ILD E V++D E   ILPF +  +     V  
Sbjct: 348 NYTYLYGENSSKGSISNHLKFVEGVKECILDGEMVSYDKEMQCILPFGLTKSGASHQVNF 407

Query: 438 KDV-----KVRVCLFAFDMLCYNGQSLINNSLLERREYLQRVLKPVTGQFQFANELNSSN 492
           +         R     FD+L  NGQ L N  +++R+EYL+++L P        +    S+
Sbjct: 408 ETTGHTEPTYRPLYAVFDLLYLNGQLLTNQDVVKRKEYLEKILIPSKNVVHLLSGPRCSD 467

Query: 493 LEDVQKYLEQSVKDACEGLMVKVLEGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVL 552
            E +   L  +V    EG+   VL+   S Y   KR  +W+K+K +YL+  G+++DL V+
Sbjct: 468 AEAITAALGAAVAHGSEGI---VLKKARSKYSVGKRDDSWIKIKPEYLENFGENMDLVVI 524

Query: 553 XXXXXXXXXXXXXXXFLLGCYNQDTGE----------------------------FETCC 584
                          F+      D  E                            F + C
Sbjct: 525 ------GRDKGRKDSFICALAVTDDSEKNNPSSYESGSDSDSDSEPIIVQPKIEKFISFC 578

Query: 585 KIGTGFSDEMLVSLYEKLK----PSSLEQPKAFYVYDSSAEPDVWFEP--TMLFEV---- 634
            I  G S+E    +    +    P    +P   +V   +  P  W +P  +++ EV    
Sbjct: 579 SIANGISNEEFKEIDRLTRGNWFPYDERKPPTDWVEFGTKTPREWIDPKNSVVLEVKARS 638

Query: 635 LTADLSLSPIYKAGNSAYGKGISLRFPRFIRIRDDKDVEDATS 677
           +  + S S +YK G++ Y            RIR DK+   A++
Sbjct: 639 IDNEESKSDLYKTGSTLYNAYCK-------RIRHDKNWSTAST 674

>KLLA0D01089g Chr4 complement(97438..100161) [2724 bp, 907 aa] {ON}
           similar to uniprot|Q08387 Saccharomyces cerevisiae
           YOR005C DNL4 DNA ligase required for nonhomologous end-
           joining (NHEJ) forms stable heterodimer with required
           cofactor Lif1p catalyzes DNA ligation as part of a
           complex with Lif1p and Nej1p involved in meiosis not
           essential for vegetative growth
          Length = 907

 Score =  106 bits (264), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 95/383 (24%), Positives = 168/383 (43%), Gaps = 35/383 (9%)

Query: 329 LKPMLAKPSKSITEVLDRFHGEKFTCEYKYDGERAQVHLLPDGSMNIY-SRNGENMTERY 387
            +P LAK +    E +       F  E K DGER Q+H +  G    Y SR G + +  Y
Sbjct: 247 FEPQLAKRTHLSYERVASKLQHDFIIEEKMDGERLQIHYINYGEQIKYLSRRGVDFSYLY 306

Query: 388 PELHIRDYLADPETTH----SLILDCEAVAWDTEQGKILPFQILSTRKRKGVEAKDVKV- 442
            E      ++     H      ILD E + +DTE+  +LPF ++ +     ++++   + 
Sbjct: 307 GENSSSGPISPSLKLHFNVKDCILDGEMITYDTEKDIVLPFGLVKSSAMNQIQSELAGIA 366

Query: 443 -----RVCLFAFDMLCYNGQSLINNSLLERREYLQRVLKPVTGQFQFANELNSSNLEDVQ 497
                +    AFD++  NG+SL N +L  R++YL ++L PV    +    + + N E ++
Sbjct: 367 PTESYKPLFVAFDLVYLNGKSLTNLALERRKDYLTKILTPVERSVEIIQYMKAINAEAIK 426

Query: 498 KYLEQSVKDACEGLMVKVLEGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVLXXXXX 557
             LEQ++    EG+++K L    S Y    R+ +W+K+K +YL+  G+++DL ++     
Sbjct: 427 DSLEQAISMGSEGIVLKHL---HSKYFVGSRNTDWIKIKPEYLEQFGENMDLLII----- 478

Query: 558 XXXXXXXXXXFLLGCYNQDTGE------FETCCKIGTGFSDEMLVSL----YEKLKPSSL 607
                     F  G    D  E      F + C I  G S+E    +    + K    S 
Sbjct: 479 -GREQGKKDSFFCGLSISDPNEVAEKPRFISFCTIANGLSNEEFKDIERKTWGKWHIFSE 537

Query: 608 EQPKAFYVYDSSAEPDVWFEP--TMLFEVLTADLSLSPIYKAGNSAYGKGISLRFPRFIR 665
           + P    +   +  P  W  P  +++ EV    +      ++    Y  G +L F    +
Sbjct: 538 DPPSPNLLGFGTKVPYEWIHPEDSVVLEVKARAIDTK---ESEKRKYRSGCTLHFGYCKQ 594

Query: 666 IRDDKDVEDATSSEQIVELYESQ 688
           IR DKD +   S  +  ++ +++
Sbjct: 595 IRYDKDWKTVASFSEFEDMKDAR 617

>Suva_15.180 Chr15 complement(308983..311829) [2847 bp, 948 aa] {ON}
           YOR005C (REAL)
          Length = 948

 Score =  106 bits (264), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 114/442 (25%), Positives = 176/442 (39%), Gaps = 62/442 (14%)

Query: 293 RDAFCQVPNYEIVINTCLEHGIMEVNKHCVLKPGIPLKPMLAKPSKSITEVLDRFHGEKF 352
           +D    V +  +V +   +  I   N    +K G    P LAK      E +       F
Sbjct: 218 QDYLSVVSDLRVVTSKLYDPDIRLKNDDLSIKVGFAFAPQLAKKVNLSYEKICHALRNDF 277

Query: 353 TCEYKYDGERAQVHLLPDG-SMNIYSRNGENMTERYP----ELHIRDYLADPETTHSLIL 407
             E K DGER QVH +  G S+  +SR G + T  Y        I  YL   ++    +L
Sbjct: 278 FVEEKMDGERIQVHYMNYGKSIKFFSRRGIDYTYLYGVNLLSGTISQYLKFSDSVKECVL 337

Query: 408 DCEAVAWDTEQGKILPFQILSTRKRKGVEAKDVK---VRVCLFAFDMLCYNGQSLINNSL 464
           D E V +D  +  ILPF ++    ++ +   D+           FD+L  NG SL    L
Sbjct: 338 DGEMVTFDAMRKVILPFGLVKGSAKEALSFNDINNNDFHPLYMVFDLLYLNGTSLTPLPL 397

Query: 465 LERREYLQRVLKPVTGQFQFANELNSSNLEDVQKYLEQSVKDACEGLMVKVLEGEESHYE 524
            +R+EYL  +L P     +        + E V+K LE ++    EG+   VL+   S Y 
Sbjct: 398 YQRKEYLSSILIPSKSVVEIVRYSRCYDAESVKKSLEVAISLGSEGV---VLKHYSSSYN 454

Query: 525 PSKRSRNWLKLKKDYLQGVGDSLDLCVLXXXXXXXXXXXXXXXFLLGCY---NQDTGEFE 581
            + R+ NW+K+K +YL+  G++LDL ++               F+LG      Q+TG+ +
Sbjct: 455 VASRNNNWIKVKPEYLEEFGENLDLIII------GRDSGKKDSFMLGLLVVDEQETGKTD 508

Query: 582 ----------------------------TCCKIGTGFSDEMLVSLYEKL-----KPSSLE 608
                                       + C I  G S E    +  K      K S L 
Sbjct: 509 QEGPSEILNDSSTERRATNPKKRVRKVLSFCSIANGISQEEFKEIDRKTRGHWKKTSGLS 568

Query: 609 QPKAFYVYDSSAEPDVWFEP--TMLFEVLTADLSLSPIYKAGNSAYGKGISLRFPRFIRI 666
            P +   + S   P  W EP  +++ E+ +  L  +   +     Y    +L      RI
Sbjct: 569 PPPSILEFGSKL-PAEWIEPSESIVLEIKSRSLDNT---ETNMQKYATNCTLYGGYCRRI 624

Query: 667 RDDKDVEDATSSEQIVELYESQ 688
           R DK   D T    + ELYE++
Sbjct: 625 RYDK---DWTECYTLDELYENR 643

>YOR005C Chr15 complement(334509..337343) [2835 bp, 944 aa] {ON}
           DNL4DNA ligase required for nonhomologous end-joining
           (NHEJ), forms stable heterodimer with required cofactor
           Lif1p, interacts with Nej1p; involved in meiosis, not
           essential for vegetative growth
          Length = 944

 Score =  104 bits (259), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 104/410 (25%), Positives = 169/410 (41%), Gaps = 59/410 (14%)

Query: 323 LKPGIPLKPMLAKPSKSITEVLDRFHGEKFTCEYKYDGERAQVHLLPDG-SMNIYSRNGE 381
           +K G    P LAK      E + R   + F  E K DGER QVH +  G S+  +SR G 
Sbjct: 248 IKVGFAFAPQLAKKVNLSYEKICRTLHDDFLVEEKMDGERIQVHYMNYGESIKFFSRRGI 307

Query: 382 NMTERY----PELHIRDYLADPETTHSLILDCEAVAWDTEQGKILPFQILSTRKRKGVE- 436
           + T  Y        I  +L   ++    +LD E V +D ++  ILPF ++    ++ +  
Sbjct: 308 DYTYLYGASLSSGTISQHLRFTDSVKECVLDGEMVTFDAKRRVILPFGLVKGSAKEALSF 367

Query: 437 --AKDVKVRVCLFAFDMLCYNGQSLINNSLLERREYLQRVLKPVTGQFQFANELNSSNLE 494
               +V        FD+L  NG SL    L +R++YL  +L P+    +         +E
Sbjct: 368 NSINNVDFHPLYMVFDLLYLNGTSLTPLPLHQRKQYLNSILSPLKNIVEIVRSSRCYGVE 427

Query: 495 DVQKYLEQSVKDACEGLMVKVLEGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVLXX 554
            ++K LE ++    EG+++K      S Y  + R+ NW+K+K +YL+  G++LDL V+  
Sbjct: 428 SIKKSLEVAISLGSEGVVLKYY---NSSYNVASRNNNWIKVKPEYLEEFGENLDLIVI-- 482

Query: 555 XXXXXXXXXXXXXFLLGCYNQDTGEFE------------------------------TCC 584
                        F+LG    D  E++                              + C
Sbjct: 483 ----GRDSGKKDSFMLGLLVLDEEEYKKHQGDSSEIVDHSSQEKHIQNSRRRVKKILSFC 538

Query: 585 KIGTGFSDEMLVSLYEK----LKPSSLEQPKAFYVYDSSAEPDVWFEP--TMLFEVLTAD 638
            I  G S E    +  K     K +S   P A  +   S  P  W +P  +++ E+ +  
Sbjct: 539 SIANGISQEEFKEIDRKTRGHWKRTSEVAPPASILEFGSKIPAEWIDPSESIVLEIKSRS 598

Query: 639 LSLSPIYKAGNSAYGKGISLRFPRFIRIRDDKDVEDATSSEQIVELYESQ 688
           L  +   +     Y    +L      RIR DK+  D  +   + +LYES+
Sbjct: 599 LDNT---ETNMQKYATNCTLYGGYCKRIRYDKEWTDCYT---LNDLYESR 642

>TBLA0G01040 Chr7 complement(258966..261884) [2919 bp, 972 aa] {ON}
           Anc_6.18 YOR005C
          Length = 972

 Score =  103 bits (258), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 70/243 (28%), Positives = 117/243 (48%), Gaps = 11/243 (4%)

Query: 318 NKHCVLKPGIPLKPMLAKPSKSITEVLDRFHGEKFTCEYKYDGERAQVHLLPDG-SMNIY 376
           N    +K G    P LAK      + +       F  E K DGER Q+H +  G ++  +
Sbjct: 264 NSDLSIKVGYIFAPQLAKRLMLSYDTISNRLNNDFFIEEKMDGERIQLHYMNYGETVKFF 323

Query: 377 SRNGENMTERYPELH----IRDYLADPETTHSLILDCEAVAWDTEQGKILPFQILSTRKR 432
           SR+G + T  Y        I  +L   +     +LD E V +D+   K+LPF ++ +   
Sbjct: 324 SRHGTDYTYLYGNDKSAGTIAKFLRLHKNVKECVLDGEMVTFDSTSKKVLPFGLVKSSAS 383

Query: 433 KGVEAKDV---KVRVCLFAFDMLCYNGQSLINNSLLERREYLQRVLKPVTGQFQFANELN 489
             +  KD+           FD+L  NG SLI+  L +R+E+L  VL P     +  + + 
Sbjct: 384 SQLNKKDIDNDSFHPLFMVFDILYLNGSSLIDLPLFKRKEFLNTVLTPYKDYVEILSSIR 443

Query: 490 SSNLEDVQKYLEQSVKDACEGLMVKVLEGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDL 549
            ++   ++K L+ ++    EG+   VL+   S Y P+ R  NW+K+K +YL+  G+++DL
Sbjct: 444 CTDSIQIKKGLDAAISVGSEGI---VLKQYISKYIPNARHNNWIKVKPEYLEEFGENMDL 500

Query: 550 CVL 552
            V+
Sbjct: 501 IVI 503

>KAFR0A05050 Chr1 (1003515..1006361) [2847 bp, 948 aa] {ON} Anc_6.18
           YOR005C
          Length = 948

 Score =  102 bits (254), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 76/255 (29%), Positives = 122/255 (47%), Gaps = 19/255 (7%)

Query: 307 NTCLEHGIMEVNKHCVLKPGIPLKPMLAKP-SKSITEVLDRFHGEKFTCEYKYDGERAQV 365
           N  L H  + +N       G    P LAK  S S  ++  +   + F  E K DGER Q+
Sbjct: 238 NIRLRHDELSIN------IGYAFAPHLAKKLSISYDKICKKLKND-FFIEEKMDGERIQI 290

Query: 366 HLLPDGS-MNIYSRNGENMTERYPEL----HIRDYLADPETTHSLILDCEAVAWDTEQGK 420
           H +  G+ +   SR G + T  Y E      I  YL         +LD E V +D +Q  
Sbjct: 291 HYMDYGNDIKFLSRRGVDYTYLYGENLSTGTIACYLKLNRDVKECVLDGEMVTYDEDQDI 350

Query: 421 ILPFQILSTRKRKGVEAKDVK---VRVCLFAFDMLCYNGQSLINNSLLERREYLQRVLKP 477
           +LPF ++ +     +  +++        L  FD++  NG SL+   L +R++YL  VL+P
Sbjct: 351 LLPFGMVKSAAMNALTKEEISGQDYHPLLMVFDLVFLNGSSLVEFPLYQRKDYLASVLEP 410

Query: 478 VTGQFQFANELNSSNLEDVQKYLEQSVKDACEGLMVKVLEGEESHYEPSKRSRNWLKLKK 537
              + Q  N    SN   ++K LE ++    EG+   VL+   S Y    R+ +W+K+K 
Sbjct: 411 YRARVQIVNFTRCSNENIIRKSLEHAISVGSEGI---VLKNYNSRYMIGSRNDSWIKIKP 467

Query: 538 DYLQGVGDSLDLCVL 552
           +YL+  G+++DL V+
Sbjct: 468 EYLEQFGENMDLIVI 482

>NCAS0D02650 Chr4 (508606..511458) [2853 bp, 950 aa] {ON} Anc_6.18
           YOR005C
          Length = 950

 Score =  101 bits (251), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 77/269 (28%), Positives = 126/269 (46%), Gaps = 13/269 (4%)

Query: 293 RDAFCQVPNYEIVINTCLEHGIMEVNKHCVLKPGIPLKPMLAKP-SKSITEVLDRFHGEK 351
           +D    V +   V     +  I   N   V+ PG    P LAK  S S  ++  +   + 
Sbjct: 226 QDYLSVVSDLRTVTTRLWDPEIRLQNNDLVINPGFAFAPQLAKKLSISYEKICMKLKND- 284

Query: 352 FTCEYKYDGERAQVHLLPDG-SMNIYSRNGENMTERYPE-LH---IRDYLADPETTHSLI 406
           F  E K DGER Q+H    G  +  +SR G + T  Y E +H   I  +L   +     I
Sbjct: 285 FIIEEKMDGERIQLHYQDYGEKLKFFSRRGTDYTYLYGESIHDGFIGKHLKLNKDVKDCI 344

Query: 407 LDCEAVAWDTEQGKILPFQILSTRKRKGVEAKDV---KVRVCLFAFDMLCYNGQSLINNS 463
           LD E + +D  Q  ILPF ++ +  R  +    +     +     FD++  NG SL N  
Sbjct: 345 LDGEMITYDKTQNMILPFGLVKSSARSMLTKDGIMNEGYQPLFMVFDLIFMNGTSLANIP 404

Query: 464 LLERREYLQRVLKPVTGQFQFANELNSSNLEDVQKYLEQSVKDACEGLMVKVLEGEESHY 523
           L  R+EYL  +  P     +  +  +  N + ++K LE ++    EG+   VL+  +S Y
Sbjct: 405 LNVRKEYLNGIFTPEPHIIELLSSYHRFNEDSIRKSLELAISMGSEGI---VLKRYDSRY 461

Query: 524 EPSKRSRNWLKLKKDYLQGVGDSLDLCVL 552
             + R+ +W+K+K +YL+  G+++DL V+
Sbjct: 462 TVASRNDDWIKVKPEYLEQFGENMDLIVI 490

>NDAI0I02260 Chr9 complement(514711..517614) [2904 bp, 967 aa] {ON}
           Anc_6.18 YOR005C
          Length = 967

 Score =  101 bits (251), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 76/270 (28%), Positives = 129/270 (47%), Gaps = 15/270 (5%)

Query: 293 RDAFCQVPNYEIVINTCLEHGIMEVNKHCVLKPGIPLKPMLAKP-SKSITEVLDRFHGEK 351
           +D    V + + V N   +  +   N    +  G P  P  AK  S S  ++  +   + 
Sbjct: 234 QDYLSVVSDLKTVANKLWDPAVHLKNDDLTINVGSPFAPQSAKKLSISYEKICAKLKHD- 292

Query: 352 FTCEYKYDGERAQVHLLPDGS-MNIYSRNGENMTERYPELHIRD-----YLADPETTHSL 405
           F  E K DGER Q+H    G+ ++  SR G + T  Y E  I+D     YL       + 
Sbjct: 293 FFIEEKMDGERIQLHYQDYGNKLSFLSRRGTDYTYLYGE-SIKDGTVSKYLHLDNNVQNC 351

Query: 406 ILDCEAVAWDTEQGKILPFQILSTRKRKGVEAKDVK---VRVCLFAFDMLCYNGQSLINN 462
           +LD E V +D E+  +LPF ++ +  R  +  + V     R  L  FD++  NG SL+N 
Sbjct: 352 VLDGEMVTFDKERNALLPFGLVKSSARSIITQEGVANEGYRPLLMVFDLVYLNGVSLVNI 411

Query: 463 SLLERREYLQRVLKPVTGQFQFANELNSSNLEDVQKYLEQSVKDACEGLMVKVLEGEESH 522
            L +R+ YL+++  P     +       S+   ++  LE ++    EG+   VL+   S 
Sbjct: 412 PLYQRKLYLEKIFTPERHIVELLRSKRCSDERSIKNALEHAISIGSEGV---VLKHYNSR 468

Query: 523 YEPSKRSRNWLKLKKDYLQGVGDSLDLCVL 552
           Y  + R+ +W+K+K +YL+  G+++DL V+
Sbjct: 469 YTVASRNDDWIKVKPEYLEQFGENMDLIVI 498

>Skud_15.166 Chr15 complement(294550..297393) [2844 bp, 947 aa] {ON}
           YOR005C (REAL)
          Length = 947

 Score =  100 bits (250), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 75/268 (27%), Positives = 122/268 (45%), Gaps = 11/268 (4%)

Query: 293 RDAFCQVPNYEIVINTCLEHGIMEVNKHCVLKPGIPLKPMLAKPSKSITEVLDRFHGEKF 352
           +D    V + ++V +   +  +   N    +K G    P LAK      E + R     F
Sbjct: 218 QDYLSVVSDLKVVTSKLYDPRVRLKNDDLSIKVGFAFAPQLAKKVSLPYEKICRALHNDF 277

Query: 353 TCEYKYDGERAQVHLLPDG-SMNIYSRNGENMTERY----PELHIRDYLADPETTHSLIL 407
             E K DGER QVH +  G S+  +SR G + T  Y        I  YL    T    +L
Sbjct: 278 LIEEKMDGERIQVHYMNYGKSIKFFSRRGIDYTYLYGASLSSGTISQYLKLTNTVKECVL 337

Query: 408 DCEAVAWDTEQGKILPFQILSTRKRKGVEAKDVK---VRVCLFAFDMLCYNGQSLINNSL 464
           D E V +D+ +  ILPF ++    +  +   D+     R     FD+L  N  SL    L
Sbjct: 338 DGEMVTFDSTRKVILPFGLVKGSAKGVLSCSDINNSDFRPLYMVFDLLYLNEISLAPLPL 397

Query: 465 LERREYLQRVLKPVTGQFQFANELNSSNLEDVQKYLEQSVKDACEGLMVKVLEGEESHYE 524
            +R++YL  +L P     +        +++ V+  LE ++    EG+++K      S Y 
Sbjct: 398 HQRKKYLSSILTPFKNVVEIVQSTRCYDVQSVKNSLEVAISLGSEGVVLKYYN---SSYN 454

Query: 525 PSKRSRNWLKLKKDYLQGVGDSLDLCVL 552
            + R+ NW+K+K +YL+  G++LDL ++
Sbjct: 455 IASRNYNWIKVKPEYLEEFGENLDLIII 482

>CAGL0E02695g Chr5 complement(254591..257431) [2841 bp, 946 aa] {ON}
           similar to uniprot|Q08387 Saccharomyces cerevisiae
           YOR005c DNL4 DNA ligase IV
          Length = 946

 Score =  100 bits (249), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 65/243 (26%), Positives = 121/243 (49%), Gaps = 11/243 (4%)

Query: 318 NKHCVLKPGIPLKPMLAKPSKSITEVLDRFHGEKFTCEYKYDGERAQVHLLPDGS-MNIY 376
           N+   +  G+   P LA       + +    G  F  E K DGER Q+H    GS +  Y
Sbjct: 258 NQDLKINIGLAFAPQLATKLHVSYQKIGEKLGWDFFIEEKMDGERIQMHYTNFGSDIKFY 317

Query: 377 SRNGENMTERYPELHIRDYLAD----PETTHSLILDCEAVAWDTEQGKILPFQILSTRKR 432
           SR   + T  Y        LA+     +     +LDCE V +D+    +LPF ++ +  +
Sbjct: 318 SRRATDYTYLYGNNLKTGTLANFINLNKNVKDCVLDCEVVTFDSNNKIVLPFGMVKSSAK 377

Query: 433 KGVEAKDVKVRV---CLFAFDMLCYNGQSLINNSLLERREYLQRVLKPVTGQFQFANELN 489
             +    +  +     L  FD+L  NG +L++    +RREYL+++L P   + +    + 
Sbjct: 378 NMLSQDGIDTQGFHPLLMVFDVLYLNGATLVDLPYYKRREYLKQILTPTAHRIEIIKSIR 437

Query: 490 SSNLEDVQKYLEQSVKDACEGLMVKVLEGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDL 549
           +++ + ++K LE+++    EG+   +L+  +S Y  + RS +W+K+K +YL+  G+++DL
Sbjct: 438 ANDEQMIKKSLEKALSVGSEGI---ILKRYDSRYVIASRSDDWIKIKPEYLEQFGENMDL 494

Query: 550 CVL 552
            ++
Sbjct: 495 VLM 497

>KLTH0C11286g Chr3 (926742..929597) [2856 bp, 951 aa] {ON} similar
           to uniprot|Q08387 Saccharomyces cerevisiae YOR005C DNL4
           DNA ligase required for nonhomologous end- joining
           (NHEJ) forms stable heterodimer with required cofactor
           Lif1p catalyzes DNA ligation as part of a complex with
           Lif1p and Nej1p involved in meiosis not essential for
           vegetative growth
          Length = 951

 Score = 97.1 bits (240), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 98/390 (25%), Positives = 165/390 (42%), Gaps = 47/390 (12%)

Query: 326 GIPLKPMLAKPSKSITEVLDRFHGEKFTCEYKYDGERAQVHLLPDGS-MNIYSRNGENMT 384
           G    P LAK      E +       F  E K DGER Q+H +  GS +   SR G + +
Sbjct: 262 GHAFAPHLAKRLHVSYERICSKLKHDFILEEKMDGERIQLHYVNGGSVLKFLSRRGIDFS 321

Query: 385 ERYPELHIR----DYLADPETTHSLILDCEAVAWDTEQGKILPFQILSTRK-----RKGV 435
             Y +   R     YL         +LD E V++D ++  ILPF I+ +          V
Sbjct: 322 HLYGQEVARGVISQYLKLKSDVRDCVLDGEMVSYDKKRKIILPFGIVKSAAVDELINSEV 381

Query: 436 EAKDVKVRVCLFAFDMLCYNGQSLINNSLLERREYLQRVLKPVTGQFQFANELNSSNLED 495
             ++   R     FD++  NG SL    L  R+EYL+ +L PV    +    + + + + 
Sbjct: 382 GNENDGYRPLYMVFDLVYLNGVSLTKVPLHIRKEYLKEILSPVPDVVEILKGIRACDAKA 441

Query: 496 VQKYLEQSVKDACEGLMVKVLEGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVLXXX 555
           ++ +++++++   EG++VK      S YE   R+ +W+K+K +Y + +G+++DL V+   
Sbjct: 442 IKNFMQRAIEMGSEGVIVK---QASSTYEVGARNDHWVKIKPEYFEDLGETMDLVVI--- 495

Query: 556 XXXXXXXXXXXXFLLGCYNQDT-------GEFE------------TCCKIGTGFSDEMLV 596
                        + G    D+       G  E            + C +  G SDE   
Sbjct: 496 ---GRDPGKKDSLMCGLLVSDSEHILENFGPIEHGKEGDPIIKCVSFCNVANGVSDEEFK 552

Query: 597 SLYEKLKPSSL---EQPKAFYVYD-SSAEPDVWFEP--TMLFEVLTADLSLSPIYKAGNS 650
            +  K + S +   E+P    + +  S  P  W +P  +++ EV    +  S   +  + 
Sbjct: 553 EINRKTRGSWVSYKEKPPPLSLLEFGSKIPVEWIDPKNSVVIEVKARSVENS---EYSSK 609

Query: 651 AYGKGISLRFPRFIRIRDDKDVEDATSSEQ 680
            Y  G +L      RIR+DKD    TS  Q
Sbjct: 610 RYRAGSTLHSAYCRRIRNDKDWTTCTSVAQ 639

>Kwal_56.22414 s56 complement(117198..120089) [2892 bp, 963 aa] {ON}
           YOR005C (DNL4) - ATP dependent DNA ligase [contig 185]
           FULL
          Length = 963

 Score = 95.5 bits (236), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 73/259 (28%), Positives = 127/259 (49%), Gaps = 14/259 (5%)

Query: 305 VINTCLEHGIMEVNKH-CVLKPGIPLKPMLAKPSKSITEVLDRFHGEKFTCEYKYDGERA 363
           V++  L +  M + K+   +  G    P LAK      E +     + F  E K DGER 
Sbjct: 254 VLSETLWNPTMRLGKNELSINIGRAFAPHLAKRLHLSYERVCAKLKQDFIIEEKMDGERI 313

Query: 364 QVHLLPDGS-MNIYSRNGENMTERYPEL--H--IRDYLADPETTHSLILDCEAVAWDTEQ 418
           Q+H +  G+ +   SR G + T  Y +   H  I  +L         +LD E V++D E+
Sbjct: 314 QLHYIERGAKIRFLSRRGTDFTHLYGDSLEHGVISQHLKFKNDVQDCVLDGEMVSFDKEK 373

Query: 419 GKILPFQILSTRKRKGVEAKDVKV-----RVCLFAFDMLCYNGQSLINNSLLERREYLQR 473
             +LPF I+ +   + +   D KV     R     FD++  NG SL    L  R+ YL+ 
Sbjct: 374 NVVLPFGIVKSTAMEELMNSDTKVDTDGYRPLYMIFDLVYLNGVSLTRLPLHLRKSYLRS 433

Query: 474 VLKPVTGQFQFANELNSSNLEDVQKYLEQSVKDACEGLMVKVLEGEESHYEPSKRSRNWL 533
           +L PV    +  +++ +S    ++  LE++++   EG+++K      S YE   R+ +W+
Sbjct: 434 ILSPVANIVEILSDVRASEPNAIKVSLERAIEMGSEGIILKQF---SSPYEIGARNDSWI 490

Query: 534 KLKKDYLQGVGDSLDLCVL 552
           K+K +Y + +G+++DL V+
Sbjct: 491 KIKPEYFEELGETMDLVVI 509

>Kpol_1032.7 s1032 complement(12295..15192) [2898 bp, 965 aa] {ON}
           complement(12295..15192) [2898 nt, 966 aa]
          Length = 965

 Score = 90.1 bits (222), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 61/209 (29%), Positives = 109/209 (52%), Gaps = 11/209 (5%)

Query: 352 FTCEYKYDGERAQVHLLPDGS-MNIYSRNGENMTERYPELH----IRDYLADPETTHSLI 406
           F  E K DGER Q+H +  G+ +   SR G + +  Y +      I  YL   +     I
Sbjct: 299 FFIEEKMDGERIQLHYMNYGAKLKFLSRRGLDYSYLYGDNRNNGAIGRYLNFHKDVKECI 358

Query: 407 LDCEAVAWDTEQGKILPFQILSTRKRKGVEAKDVK---VRVCLFAFDMLCYNGQSLINNS 463
           LD E V +D+ +  ILPF ++ +   + +   D++         AFD++  NG SL    
Sbjct: 359 LDGEMVTYDSVKNCILPFGLVKSSAMQSLSVSDIEPDGYHPLYMAFDLVYLNGSSLSTLP 418

Query: 464 LLERREYLQRVLKPVTGQFQFANELNSSNLEDVQKYLEQSVKDACEGLMVKVLEGEESHY 523
           L +R+ YL ++L P     +    L+ ++   ++  LE++++   EG+++K  +   S Y
Sbjct: 419 LHQRKNYLDKLLIPCPDFVEILPALHCNDSSLIKSSLEKAIELGSEGIILKRFD---SQY 475

Query: 524 EPSKRSRNWLKLKKDYLQGVGDSLDLCVL 552
             +KRS +W+K+K +YL+  G+++DL V+
Sbjct: 476 LVAKRSDDWIKIKPEYLEQFGENMDLIVI 504

>Smik_8.288 Chr8 complement(472376..473305) [930 bp, 309 aa] {ON}
           YHR199C (REAL)
          Length = 309

 Score = 35.4 bits (80), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 32/61 (52%)

Query: 266 LSKALLSYEHDGEEPSSELVENAEQRVRDAFCQVPNYEIVINTCLEHGIMEVNKHCVLKP 325
           L    LS      E SS LV++ ++++RDA        I+IN  L+ GI  ++K+  +K 
Sbjct: 134 LDSKFLSQAFIDTESSSSLVKSHQEKLRDALNDPAKAPILINNLLDSGIRLMSKNTPIKA 193

Query: 326 G 326
           G
Sbjct: 194 G 194

>CAGL0C01683g Chr3 (178695..182042) [3348 bp, 1115 aa] {ON} highly
           similar to uniprot|P38144 Saccharomyces cerevisiae
           YBR245c ISW1 and highly similar to uniprot|Q08773
           Saccharomyces cerevisiae YOR304w ISW2
          Length = 1115

 Score = 35.4 bits (80), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 35/127 (27%), Positives = 65/127 (51%), Gaps = 6/127 (4%)

Query: 168 SLQQVRAKYREIGDLGEVAQEARAVQPTMFKPKPLTVGEVFNNLKSIAKSQGKDSQTRKI 227
           +L+ VRA Y EI D  E  Q+   ++ ++   +PLT  E    LKS  +++G  + T+  
Sbjct: 811 TLEDVRATYGEIADEEEKKQKLELLKVSISNAEPLTEEE--EQLKSQWENEGFTNWTKTD 868

Query: 228 QLIKRMLTACQGVEAKFLIRSLESKLRIGLAEKTVLISLSKALLSYEH-DGEEPSSELVE 286
              ++ +TAC G   +  I+++  +L  G  E+ V    +    + E  D  E   +++E
Sbjct: 869 --FRKFITAC-GKYGRNSIQAITMELAPGKTEEEVRRYATAFWSNLERIDDYEKYLKMIE 925

Query: 287 NAEQRVR 293
           N E++V+
Sbjct: 926 NEEEKVK 932

>NCAS0A08660 Chr1 complement(1710032..1713205) [3174 bp, 1057 aa]
           {ON} Anc_2.662
          Length = 1057

 Score = 32.7 bits (73), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 41/83 (49%), Gaps = 9/83 (10%)

Query: 207 VFNNLKS-IAKSQGKDSQTRKIQLIKRMLTACQ------GVEAKFLIRSLESKLRIGLAE 259
           VFNN +  +  S+  DSQT+K +L  R++  C+      G +  F++R+    +      
Sbjct: 282 VFNNRQVFVVNSESADSQTKKFELTARLVCYCRHHDAANGFQILFVVRNTMGDVLAKTFT 341

Query: 260 KTVLISLSK--ALLSYEHDGEEP 280
            +++I+  K  +L S+     EP
Sbjct: 342 SSIMITDKKPSSLTSFPASNTEP 364

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.134    0.384 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 66,386,640
Number of extensions: 2680312
Number of successful extensions: 7882
Number of sequences better than 10.0: 44
Number of HSP's gapped: 8028
Number of HSP's successfully gapped: 46
Length of query: 693
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 576
Effective length of database: 40,065,477
Effective search space: 23077714752
Effective search space used: 23077714752
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 69 (31.2 bits)