Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0F07502g7.196ON41241221790.0
KLLA0D16214g7.196ON41839718140.0
Kwal_55.203687.196ON41240818100.0
KLTH0E04554g7.196ON47940717750.0
Kpol_1063.97.196ON41740617430.0
Skud_9.1477.196ON43140417330.0
Suva_9.1777.196ON43540417310.0
Smik_9.1687.196ON43140417300.0
TDEL0H025107.196ON41841017240.0
Ecym_43807.196ON41839717160.0
YIL022W (TIM44)7.196ON43140416880.0
ADL118C7.196ON41841916830.0
CAGL0J02442g7.196ON41240316680.0
TPHA0C045307.196ON41639416540.0
ZYRO0D15840g7.196ON40739516330.0
NDAI0B017807.196ON43438516000.0
NCAS0A125207.196ON43238715890.0
KNAG0H026907.196ON41938415860.0
KAFR0A026407.196ON42139815160.0
TBLA0J015007.196ON42141613470.0
TPHA0B027707.216ON480110820.13
TDEL0E051005.120ON49595732.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0F07502g
         (412 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0F07502g Chr6 complement(571758..572996) [1239 bp, 412 aa] {...   843   0.0  
KLLA0D16214g Chr4 complement(1364989..1366245) [1257 bp, 418 aa]...   703   0.0  
Kwal_55.20368 s55 (376673..377911) [1239 bp, 412 aa] {ON} YIL022...   701   0.0  
KLTH0E04554g Chr5 (412896..414335) [1440 bp, 479 aa] {ON} simila...   688   0.0  
Kpol_1063.9 s1063 (26537..27790) [1254 bp, 417 aa] {ON} (26537.....   676   0.0  
Skud_9.147 Chr9 (280791..282086) [1296 bp, 431 aa] {ON} YIL022W ...   672   0.0  
Suva_9.177 Chr9 (298403..299710) [1308 bp, 435 aa] {ON} YIL022W ...   671   0.0  
Smik_9.168 Chr9 (285754..287049) [1296 bp, 431 aa] {ON} YIL022W ...   671   0.0  
TDEL0H02510 Chr8 (423430..424686) [1257 bp, 418 aa] {ON} Anc_7.1...   668   0.0  
Ecym_4380 Chr4 (801356..802612) [1257 bp, 418 aa] {ON} similar t...   665   0.0  
YIL022W Chr9 (311165..312460) [1296 bp, 431 aa] {ON}  TIM44Essen...   654   0.0  
ADL118C Chr4 complement(478675..479931) [1257 bp, 418 aa] {ON} S...   652   0.0  
CAGL0J02442g Chr10 complement(236641..237879) [1239 bp, 412 aa] ...   647   0.0  
TPHA0C04530 Chr3 complement(975677..976927) [1251 bp, 416 aa] {O...   641   0.0  
ZYRO0D15840g Chr4 complement(1321497..1322720) [1224 bp, 407 aa]...   633   0.0  
NDAI0B01780 Chr2 complement(423642..424946) [1305 bp, 434 aa] {O...   620   0.0  
NCAS0A12520 Chr1 complement(2470598..2471896) [1299 bp, 432 aa] ...   616   0.0  
KNAG0H02690 Chr8 (497172..498431) [1260 bp, 419 aa] {ON} Anc_7.1...   615   0.0  
KAFR0A02640 Chr1 (547285..548550) [1266 bp, 421 aa] {ON} Anc_7.1...   588   0.0  
TBLA0J01500 Chr10 (342554..343819) [1266 bp, 421 aa] {ON} Anc_7....   523   0.0  
TPHA0B02770 Chr2 (631381..632823) [1443 bp, 480 aa] {ON} Anc_7.2...    36   0.13 
TDEL0E05100 Chr5 (940235..941722) [1488 bp, 495 aa] {ON} Anc_5.1...    33   2.0  

>SAKL0F07502g Chr6 complement(571758..572996) [1239 bp, 412 aa] {ON}
           highly similar to uniprot|Q01852 Saccharomyces
           cerevisiae YIL022W TIM44 48.8 kDa protein involved in
           mitochondrial protein import
          Length = 412

 Score =  843 bits (2179), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 412/412 (100%), Positives = 412/412 (100%)

Query: 1   MYRHSIKPQLVLASRRTISSTVRLPQGQRSPLQIFRETFKQEWEKSKELQDNIKTLQDAS 60
           MYRHSIKPQLVLASRRTISSTVRLPQGQRSPLQIFRETFKQEWEKSKELQDNIKTLQDAS
Sbjct: 1   MYRHSIKPQLVLASRRTISSTVRLPQGQRSPLQIFRETFKQEWEKSKELQDNIKTLQDAS 60

Query: 61  GKLGESDAYKKAREAYLRAQKGSTIVGKTLKKTGETVEDIAVKAWESELGKTTRKAMNAT 120
           GKLGESDAYKKAREAYLRAQKGSTIVGKTLKKTGETVEDIAVKAWESELGKTTRKAMNAT
Sbjct: 61  GKLGESDAYKKAREAYLRAQKGSTIVGKTLKKTGETVEDIAVKAWESELGKTTRKAMNAT 120

Query: 121 AQKIDESFEPVRQTKVYKDVSEVIDDGESSRYGGFITKEQRRLKKEQDLASGKRPKAVKS 180
           AQKIDESFEPVRQTKVYKDVSEVIDDGESSRYGGFITKEQRRLKKEQDLASGKRPKAVKS
Sbjct: 121 AQKIDESFEPVRQTKVYKDVSEVIDDGESSRYGGFITKEQRRLKKEQDLASGKRPKAVKS 180

Query: 181 NDEAGTALVATNIEAKESFSKKIEDFKEKTPTGRKIHEMKVRLWDESENPLIVLLRTIGN 240
           NDEAGTALVATNIEAKESFSKKIEDFKEKTPTGRKIHEMKVRLWDESENPLIVLLRTIGN
Sbjct: 181 NDEAGTALVATNIEAKESFSKKIEDFKEKTPTGRKIHEMKVRLWDESENPLIVLLRTIGN 240

Query: 241 KVGGIFAETESARVMGQFKMLDPNFNTESFTKHLREYIIPEILEAYVKGDEAVLKQWFSE 300
           KVGGIFAETESARVMGQFKMLDPNFNTESFTKHLREYIIPEILEAYVKGDEAVLKQWFSE
Sbjct: 241 KVGGIFAETESARVMGQFKMLDPNFNTESFTKHLREYIIPEILEAYVKGDEAVLKQWFSE 300

Query: 301 APYNVYAAQQKAFRDQELFADGRILDIRGVEIVSAKLLAPQDIPVLVVGCRAQEIHLYRK 360
           APYNVYAAQQKAFRDQELFADGRILDIRGVEIVSAKLLAPQDIPVLVVGCRAQEIHLYRK
Sbjct: 301 APYNVYAAQQKAFRDQELFADGRILDIRGVEIVSAKLLAPQDIPVLVVGCRAQEIHLYRK 360

Query: 361 AKTGEIAAGTESNILLSSYAMVFTRDPENVDDKETEGWRILEFVRGGSRQFT 412
           AKTGEIAAGTESNILLSSYAMVFTRDPENVDDKETEGWRILEFVRGGSRQFT
Sbjct: 361 AKTGEIAAGTESNILLSSYAMVFTRDPENVDDKETEGWRILEFVRGGSRQFT 412

>KLLA0D16214g Chr4 complement(1364989..1366245) [1257 bp, 418 aa]
           {ON} highly similar to uniprot|Q01852 Saccharomyces
           cerevisiae YIL022W TIM44 48.8 kDa protein involved in
           mitochondrial protein import
          Length = 418

 Score =  703 bits (1814), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/397 (84%), Positives = 366/397 (92%)

Query: 16  RTISSTVRLPQGQRSPLQIFRETFKQEWEKSKELQDNIKTLQDASGKLGESDAYKKAREA 75
           RT + + +     RSPLQIFRETFKQEWEKSKELQDNIK LQDASGKLGES+AYKKAREA
Sbjct: 22  RTFTVSAKAMSNPRSPLQIFRETFKQEWEKSKELQDNIKALQDASGKLGESEAYKKAREA 81

Query: 76  YLRAQKGSTIVGKTLKKTGETVEDIAVKAWESELGKTTRKAMNATAQKIDESFEPVRQTK 135
           Y++AQKGSTIVGKTLKKTGETVE IA KAW+SE+ K+TRK +N TA K+DESFEPVR+TK
Sbjct: 82  YVKAQKGSTIVGKTLKKTGETVETIASKAWDSEIAKSTRKVVNKTADKLDESFEPVRKTK 141

Query: 136 VYKDVSEVIDDGESSRYGGFITKEQRRLKKEQDLASGKRPKAVKSNDEAGTALVATNIEA 195
           VYKDVSEVIDDG+SSRYGGFITKEQRRL KE+ +ASGKR +AVKSND AGTALVATNIE+
Sbjct: 142 VYKDVSEVIDDGDSSRYGGFITKEQRRLMKEEAIASGKRSRAVKSNDAAGTALVATNIES 201

Query: 196 KESFSKKIEDFKEKTPTGRKIHEMKVRLWDESENPLIVLLRTIGNKVGGIFAETESARVM 255
           KESF KKIEDFKEKTP GRK+HE K++LWDESENPL+V+LRT+  K+GG+FAETESARV 
Sbjct: 202 KESFGKKIEDFKEKTPVGRKLHEYKIKLWDESENPLVVMLRTVSGKIGGLFAETESARVY 261

Query: 256 GQFKMLDPNFNTESFTKHLREYIIPEILEAYVKGDEAVLKQWFSEAPYNVYAAQQKAFRD 315
           GQFKM+DP FNTE FTKHLREYIIPEILEAYVKGDEAVLKQWFSEAPYNVYAAQQK FR+
Sbjct: 262 GQFKMMDPTFNTEDFTKHLREYIIPEILEAYVKGDEAVLKQWFSEAPYNVYAAQQKQFRE 321

Query: 316 QELFADGRILDIRGVEIVSAKLLAPQDIPVLVVGCRAQEIHLYRKAKTGEIAAGTESNIL 375
           QELFADG+ILDIRGVEIVSAKLL PQDIPVLVVGCRAQEIHLYRKAKTGEIAAG ES+IL
Sbjct: 322 QELFADGKILDIRGVEIVSAKLLPPQDIPVLVVGCRAQEIHLYRKAKTGEIAAGAESSIL 381

Query: 376 LSSYAMVFTRDPENVDDKETEGWRILEFVRGGSRQFT 412
           +SSYAMVFTRDPE VDDKETEGW+ILEFVRGGSRQFT
Sbjct: 382 MSSYAMVFTRDPETVDDKETEGWKILEFVRGGSRQFT 418

>Kwal_55.20368 s55 (376673..377911) [1239 bp, 412 aa] {ON} YIL022W
           (TIM44) - 48.8 kDa protein involved in mitochondrial
           protein import [contig 149] FULL
          Length = 412

 Score =  701 bits (1810), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/408 (81%), Positives = 374/408 (91%), Gaps = 1/408 (0%)

Query: 6   IKPQLVLASRRTISSTVRLPQGQ-RSPLQIFRETFKQEWEKSKELQDNIKTLQDASGKLG 64
           ++P   +   R +S T+R  QG  RSPLQIFRETFKQEW+KS+ELQDNIK LQDASGKLG
Sbjct: 5   VRPVGNVVFSRKLSQTIRACQGNPRSPLQIFRETFKQEWKKSQELQDNIKALQDASGKLG 64

Query: 65  ESDAYKKAREAYLRAQKGSTIVGKTLKKTGETVEDIAVKAWESELGKTTRKAMNATAQKI 124
           ESDAYKKAREAYL+AQKGSTIVGKT+KKTG++VE IA KAWESE+ K+TRKA+N TA K+
Sbjct: 65  ESDAYKKAREAYLKAQKGSTIVGKTMKKTGDSVERIAAKAWESEISKSTRKAVNKTAAKL 124

Query: 125 DESFEPVRQTKVYKDVSEVIDDGESSRYGGFITKEQRRLKKEQDLASGKRPKAVKSNDEA 184
           DESFEPVR T+VYKDVSEV++ G SSRYGGFITKEQRRLK EQD+ASGKRPKAV+SNDEA
Sbjct: 125 DESFEPVRHTRVYKDVSEVMESGNSSRYGGFITKEQRRLKLEQDIASGKRPKAVRSNDEA 184

Query: 185 GTALVATNIEAKESFSKKIEDFKEKTPTGRKIHEMKVRLWDESENPLIVLLRTIGNKVGG 244
           GTALVATNIEAKESF KK++DFKEKT  GRK+H+ KV+LWDESENPLIVLLRTIGNK+GG
Sbjct: 185 GTALVATNIEAKESFGKKVDDFKEKTVVGRKLHDFKVKLWDESENPLIVLLRTIGNKIGG 244

Query: 245 IFAETESARVMGQFKMLDPNFNTESFTKHLREYIIPEILEAYVKGDEAVLKQWFSEAPYN 304
           +FAETESARVMGQFKM+D NFN+ESF  HLREYIIPE+LEAYVKGDE VLKQWFSEAPYN
Sbjct: 245 LFAETESARVMGQFKMMDGNFNSESFLSHLREYIIPEVLEAYVKGDEKVLKQWFSEAPYN 304

Query: 305 VYAAQQKAFRDQELFADGRILDIRGVEIVSAKLLAPQDIPVLVVGCRAQEIHLYRKAKTG 364
           VYAAQQK FR+Q LFADGRILDIRGV+IVSAKLLAPQD+PVLVVGCRAQEIHLYR  KTG
Sbjct: 305 VYAAQQKVFREQGLFADGRILDIRGVDIVSAKLLAPQDLPVLVVGCRAQEIHLYRDVKTG 364

Query: 365 EIAAGTESNILLSSYAMVFTRDPENVDDKETEGWRILEFVRGGSRQFT 412
           E+AAGT+SNIL+SSYAMVFTRDPE++D+KETEGW+ILEFVRGGSRQFT
Sbjct: 365 EVAAGTQSNILMSSYAMVFTRDPEDIDNKETEGWKILEFVRGGSRQFT 412

>KLTH0E04554g Chr5 (412896..414335) [1440 bp, 479 aa] {ON} similar
           to uniprot|Q01852 Saccharomyces cerevisiae YIL022W TIM44
           48.8 kDa protein involved in mitochondrial protein
           import
          Length = 479

 Score =  688 bits (1775), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/407 (80%), Positives = 369/407 (90%), Gaps = 1/407 (0%)

Query: 7   KPQLVLASRRTISSTVRLPQGQ-RSPLQIFRETFKQEWEKSKELQDNIKTLQDASGKLGE 65
           +P   +  RR ++ T +  QG  RSPLQIFRETFKQEW+KS+ELQDNIK LQDASGK+GE
Sbjct: 73  RPLKSVVIRRNLAQTFKACQGNPRSPLQIFRETFKQEWKKSQELQDNIKALQDASGKIGE 132

Query: 66  SDAYKKAREAYLRAQKGSTIVGKTLKKTGETVEDIAVKAWESELGKTTRKAMNATAQKID 125
           S+AYKKAREAYL AQKGSTIVGKTLKKTG++VE IA KAWESE+GK+TR+A+N TA K+D
Sbjct: 133 SEAYKKAREAYLSAQKGSTIVGKTLKKTGDSVEKIAAKAWESEIGKSTRQAVNKTAAKLD 192

Query: 126 ESFEPVRQTKVYKDVSEVIDDGESSRYGGFITKEQRRLKKEQDLASGKRPKAVKSNDEAG 185
           ESFEPVR T+VYKDVSEV+D   SSRYGGFI+KEQRRLK EQD+ASGKRPKAVKSN+EAG
Sbjct: 193 ESFEPVRHTRVYKDVSEVMDSSNSSRYGGFISKEQRRLKLEQDIASGKRPKAVKSNEEAG 252

Query: 186 TALVATNIEAKESFSKKIEDFKEKTPTGRKIHEMKVRLWDESENPLIVLLRTIGNKVGGI 245
           TALVAT IEAKESF KK++DFKEKT  GRK+ ++K +LWDESENPLIVL+RTIGNKVGG+
Sbjct: 253 TALVATEIEAKESFGKKVDDFKEKTVVGRKLQDVKQKLWDESENPLIVLMRTIGNKVGGL 312

Query: 246 FAETESARVMGQFKMLDPNFNTESFTKHLREYIIPEILEAYVKGDEAVLKQWFSEAPYNV 305
           FAETESARVMGQFKM+D NFN+ESF  HLREYIIPE+LEAYVKG+E VLKQWFSEAPYNV
Sbjct: 313 FAETESARVMGQFKMMDGNFNSESFLSHLREYIIPEVLEAYVKGEEQVLKQWFSEAPYNV 372

Query: 306 YAAQQKAFRDQELFADGRILDIRGVEIVSAKLLAPQDIPVLVVGCRAQEIHLYRKAKTGE 365
           YAAQQK FR+Q LFADGRILDIRGV+IVSAKLL PQD+PVLVVGCRAQEIHLYR  KTGE
Sbjct: 373 YAAQQKVFREQGLFADGRILDIRGVDIVSAKLLPPQDLPVLVVGCRAQEIHLYRDVKTGE 432

Query: 366 IAAGTESNILLSSYAMVFTRDPENVDDKETEGWRILEFVRGGSRQFT 412
           +AAGT+SNIL+SSYAMVFTRDPEN+DDKETEGW+ILEFVRGGSRQFT
Sbjct: 433 VAAGTQSNILMSSYAMVFTRDPENIDDKETEGWKILEFVRGGSRQFT 479

>Kpol_1063.9 s1063 (26537..27790) [1254 bp, 417 aa] {ON}
           (26537..27790) [1254 nt, 418 aa]
          Length = 417

 Score =  676 bits (1743), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/406 (79%), Positives = 368/406 (90%), Gaps = 1/406 (0%)

Query: 8   PQLVLA-SRRTISSTVRLPQGQRSPLQIFRETFKQEWEKSKELQDNIKTLQDASGKLGES 66
           P+L+ + S    S++ R+ QG R+P+QIFR+TFK+EWEKSK+LQDNIK LQDASG+LGES
Sbjct: 12  PKLLCSGSIHLFSTSSRVLQGPRTPIQIFRDTFKKEWEKSKDLQDNIKALQDASGRLGES 71

Query: 67  DAYKKAREAYLRAQKGSTIVGKTLKKTGETVEDIAVKAWESELGKTTRKAMNATAQKIDE 126
           +AYKKAREAYL+AQKGSTIVGKTL+KTGETVEDIA KAW+SE+GK+TRKA +ATA+KIDE
Sbjct: 72  EAYKKAREAYLKAQKGSTIVGKTLQKTGETVEDIASKAWDSEIGKSTRKAASATARKIDE 131

Query: 127 SFEPVRQTKVYKDVSEVIDDGESSRYGGFITKEQRRLKKEQDLASGKRPKAVKSNDEAGT 186
           SFEPVR+T+VYKDVS+VIDDG+SSRYGGFI KEQRRLK+E DL SGKR +AVKSNDEAGT
Sbjct: 132 SFEPVRKTQVYKDVSDVIDDGDSSRYGGFIGKEQRRLKRESDLVSGKRVRAVKSNDEAGT 191

Query: 187 ALVATNIEAKESFSKKIEDFKEKTPTGRKIHEMKVRLWDESENPLIVLLRTIGNKVGGIF 246
           ++VATNIEAKES  KK+EDFKE T  GR IH +KV+LWDE+ENPLIV LR +  K+GG F
Sbjct: 192 SIVATNIEAKESLGKKMEDFKENTTAGRTIHGVKVKLWDENENPLIVFLRKVSGKIGGFF 251

Query: 247 AETESARVMGQFKMLDPNFNTESFTKHLREYIIPEILEAYVKGDEAVLKQWFSEAPYNVY 306
           AETES+RV+ QFK++DP F+ +SFTKHLREYIIPE+LEAYVKGDEAVLK+WFSEAPYNVY
Sbjct: 252 AETESSRVLSQFKLMDPTFSNDSFTKHLREYIIPEVLEAYVKGDEAVLKKWFSEAPYNVY 311

Query: 307 AAQQKAFRDQELFADGRILDIRGVEIVSAKLLAPQDIPVLVVGCRAQEIHLYRKAKTGEI 366
           AAQQK FR Q+LF DGRILDIRGVEIVSAKLLAPQDIPVLVVGCRAQEIHLYRK KTGEI
Sbjct: 312 AAQQKEFRKQQLFPDGRILDIRGVEIVSAKLLAPQDIPVLVVGCRAQEIHLYRKVKTGEI 371

Query: 367 AAGTESNILLSSYAMVFTRDPENVDDKETEGWRILEFVRGGSRQFT 412
           AAG ESNIL+SSYAMVFTRDPE +DD ETEGW+ILEFVRGGSRQFT
Sbjct: 372 AAGDESNILMSSYAMVFTRDPEQIDDDETEGWKILEFVRGGSRQFT 417

>Skud_9.147 Chr9 (280791..282086) [1296 bp, 431 aa] {ON} YIL022W
           (REAL)
          Length = 431

 Score =  672 bits (1733), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/404 (79%), Positives = 366/404 (90%), Gaps = 2/404 (0%)

Query: 11  VLASRRTISSTVRLPQG--QRSPLQIFRETFKQEWEKSKELQDNIKTLQDASGKLGESDA 68
           +L +R   S++    QG   RSPLQIFR+TFK+EWEKS+ELQ+NIKTLQDASGKLGES+A
Sbjct: 28  LLVARVLFSTSATRAQGGNPRSPLQIFRDTFKKEWEKSQELQENIKTLQDASGKLGESEA 87

Query: 69  YKKAREAYLRAQKGSTIVGKTLKKTGETVEDIAVKAWESELGKTTRKAMNATAQKIDESF 128
           YKKAREAYLRAQ+GSTIVGKTLKKTGET+E IA KAWESELGK TRKA +ATA+++DESF
Sbjct: 88  YKKAREAYLRAQRGSTIVGKTLKKTGETMEHIATKAWESELGKNTRKAASATAKRLDESF 147

Query: 129 EPVRQTKVYKDVSEVIDDGESSRYGGFITKEQRRLKKEQDLASGKRPKAVKSNDEAGTAL 188
           EPVRQTK+YK+VSEVIDDGESSRYGGFITKEQRRLK+E+DLASGKR +AVKSNDEAGTA+
Sbjct: 148 EPVRQTKIYKEVSEVIDDGESSRYGGFITKEQRRLKREKDLASGKRHRAVKSNDEAGTAV 207

Query: 189 VATNIEAKESFSKKIEDFKEKTPTGRKIHEMKVRLWDESENPLIVLLRTIGNKVGGIFAE 248
           VATNIE+KESF KK+EDF+EKT  GR I  +K RLWDESENPLIV++R + NKVGG FAE
Sbjct: 208 VATNIESKESFGKKVEDFREKTAMGRSIQSLKNRLWDESENPLIVIMRKVTNKVGGFFAE 267

Query: 249 TESARVMGQFKMLDPNFNTESFTKHLREYIIPEILEAYVKGDEAVLKQWFSEAPYNVYAA 308
           TES+RV  QFK++DP F+ ESFT+HLR+YI+PEILEAYVK D  VLK+WFSEAPYNVYAA
Sbjct: 268 TESSRVHSQFKLMDPTFSNESFTRHLRDYIVPEILEAYVKADVKVLKKWFSEAPYNVYAA 327

Query: 309 QQKAFRDQELFADGRILDIRGVEIVSAKLLAPQDIPVLVVGCRAQEIHLYRKAKTGEIAA 368
           QQK FR+Q+++ADGRILDIRGVEIVSAKLLAPQDIPVLVVGCRAQEI+LYRK KTGEIAA
Sbjct: 328 QQKIFREQDVYADGRILDIRGVEIVSAKLLAPQDIPVLVVGCRAQEINLYRKRKTGEIAA 387

Query: 369 GTESNILLSSYAMVFTRDPENVDDKETEGWRILEFVRGGSRQFT 412
           G E+NIL+SSYAMVFTRDPE +DD ETEGW+ILEFVRGGSRQFT
Sbjct: 388 GNEANILMSSYAMVFTRDPEQIDDDETEGWKILEFVRGGSRQFT 431

>Suva_9.177 Chr9 (298403..299710) [1308 bp, 435 aa] {ON} YIL022W
           (REAL)
          Length = 435

 Score =  671 bits (1731), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/404 (79%), Positives = 367/404 (90%), Gaps = 2/404 (0%)

Query: 11  VLASRRTISSTVRLPQG--QRSPLQIFRETFKQEWEKSKELQDNIKTLQDASGKLGESDA 68
           +L +R   S++    QG   RSPLQIFR+TFK+EW+KS+ELQ+NIKTLQDASGKLGES+A
Sbjct: 32  LLIARALFSTSATRAQGGNPRSPLQIFRDTFKKEWDKSQELQENIKTLQDASGKLGESEA 91

Query: 69  YKKAREAYLRAQKGSTIVGKTLKKTGETVEDIAVKAWESELGKTTRKAMNATAQKIDESF 128
           YKKAREAYLRAQ+GSTIVGKTLKKTGETVE IA +AW+SELGK TRKA +ATA+K+DESF
Sbjct: 92  YKKAREAYLRAQRGSTIVGKTLKKTGETVEHIATRAWDSELGKNTRKAASATAKKLDESF 151

Query: 129 EPVRQTKVYKDVSEVIDDGESSRYGGFITKEQRRLKKEQDLASGKRPKAVKSNDEAGTAL 188
           EPVRQTK+YK+VSEVIDDGESSRYGGFITKEQRRLK+E+DLASGKR +AVKSNDEAGTA+
Sbjct: 152 EPVRQTKIYKEVSEVIDDGESSRYGGFITKEQRRLKREKDLASGKRHRAVKSNDEAGTAV 211

Query: 189 VATNIEAKESFSKKIEDFKEKTPTGRKIHEMKVRLWDESENPLIVLLRTIGNKVGGIFAE 248
           VATNIE+KESF KK+EDFKEKT  GR I  +K RLWDESENPLIV++R + NKVGG FAE
Sbjct: 212 VATNIESKESFGKKVEDFKEKTAVGRSIQSLKNRLWDESENPLIVIMRKVTNKVGGFFAE 271

Query: 249 TESARVMGQFKMLDPNFNTESFTKHLREYIIPEILEAYVKGDEAVLKQWFSEAPYNVYAA 308
           TES+RV  QFKM+DP F+ E+FT+HLREYI+PEILEAYVKGD  VLK+WFSEAP+NVYAA
Sbjct: 272 TESSRVYSQFKMMDPTFSNENFTRHLREYIVPEILEAYVKGDVKVLKKWFSEAPFNVYAA 331

Query: 309 QQKAFRDQELFADGRILDIRGVEIVSAKLLAPQDIPVLVVGCRAQEIHLYRKAKTGEIAA 368
           QQK F++Q++FADGRILDIRGVEIVSAKLLAPQDIPVLVVGCRAQEI+LYRK KTGEIAA
Sbjct: 332 QQKIFKEQDVFADGRILDIRGVEIVSAKLLAPQDIPVLVVGCRAQEINLYRKRKTGEIAA 391

Query: 369 GTESNILLSSYAMVFTRDPENVDDKETEGWRILEFVRGGSRQFT 412
           G E+NIL+SSYAMVFTRDPE +DD ETEGW+ILEFVRGGSRQFT
Sbjct: 392 GDEANILMSSYAMVFTRDPEQIDDDETEGWKILEFVRGGSRQFT 435

>Smik_9.168 Chr9 (285754..287049) [1296 bp, 431 aa] {ON} YIL022W
           (REAL)
          Length = 431

 Score =  671 bits (1730), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/404 (79%), Positives = 367/404 (90%), Gaps = 2/404 (0%)

Query: 11  VLASRRTISSTVRLPQG--QRSPLQIFRETFKQEWEKSKELQDNIKTLQDASGKLGESDA 68
           ++ +R   S++    QG   RSPLQIFR+TFK+EWEKS+ELQ+NIKTLQDASGKLGES+A
Sbjct: 28  LMIARVLFSTSATRTQGGNPRSPLQIFRDTFKKEWEKSQELQENIKTLQDASGKLGESEA 87

Query: 69  YKKAREAYLRAQKGSTIVGKTLKKTGETVEDIAVKAWESELGKTTRKAMNATAQKIDESF 128
           YKKAREAYL+AQ+GSTIVGKTLKKTGET+E IA KAWESELGK TRKA +ATA+K+DESF
Sbjct: 88  YKKAREAYLKAQRGSTIVGKTLKKTGETMEHIATKAWESELGKNTRKAASATAKKLDESF 147

Query: 129 EPVRQTKVYKDVSEVIDDGESSRYGGFITKEQRRLKKEQDLASGKRPKAVKSNDEAGTAL 188
           EPVRQTK+YK+VSEVIDDGESSRYGGFITKEQRRLK+E+DLASGKR +AVKSNDEAGTA+
Sbjct: 148 EPVRQTKIYKEVSEVIDDGESSRYGGFITKEQRRLKREKDLASGKRHRAVKSNDEAGTAV 207

Query: 189 VATNIEAKESFSKKIEDFKEKTPTGRKIHEMKVRLWDESENPLIVLLRTIGNKVGGIFAE 248
           VATNIE+KESF KK+EDFKEKT  GR I  +K +LWDESENPLIV++R I NKVGG FAE
Sbjct: 208 VATNIESKESFGKKVEDFKEKTVVGRSIQSLKNKLWDESENPLIVVMRKITNKVGGFFAE 267

Query: 249 TESARVMGQFKMLDPNFNTESFTKHLREYIIPEILEAYVKGDEAVLKQWFSEAPYNVYAA 308
           TES+RV  QFKM+DP F+ ESFT+HLREYI+PEILEAYVKGD  VLK+WFSEAP+NVYAA
Sbjct: 268 TESSRVYSQFKMMDPTFSNESFTRHLREYIVPEILEAYVKGDVKVLKKWFSEAPFNVYAA 327

Query: 309 QQKAFRDQELFADGRILDIRGVEIVSAKLLAPQDIPVLVVGCRAQEIHLYRKAKTGEIAA 368
           QQK F++Q+++ADGRILDIRGVE+VSAKLLAPQDIPVLVVGCRAQEI+LYRK KTGEIAA
Sbjct: 328 QQKIFKEQDVYADGRILDIRGVEVVSAKLLAPQDIPVLVVGCRAQEINLYRKKKTGEIAA 387

Query: 369 GTESNILLSSYAMVFTRDPENVDDKETEGWRILEFVRGGSRQFT 412
           G E+NIL+SSYAMVFTRDPE +DD ETEGW+ILEFVRGGSRQFT
Sbjct: 388 GDEANILMSSYAMVFTRDPEQIDDDETEGWKILEFVRGGSRQFT 431

>TDEL0H02510 Chr8 (423430..424686) [1257 bp, 418 aa] {ON} Anc_7.196
           YIL022W
          Length = 418

 Score =  668 bits (1724), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/410 (77%), Positives = 365/410 (89%)

Query: 3   RHSIKPQLVLASRRTISSTVRLPQGQRSPLQIFRETFKQEWEKSKELQDNIKTLQDASGK 62
           R S+  +  LA R   S++    Q  RSP+QIFR+TFK+EW+KS+ELQDNIKTLQDASG+
Sbjct: 9   RSSVIAEGRLAGRALFSTSSGSLQNPRSPVQIFRDTFKKEWKKSQELQDNIKTLQDASGR 68

Query: 63  LGESDAYKKAREAYLRAQKGSTIVGKTLKKTGETVEDIAVKAWESELGKTTRKAMNATAQ 122
           LGES+AYK+AREAY+RAQKGSTIVGKTLKKTGETVE+IA KAW+SE+ + TR+A + TA+
Sbjct: 69  LGESEAYKRAREAYVRAQKGSTIVGKTLKKTGETVENIASKAWDSEIARNTREAASKTAK 128

Query: 123 KIDESFEPVRQTKVYKDVSEVIDDGESSRYGGFITKEQRRLKKEQDLASGKRPKAVKSND 182
           KIDE FEPVRQTK+YKDVSEV+DDG SSRYGGFITKEQRRLK+EQD+ SGKR KAVK N+
Sbjct: 129 KIDEGFEPVRQTKIYKDVSEVMDDGNSSRYGGFITKEQRRLKREQDMLSGKRAKAVKGNE 188

Query: 183 EAGTALVATNIEAKESFSKKIEDFKEKTPTGRKIHEMKVRLWDESENPLIVLLRTIGNKV 242
           +AGTALVAT+IEAK+SF KK+EDFKEKT  GR +H +K  LWDES NPLIV LR I  K+
Sbjct: 189 DAGTALVATDIEAKQSFGKKVEDFKEKTVLGRTLHRLKNSLWDESVNPLIVFLRKITRKI 248

Query: 243 GGIFAETESARVMGQFKMLDPNFNTESFTKHLREYIIPEILEAYVKGDEAVLKQWFSEAP 302
           GG FAETE+ARV+GQFKM+DP F  ESFT+HLREY+IPEILEAYVKGDE VLK+WFSEAP
Sbjct: 249 GGFFAETEAARVLGQFKMMDPTFTNESFTRHLREYVIPEILEAYVKGDEKVLKKWFSEAP 308

Query: 303 YNVYAAQQKAFRDQELFADGRILDIRGVEIVSAKLLAPQDIPVLVVGCRAQEIHLYRKAK 362
           YNVYAAQQKAFR+Q+LFADG+ILDIRGVEIVSAK+L PQDIPVLVVGCRAQEIHLYRKAK
Sbjct: 309 YNVYAAQQKAFREQQLFADGKILDIRGVEIVSAKMLPPQDIPVLVVGCRAQEIHLYRKAK 368

Query: 363 TGEIAAGTESNILLSSYAMVFTRDPENVDDKETEGWRILEFVRGGSRQFT 412
           TGE+AAG ESNI++SSYAMVFTRDPE +DD+ETEGWRILEFVRGGSRQFT
Sbjct: 369 TGEVAAGHESNIMMSSYAMVFTRDPEQIDDEETEGWRILEFVRGGSRQFT 418

>Ecym_4380 Chr4 (801356..802612) [1257 bp, 418 aa] {ON} similar to
           Ashbya gossypii ADL118C
          Length = 418

 Score =  665 bits (1716), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/397 (78%), Positives = 355/397 (89%)

Query: 16  RTISSTVRLPQGQRSPLQIFRETFKQEWEKSKELQDNIKTLQDASGKLGESDAYKKAREA 75
           R  S+T     GQ+SPLQIFRETFK EW+KS+ELQDNIK LQDASG+LGESDAYKKAREA
Sbjct: 22  RQFSTTGLSWNGQKSPLQIFRETFKDEWKKSQELQDNIKALQDASGRLGESDAYKKAREA 81

Query: 76  YLRAQKGSTIVGKTLKKTGETVEDIAVKAWESELGKTTRKAMNATAQKIDESFEPVRQTK 135
           YL+AQ+GST+VGKTLKKTGET+E++ VKAW+S++GK TR+ ++ TAQK+DESFEPVR T+
Sbjct: 82  YLKAQRGSTVVGKTLKKTGETIENLTVKAWDSDIGKNTREVVSKTAQKLDESFEPVRHTR 141

Query: 136 VYKDVSEVIDDGESSRYGGFITKEQRRLKKEQDLASGKRPKAVKSNDEAGTALVATNIEA 195
           VYKD+SE+IDDGESSRYGGFI KE RR K+E DLASG+R  AV+SNDEAGTA+VATN E 
Sbjct: 142 VYKDMSELIDDGESSRYGGFIAKETRRQKREHDLASGRRTHAVRSNDEAGTAMVATNKEG 201

Query: 196 KESFSKKIEDFKEKTPTGRKIHEMKVRLWDESENPLIVLLRTIGNKVGGIFAETESARVM 255
           KESF KKI+DFKEKT  GRK+HE KV+LWDE+ENPLI +LRTI NK+GG+FAETESARV 
Sbjct: 202 KESFGKKIQDFKEKTFIGRKLHESKVKLWDENENPLISMLRTISNKIGGLFAETESARVF 261

Query: 256 GQFKMLDPNFNTESFTKHLREYIIPEILEAYVKGDEAVLKQWFSEAPYNVYAAQQKAFRD 315
            QFK+LDP FN+E FTKHLREYIIPE+LEAYVKGDE VLKQW SEAPYNVYAAQQK FR+
Sbjct: 262 AQFKLLDPTFNSEEFTKHLREYIIPEVLEAYVKGDEVVLKQWLSEAPYNVYAAQQKQFRE 321

Query: 316 QELFADGRILDIRGVEIVSAKLLAPQDIPVLVVGCRAQEIHLYRKAKTGEIAAGTESNIL 375
           QELF DGR+LDIRGVEIVSAKLL PQD+P LVVGCR QEIHLYRKAKTGEIAAG ESNI+
Sbjct: 322 QELFPDGRVLDIRGVEIVSAKLLPPQDVPALVVGCRVQEIHLYRKAKTGEIAAGHESNIM 381

Query: 376 LSSYAMVFTRDPENVDDKETEGWRILEFVRGGSRQFT 412
           +SSYAMV TRDPENV DKETEGW++LEF+RGGSRQFT
Sbjct: 382 MSSYAMVLTRDPENVTDKETEGWKVLEFIRGGSRQFT 418

>YIL022W Chr9 (311165..312460) [1296 bp, 431 aa] {ON}
           TIM44Essential component of the Translocase of the Inner
           Mitochondrial membrane (TIM23 complex); tethers the
           import motor and regulatory factors (PAM complex) to the
           translocation channel (Tim23p-Tim17p core complex)
          Length = 431

 Score =  654 bits (1688), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/404 (79%), Positives = 366/404 (90%), Gaps = 2/404 (0%)

Query: 11  VLASRRTISSTVRLPQG--QRSPLQIFRETFKQEWEKSKELQDNIKTLQDASGKLGESDA 68
           +L +R   S++    QG   RSPLQIFR+TFK+EWEKS+ELQ+NIKTLQDASGKLGES+A
Sbjct: 28  LLVARVLFSTSTTRAQGGNPRSPLQIFRDTFKKEWEKSQELQENIKTLQDASGKLGESEA 87

Query: 69  YKKAREAYLRAQKGSTIVGKTLKKTGETVEDIAVKAWESELGKTTRKAMNATAQKIDESF 128
           YKKAREAYL+AQ+GSTIVGKTLKKTGET+E IA KAWESELGK TRKA  ATA+K+DESF
Sbjct: 88  YKKAREAYLKAQRGSTIVGKTLKKTGETMEHIATKAWESELGKNTRKAAAATAKKLDESF 147

Query: 129 EPVRQTKVYKDVSEVIDDGESSRYGGFITKEQRRLKKEQDLASGKRPKAVKSNDEAGTAL 188
           EPVRQTK+YK+VSEVIDDGESSRYGGFITKEQRRLK+E+DLASGKR +AVKSN++AGTA+
Sbjct: 148 EPVRQTKIYKEVSEVIDDGESSRYGGFITKEQRRLKRERDLASGKRHRAVKSNEDAGTAV 207

Query: 189 VATNIEAKESFSKKIEDFKEKTPTGRKIHEMKVRLWDESENPLIVLLRTIGNKVGGIFAE 248
           VATNIE+KESF KK+EDFKEKT  GR I  +K +LWDESENPLIV++R I NKVGG FAE
Sbjct: 208 VATNIESKESFGKKVEDFKEKTVVGRSIQSLKNKLWDESENPLIVVMRKITNKVGGFFAE 267

Query: 249 TESARVMGQFKMLDPNFNTESFTKHLREYIIPEILEAYVKGDEAVLKQWFSEAPYNVYAA 308
           TES+RV  QFK++DP F+ ESFT+HLREYI+PEILEAYVKGD  VLK+WFSEAP+NVYAA
Sbjct: 268 TESSRVYSQFKLMDPTFSNESFTRHLREYIVPEILEAYVKGDVKVLKKWFSEAPFNVYAA 327

Query: 309 QQKAFRDQELFADGRILDIRGVEIVSAKLLAPQDIPVLVVGCRAQEIHLYRKAKTGEIAA 368
           QQK F++Q+++ADGRILDIRGVEIVSAKLLAPQDIPVLVVGCRAQEI+LYRK KTGEIAA
Sbjct: 328 QQKIFKEQDVYADGRILDIRGVEIVSAKLLAPQDIPVLVVGCRAQEINLYRKKKTGEIAA 387

Query: 369 GTESNILLSSYAMVFTRDPENVDDKETEGWRILEFVRGGSRQFT 412
           G E+NIL+SSYAMVFTRDPE +DD ETEGW+ILEFVRGGSRQFT
Sbjct: 388 GDEANILMSSYAMVFTRDPEQIDDDETEGWKILEFVRGGSRQFT 431

>ADL118C Chr4 complement(478675..479931) [1257 bp, 418 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL022W
           (TIM44)
          Length = 418

 Score =  652 bits (1683), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/419 (77%), Positives = 367/419 (87%), Gaps = 8/419 (1%)

Query: 1   MYRHSI-------KPQLVLASRRTISSTVRLPQGQRSPLQIFRETFKQEWEKSKELQDNI 53
           M+R+S        +PQ VLA+R   S+T     G +SPLQ+FRETFK+EW+KS+ELQDNI
Sbjct: 1   MHRYSAVKQAQKSQPQRVLAAR-GFSATRWAGNGPKSPLQVFRETFKEEWKKSQELQDNI 59

Query: 54  KTLQDASGKLGESDAYKKAREAYLRAQKGSTIVGKTLKKTGETVEDIAVKAWESELGKTT 113
           K LQDA G+LGESDAYKKAREAYL+AQKGSTIVGKTLK+TGET+E I V+AWESE+GKTT
Sbjct: 60  KALQDAGGRLGESDAYKKAREAYLKAQKGSTIVGKTLKRTGETLEHITVQAWESEIGKTT 119

Query: 114 RKAMNATAQKIDESFEPVRQTKVYKDVSEVIDDGESSRYGGFITKEQRRLKKEQDLASGK 173
           RK ++ TAQK+DESFEPVRQTKVYKD+SE+IDDGESSRYGGF+ KE+RR K+E+DLA+GK
Sbjct: 120 RKTVSKTAQKLDESFEPVRQTKVYKDMSEIIDDGESSRYGGFMEKERRREKRERDLATGK 179

Query: 174 RPKAVKSNDEAGTALVATNIEAKESFSKKIEDFKEKTPTGRKIHEMKVRLWDESENPLIV 233
           R   V+SN+EAG+ALVAT+ EA ES  KKI+DFKEKT  GRK+HE+KVRLWDE+ENPLI 
Sbjct: 180 RATPVRSNEEAGSALVATDKEASESLGKKIQDFKEKTVVGRKLHEIKVRLWDENENPLIG 239

Query: 234 LLRTIGNKVGGIFAETESARVMGQFKMLDPNFNTESFTKHLREYIIPEILEAYVKGDEAV 293
           LLRTI NKVGG+FAETESARV  QFK+LDP FNTE FTKHLREYIIPE+LEAYVKGDE V
Sbjct: 240 LLRTISNKVGGLFAETESARVFAQFKLLDPTFNTEEFTKHLREYIIPEVLEAYVKGDEQV 299

Query: 294 LKQWFSEAPYNVYAAQQKAFRDQELFADGRILDIRGVEIVSAKLLAPQDIPVLVVGCRAQ 353
           LKQWFSEAPYNVY+AQQK  R QELFADGRILDIRGVEI+SAKLL PQD+P +VVGCRAQ
Sbjct: 300 LKQWFSEAPYNVYSAQQKQIRQQELFADGRILDIRGVEIISAKLLPPQDVPAIVVGCRAQ 359

Query: 354 EIHLYRKAKTGEIAAGTESNILLSSYAMVFTRDPENVDDKETEGWRILEFVRGGSRQFT 412
           EIHL+RKA TGEIAAG ESNI+LSSYAMV TRDPE VDDKETEGW+ILEFVRGGSR FT
Sbjct: 360 EIHLFRKATTGEIAAGHESNIMLSSYAMVLTRDPEKVDDKETEGWKILEFVRGGSRSFT 418

>CAGL0J02442g Chr10 complement(236641..237879) [1239 bp, 412 aa]
           {ON} highly similar to uniprot|Q01852 Saccharomyces
           cerevisiae YIL022w TIM44
          Length = 412

 Score =  647 bits (1668), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/403 (77%), Positives = 352/403 (87%), Gaps = 1/403 (0%)

Query: 11  VLASRRTISSTVRLPQGQRSPLQIFRETFKQEWEKSKELQDNIKTLQDASGKLGESDAYK 70
           VL +RR   +   L    RSPLQIFRETFK+EWEKS+ELQDNIKTLQDASG+LGES+AYK
Sbjct: 10  VLVARRCFGTRSVLLSNPRSPLQIFRETFKKEWEKSQELQDNIKTLQDASGRLGESEAYK 69

Query: 71  KAREAYLRAQKGS-TIVGKTLKKTGETVEDIAVKAWESELGKTTRKAMNATAQKIDESFE 129
           KAREAYL+A KGS TIVGKTL+KTGETVE++A KAW+S++ KTTR   + TA+K+DESFE
Sbjct: 70  KAREAYLKASKGSQTIVGKTLQKTGETVEELATKAWDSDIAKTTRVVASKTAKKLDESFE 129

Query: 130 PVRQTKVYKDVSEVIDDGESSRYGGFITKEQRRLKKEQDLASGKRPKAVKSNDEAGTALV 189
           PVRQTK+YKDVSEVIDDG+SS YGGFITKEQRRLK+E+DLASGKR +AVKSNDEAG+ALV
Sbjct: 130 PVRQTKIYKDVSEVIDDGDSSSYGGFITKEQRRLKREKDLASGKRVRAVKSNDEAGSALV 189

Query: 190 ATNIEAKESFSKKIEDFKEKTPTGRKIHEMKVRLWDESENPLIVLLRTIGNKVGGIFAET 249
           AT+IEAKES  KKIEDFKEKTP GR +  +KV LWDESENPLIV LR I  K+GG FAET
Sbjct: 190 ATDIEAKESLGKKIEDFKEKTPVGRTLKSVKVSLWDESENPLIVFLRKITGKIGGFFAET 249

Query: 250 ESARVMGQFKMLDPNFNTESFTKHLREYIIPEILEAYVKGDEAVLKQWFSEAPYNVYAAQ 309
           ESARV  QFKM+DP F    FTKHLR+YI+PE+LEAYVKGDE VLK+WFSEAP+NVY AQ
Sbjct: 250 ESARVYKQFKMVDPTFTNIGFTKHLRDYIVPEVLEAYVKGDEKVLKKWFSEAPFNVYNAQ 309

Query: 310 QKAFRDQELFADGRILDIRGVEIVSAKLLAPQDIPVLVVGCRAQEIHLYRKAKTGEIAAG 369
           QK F+ QELF+DG+ILDIRGVE+VSAKLL PQDIPVLVVGCRAQEIHLYRKAKTGEIAAG
Sbjct: 310 QKIFKKQELFSDGKILDIRGVEVVSAKLLQPQDIPVLVVGCRAQEIHLYRKAKTGEIAAG 369

Query: 370 TESNILLSSYAMVFTRDPENVDDKETEGWRILEFVRGGSRQFT 412
            ESNIL+SSYAMVFTRDPE +DD ETEGW+ILEF+RG SR F 
Sbjct: 370 DESNILMSSYAMVFTRDPEQIDDDETEGWKILEFIRGSSRPFN 412

>TPHA0C04530 Chr3 complement(975677..976927) [1251 bp, 416 aa] {ON}
           Anc_7.196 YIL022W
          Length = 416

 Score =  641 bits (1654), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/394 (76%), Positives = 354/394 (89%)

Query: 19  SSTVRLPQGQRSPLQIFRETFKQEWEKSKELQDNIKTLQDASGKLGESDAYKKAREAYLR 78
           +STV    G ++P+QIFRETFK+EWEKS+ELQDNIKTLQDASG+LG+S+AYKKA+EAY++
Sbjct: 23  TSTVLRNGGGKTPIQIFRETFKKEWEKSQELQDNIKTLQDASGRLGQSEAYKKAKEAYVK 82

Query: 79  AQKGSTIVGKTLKKTGETVEDIAVKAWESELGKTTRKAMNATAQKIDESFEPVRQTKVYK 138
           AQ+ STIV KTLKKTGETVED+A K W+SE+GK+TRK ++  A+KIDESFEPVRQT+VYK
Sbjct: 83  AQQSSTIVSKTLKKTGETVEDLAKKTWDSEIGKSTRKVVSQGAKKIDESFEPVRQTQVYK 142

Query: 139 DVSEVIDDGESSRYGGFITKEQRRLKKEQDLASGKRPKAVKSNDEAGTALVATNIEAKES 198
           +VSEVIDDGESSRYGGFI+KEQRR K+E DLASGKR +A KSN+EAGTA+VATN+E+KES
Sbjct: 143 EVSEVIDDGESSRYGGFISKEQRRKKREADLASGKRVRATKSNEEAGTAIVATNVESKES 202

Query: 199 FSKKIEDFKEKTPTGRKIHEMKVRLWDESENPLIVLLRTIGNKVGGIFAETESARVMGQF 258
           F KKI+DFKEKT  G+ +   KVR+WDE+ENPLIV+LRTI NK+ G FAETES+RV  QF
Sbjct: 203 FGKKIDDFKEKTVVGKTMKSFKVRVWDENENPLIVVLRTISNKISGFFAETESSRVYSQF 262

Query: 259 KMLDPNFNTESFTKHLREYIIPEILEAYVKGDEAVLKQWFSEAPYNVYAAQQKAFRDQEL 318
           K++DP F+  +FTKHLR+YIIPE+LEAYVKGDE VLK+WFSEAP+NVYAAQQK  R Q+L
Sbjct: 263 KLMDPTFSNAAFTKHLRDYIIPEVLEAYVKGDEVVLKKWFSEAPFNVYAAQQKELRKQQL 322

Query: 319 FADGRILDIRGVEIVSAKLLAPQDIPVLVVGCRAQEIHLYRKAKTGEIAAGTESNILLSS 378
           F DGRILDIRGV+IVSAKLLAPQDIPVLVVGCRAQE+HLYRK KTGE+ AG ESNI++SS
Sbjct: 323 FTDGRILDIRGVDIVSAKLLAPQDIPVLVVGCRAQELHLYRKVKTGELGAGDESNIMMSS 382

Query: 379 YAMVFTRDPENVDDKETEGWRILEFVRGGSRQFT 412
           YAMVFTRDP+N+DD ETEGW+ILEFVRGGSRQFT
Sbjct: 383 YAMVFTRDPDNIDDDETEGWKILEFVRGGSRQFT 416

>ZYRO0D15840g Chr4 complement(1321497..1322720) [1224 bp, 407 aa]
           {ON} highly similar to uniprot|Q01852 Saccharomyces
           cerevisiae YIL022W TIM44 48.8 kDa protein involved in
           mitochondrial protein import
          Length = 407

 Score =  633 bits (1633), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/395 (75%), Positives = 358/395 (90%), Gaps = 1/395 (0%)

Query: 18  ISSTVRLPQGQRSPLQIFRETFKQEWEKSKELQDNIKTLQDASGKLGESDAYKKAREAYL 77
            S++ R  QG RSPLQIFR+TFK+EWEKS+ELQ+NIKTLQDASG+LG+S+  K+AREAYL
Sbjct: 14  FSTSSRSLQG-RSPLQIFRDTFKKEWEKSQELQENIKTLQDASGRLGDSEGVKRAREAYL 72

Query: 78  RAQKGSTIVGKTLKKTGETVEDIAVKAWESELGKTTRKAMNATAQKIDESFEPVRQTKVY 137
           RAQKGSTIVGKTL+KTGETVE IA KAWESE+ K+TR A +ATA+K+D+SFEPVR TK+Y
Sbjct: 73  RAQKGSTIVGKTLQKTGETVEGIASKAWESEIAKSTRSAASATAKKLDKSFEPVRNTKIY 132

Query: 138 KDVSEVIDDGESSRYGGFITKEQRRLKKEQDLASGKRPKAVKSNDEAGTALVATNIEAKE 197
           KDVSEV++D ++SRYGGF+TKEQR++K+E+++ASGKR +A++SN+EAGTALVATNIEAKE
Sbjct: 133 KDVSEVMEDADTSRYGGFLTKEQRKIKREREIASGKRARAIRSNEEAGTALVATNIEAKE 192

Query: 198 SFSKKIEDFKEKTPTGRKIHEMKVRLWDESENPLIVLLRTIGNKVGGIFAETESARVMGQ 257
           S  KK+EDF+EKT  GR I ++KVRLW+E+ENPLIV+LR I NKVGG FAETE+A+V+GQ
Sbjct: 193 SLGKKVEDFREKTFIGRAIQQLKVRLWNENENPLIVILRKITNKVGGFFAETETAKVIGQ 252

Query: 258 FKMLDPNFNTESFTKHLREYIIPEILEAYVKGDEAVLKQWFSEAPYNVYAAQQKAFRDQE 317
           FK+LDP+F +E FT+ LR+Y+IPE+LEAY KGDE  LK+WFSEAP+NVYAAQQK FRDQ+
Sbjct: 253 FKLLDPSFTSEGFTRQLRDYVIPEVLEAYAKGDEKTLKKWFSEAPFNVYAAQQKFFRDQK 312

Query: 318 LFADGRILDIRGVEIVSAKLLAPQDIPVLVVGCRAQEIHLYRKAKTGEIAAGTESNILLS 377
           LFAD RILDIRGV+IVSAKLL PQDIPVL+VGCRAQEI LYR  K+GE+AAG ESNIL+S
Sbjct: 313 LFADSRILDIRGVDIVSAKLLPPQDIPVLIVGCRAQEIQLYRSIKSGEVAAGHESNILMS 372

Query: 378 SYAMVFTRDPENVDDKETEGWRILEFVRGGSRQFT 412
           SYAMVFTRDPENV+D+ETEGWRI+EFVRGGSRQFT
Sbjct: 373 SYAMVFTRDPENVEDEETEGWRIIEFVRGGSRQFT 407

>NDAI0B01780 Chr2 complement(423642..424946) [1305 bp, 434 aa] {ON}
           Anc_7.196 YIL022W
          Length = 434

 Score =  620 bits (1600), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/385 (75%), Positives = 342/385 (88%)

Query: 27  GQRSPLQIFRETFKQEWEKSKELQDNIKTLQDASGKLGESDAYKKAREAYLRAQKGSTIV 86
           G R+P+QIFR+TFK+EWEKS+ELQDNIK L DASGKL ES+ +K A++AYL+A KGSTIV
Sbjct: 49  GGRTPIQIFRDTFKKEWEKSQELQDNIKALHDASGKLSESETFKMAKDAYLKAHKGSTIV 108

Query: 87  GKTLKKTGETVEDIAVKAWESELGKTTRKAMNATAQKIDESFEPVRQTKVYKDVSEVIDD 146
            KTLKKTGETVE +A KAW+SE+GK TR A   TA+ ID+SFEPVR+T++YKDVSEVIDD
Sbjct: 109 SKTLKKTGETVETMASKAWDSEIGKNTRIAAKKTAETIDKSFEPVRKTQIYKDVSEVIDD 168

Query: 147 GESSRYGGFITKEQRRLKKEQDLASGKRPKAVKSNDEAGTALVATNIEAKESFSKKIEDF 206
           G+SSRYGGFITKE+R+LK+E+DLASGKR +AVKSNDEAGTALVATNIEAKESF KK+EDF
Sbjct: 169 GDSSRYGGFITKEERKLKRERDLASGKRQRAVKSNDEAGTALVATNIEAKESFGKKVEDF 228

Query: 207 KEKTPTGRKIHEMKVRLWDESENPLIVLLRTIGNKVGGIFAETESARVMGQFKMLDPNFN 266
           KEKT  G+ +  +K++LWDESENPLIV LR I NK+ G F ETESA+V  QFK++D  F 
Sbjct: 229 KEKTVVGKTMKTVKMKLWDESENPLIVTLRKISNKISGFFDETESAKVYTQFKLMDTTFT 288

Query: 267 TESFTKHLREYIIPEILEAYVKGDEAVLKQWFSEAPYNVYAAQQKAFRDQELFADGRILD 326
            + FT+HLR+YI+PEILEAY+KGDE VLK+WFSEAP+NVYAAQQK FR+Q LF+DGRILD
Sbjct: 289 NDGFTRHLRDYIVPEILEAYIKGDEKVLKKWFSEAPFNVYAAQQKVFREQGLFSDGRILD 348

Query: 327 IRGVEIVSAKLLAPQDIPVLVVGCRAQEIHLYRKAKTGEIAAGTESNILLSSYAMVFTRD 386
           IRGVEIVSAKLLAPQDIPVLVVGCRAQEI+LY+KAK+GEIAAG ESNI++SSYAMVFTRD
Sbjct: 349 IRGVEIVSAKLLAPQDIPVLVVGCRAQEINLYKKAKSGEIAAGDESNIVMSSYAMVFTRD 408

Query: 387 PENVDDKETEGWRILEFVRGGSRQF 411
           PE +DD ETEGW+ILEFVRGGSR F
Sbjct: 409 PEQIDDDETEGWKILEFVRGGSRPF 433

>NCAS0A12520 Chr1 complement(2470598..2471896) [1299 bp, 432 aa]
           {ON} Anc_7.196 YIL022W
          Length = 432

 Score =  616 bits (1589), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/387 (74%), Positives = 344/387 (88%), Gaps = 1/387 (0%)

Query: 27  GQRSPLQIFRETFKQEWEKSKELQDNIKTLQDASGKLGESDAYKKAREAYLRAQKGS-TI 85
           G R+P+QIFR+TFK+EW+KS+ELQ+NIK L DASGKL ES+ +K A++AYL+A KGS TI
Sbjct: 46  GGRTPIQIFRDTFKKEWDKSQELQENIKALHDASGKLSESETFKMAKDAYLKAHKGSSTI 105

Query: 86  VGKTLKKTGETVEDIAVKAWESELGKTTRKAMNATAQKIDESFEPVRQTKVYKDVSEVID 145
           + KT++KTGETVE++A KAW+SE+ K+TR+A   TA  +D+SFEPVR+T+VYKD+SEVID
Sbjct: 106 LSKTMQKTGETVENMASKAWDSEIAKSTREAAKKTADTLDKSFEPVRKTQVYKDISEVID 165

Query: 146 DGESSRYGGFITKEQRRLKKEQDLASGKRPKAVKSNDEAGTALVATNIEAKESFSKKIED 205
           DG+SSRYGGFITKE+RRLK+E DLASGKR +A+KSN+EAGTALVAT+IEAK+SF KK+ED
Sbjct: 166 DGDSSRYGGFITKEERRLKRESDLASGKRQRAIKSNEEAGTALVATDIEAKQSFGKKVED 225

Query: 206 FKEKTPTGRKIHEMKVRLWDESENPLIVLLRTIGNKVGGIFAETESARVMGQFKMLDPNF 265
           FKEKT  G+ +  +KV+LWDESENPLIV LR I NK+GG F ETESARV  QFKM+D  F
Sbjct: 226 FKEKTVVGKTMSSVKVKLWDESENPLIVFLRKITNKIGGFFDETESARVYTQFKMMDATF 285

Query: 266 NTESFTKHLREYIIPEILEAYVKGDEAVLKQWFSEAPYNVYAAQQKAFRDQELFADGRIL 325
             E FT+HLREYI+PE+LEAY+KGDE VLK+WFSEAP+NVY+AQQK FR+Q LF+DGRIL
Sbjct: 286 TNEGFTRHLREYIVPELLEAYIKGDEKVLKKWFSEAPFNVYSAQQKVFREQGLFSDGRIL 345

Query: 326 DIRGVEIVSAKLLAPQDIPVLVVGCRAQEIHLYRKAKTGEIAAGTESNILLSSYAMVFTR 385
           DIRGVEIVSAKLLAPQDIPVLVVGCRAQEI+LYRK KTGEIAAG +SNIL+SSYAMVFTR
Sbjct: 346 DIRGVEIVSAKLLAPQDIPVLVVGCRAQEINLYRKVKTGEIAAGDQSNILMSSYAMVFTR 405

Query: 386 DPENVDDKETEGWRILEFVRGGSRQFT 412
           DPE +DD ETEGW+ILEFVRGGSRQFT
Sbjct: 406 DPEQIDDDETEGWKILEFVRGGSRQFT 432

>KNAG0H02690 Chr8 (497172..498431) [1260 bp, 419 aa] {ON} Anc_7.196
           YIL022W
          Length = 419

 Score =  615 bits (1586), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/384 (76%), Positives = 345/384 (89%)

Query: 29  RSPLQIFRETFKQEWEKSKELQDNIKTLQDASGKLGESDAYKKAREAYLRAQKGSTIVGK 88
           RSPL IFR+TFK+EWEKS+ELQ+NI+TLQDASGK+GE++AY+KAREA+LRAQKGSTIVGK
Sbjct: 36  RSPLSIFRDTFKKEWEKSQELQENIRTLQDASGKIGETEAYRKAREAFLRAQKGSTIVGK 95

Query: 89  TLKKTGETVEDIAVKAWESELGKTTRKAMNATAQKIDESFEPVRQTKVYKDVSEVIDDGE 148
           TLKKTGETVE IA KAW+SE+ K +RKA   TAQK+DE FEPVRQT++YKDVSEVIDDG+
Sbjct: 96  TLKKTGETVEGIASKAWDSEIAKASRKAAVKTAQKLDEGFEPVRQTQLYKDVSEVIDDGD 155

Query: 149 SSRYGGFITKEQRRLKKEQDLASGKRPKAVKSNDEAGTALVATNIEAKESFSKKIEDFKE 208
           S+ YGGF T+E+R+ ++E+ LASG+R +AVKSNDEAGTALVAT +E+KES  KK+EDFKE
Sbjct: 156 STSYGGFFTREERQRRREKALASGERVRAVKSNDEAGTALVATGVESKESLGKKMEDFKE 215

Query: 209 KTPTGRKIHEMKVRLWDESENPLIVLLRTIGNKVGGIFAETESARVMGQFKMLDPNFNTE 268
           KT  GR +H +K RLWDESENPLIV +R +  KVG  FAETES RV  QFK++DPNFN+ 
Sbjct: 216 KTAVGRSLHGLKHRLWDESENPLIVFMRKVSGKVGKFFAETESGRVYTQFKLMDPNFNSV 275

Query: 269 SFTKHLREYIIPEILEAYVKGDEAVLKQWFSEAPYNVYAAQQKAFRDQELFADGRILDIR 328
           +FTKHLREY++PEILEAYV+GDE VLK+WFSEAPYNVYAAQQK F+++ LFADGRILDIR
Sbjct: 276 TFTKHLREYVVPEILEAYVRGDEKVLKKWFSEAPYNVYAAQQKMFKEKALFADGRILDIR 335

Query: 329 GVEIVSAKLLAPQDIPVLVVGCRAQEIHLYRKAKTGEIAAGTESNILLSSYAMVFTRDPE 388
           GVEIVSAKLL PQD+PVLVVGCRAQEI+LY+K KTGEIAAG+ESNIL+SSYAMVFTRDPE
Sbjct: 336 GVEIVSAKLLQPQDLPVLVVGCRAQEINLYKKVKTGEIAAGSESNILMSSYAMVFTRDPE 395

Query: 389 NVDDKETEGWRILEFVRGGSRQFT 412
            V D+ETEGW+ILEFVRGGSRQFT
Sbjct: 396 QVTDEETEGWKILEFVRGGSRQFT 419

>KAFR0A02640 Chr1 (547285..548550) [1266 bp, 421 aa] {ON} Anc_7.196
           YIL022W
          Length = 421

 Score =  588 bits (1516), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/398 (70%), Positives = 334/398 (83%), Gaps = 2/398 (0%)

Query: 17  TISSTVRLPQGQRSPLQIFRETFKQEWEKSKELQDNIKTLQDASGKLGESDAYKKAREAY 76
           ++ ++  L Q QR+PLQIFRETFK+EWEKS ELQ +IK LQDASGK+ ES+AYKKAR+AY
Sbjct: 24  SLHTSRNLGQQQRTPLQIFRETFKKEWEKSAELQGSIKELQDASGKISESEAYKKARDAY 83

Query: 77  LRAQKGS-TIVGKTLKKTGETVEDIAVKAWESELGKTTRKAMNATAQKIDESFEPVRQTK 135
           L+A +GS TI+ KTLKKTG+T+EDIA KAWESE+ K TR+  + TA+K+DESFEPVR TK
Sbjct: 84  LKAHRGSSTILDKTLKKTGDTLEDIATKAWESEISKNTRQMASETAKKLDESFEPVRNTK 143

Query: 136 VYKDVSEVI-DDGESSRYGGFITKEQRRLKKEQDLASGKRPKAVKSNDEAGTALVATNIE 194
           +YKDVSEV+ DDG+S RYGGFI K++RRLK+E  L SGKR +AVKSNDEAGTALVATN++
Sbjct: 144 IYKDVSEVLNDDGDSYRYGGFIQKDERRLKRENALKSGKRVRAVKSNDEAGTALVATNVQ 203

Query: 195 AKESFSKKIEDFKEKTPTGRKIHEMKVRLWDESENPLIVLLRTIGNKVGGIFAETESARV 254
           + ES  +K E+FKE+T  G+ +H  KV  WDESENPLIVLLR I  K+ G F ETES+RV
Sbjct: 204 SHESIGQKYENFKERTMVGKILHNFKVNYWDESENPLIVLLRKITLKITGFFGETESSRV 263

Query: 255 MGQFKMLDPNFNTESFTKHLREYIIPEILEAYVKGDEAVLKQWFSEAPYNVYAAQQKAFR 314
             QFK++D  FN ESFT+HLREYI+PEILEAY+KGDE VLK WFSEAP+NVY+AQQK FR
Sbjct: 264 YSQFKLIDQTFNAESFTRHLREYIVPEILEAYIKGDEKVLKNWFSEAPFNVYSAQQKVFR 323

Query: 315 DQELFADGRILDIRGVEIVSAKLLAPQDIPVLVVGCRAQEIHLYRKAKTGEIAAGTESNI 374
            Q LF DG ILDIR VEIVSAKLL PQDIPVLVV CRAQEI++YRK KTGE+AAG  S+I
Sbjct: 324 QQNLFPDGNILDIRNVEIVSAKLLQPQDIPVLVVSCRAQEINIYRKIKTGEVAAGNASDI 383

Query: 375 LLSSYAMVFTRDPENVDDKETEGWRILEFVRGGSRQFT 412
           L+S+YAMVFTRDPE +D+ ETEGWRILEFVRG SRQFT
Sbjct: 384 LMSTYAMVFTRDPEEIDNDETEGWRILEFVRGNSRQFT 421

>TBLA0J01500 Chr10 (342554..343819) [1266 bp, 421 aa] {ON} Anc_7.196
           YIL022W
          Length = 421

 Score =  523 bits (1347), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 245/416 (58%), Positives = 331/416 (79%), Gaps = 10/416 (2%)

Query: 3   RHSIKP-QLVLASRRTISSTVRLPQGQRSPLQIFRETFKQEWEKSKELQDNIKTLQDASG 61
           R+++ P +L+++S  +    ++     ++P+QIFRETFKQEWEKS  LQD IKTL DAS 
Sbjct: 10  RNALHPSKLLISSFHSYPVVLQSNDSNKTPIQIFRETFKQEWEKSATLQDQIKTLTDASD 69

Query: 62  KLGESDAYKKAREAYLRAQKGSTIVGKTLKKTGETVEDIAVKAWESELGKTTRKAMNATA 121
           ++ +SDA+KKA++AY      +TI+ KT+ KTG  + D A+KAW+S+L + T+ A    A
Sbjct: 70  RINQSDAFKKAKDAYKNVSNQTTILSKTISKTGTKLNDAALKAWDSDLAQKTKLA----A 125

Query: 122 QKIDESFEPVRQTKVYKDVSEVIDDGESS-RYGGFITKEQRRLKKEQDLASGKRPKAVKS 180
           +K+D+SFEPVR TK+YKDVSEVIDD ++S +YGGFI+KE+RR K+  DL +GKR K +KS
Sbjct: 126 KKLDDSFEPVRNTKIYKDVSEVIDDKDNSYKYGGFISKEERRSKRISDLQTGKRMKPIKS 185

Query: 181 NDEAGTALVATNIEAKESFSKKIEDFKEKTPTGRKIHEMKVRLWDESENPLIVLLRTIGN 240
           NDEAGTAL+AT++++KES ++K+ DFKEKT  G+ +  +K ++WDE++NPLIV +R +  
Sbjct: 186 NDEAGTALIATDLKSKESINEKLNDFKEKTVVGQTMTSIKTKVWDENDNPLIVGMRKVTG 245

Query: 241 KVGGIFAETESARVMGQFKMLDPNFNTESFTKHLREYIIPEILEAYVKGDEAVLKQWFSE 300
                FAETES+RV+ QFK++DPNFN ESF + LREYIIPE+LEAY+KGDE +LK WFSE
Sbjct: 246 VFNRFFAETESSRVLTQFKLIDPNFNNESFLRSLREYIIPEVLEAYIKGDEKILKNWFSE 305

Query: 301 APYNVYAAQQKAFRDQELFADGRILDIRGVEIVSAKLLAPQDIPVLVVGCRAQEIHLYRK 360
           APYNVY+AQQK  R Q++F+DGR+LDIRGV+IV+AK+L PQDIPV+VV CRAQEI++Y+K
Sbjct: 306 APYNVYSAQQKELRKQKIFSDGRVLDIRGVDIVTAKMLPPQDIPVIVVSCRAQEINIYKK 365

Query: 361 ----AKTGEIAAGTESNILLSSYAMVFTRDPENVDDKETEGWRILEFVRGGSRQFT 412
                +T +I AG +SNIL+S+YAMVFTRDPE +D+ ETEGW+ILEFVRGGSR+FT
Sbjct: 366 FNVEKQTNDIVAGHDSNILMSTYAMVFTRDPEQLDNDETEGWKILEFVRGGSRKFT 421

>TPHA0B02770 Chr2 (631381..632823) [1443 bp, 480 aa] {ON} Anc_7.216
           YIL039W
          Length = 480

 Score = 36.2 bits (82), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 33/110 (30%), Positives = 48/110 (43%), Gaps = 18/110 (16%)

Query: 141 SEVIDDGE----SSRYGGFITKEQRRLKKEQDLASGKRPKAVKSNDEAGTALVATN--IE 194
           S+ IDD E    +SRY       +R  K+  D+      +   S+DE G   V T   IE
Sbjct: 147 SQWIDDSEFYNRTSRY------MRRIFKRNTDILFDINNE---SHDENGQYQVNTEKWIE 197

Query: 195 AKESFSKKIEDFKEKTPTGRKIHEMKVRLWDESENPL---IVLLRTIGNK 241
           +K  FS + E+  E TP   +     +  WDE  +P     + + T GN 
Sbjct: 198 SKNLFSYEFENIDESTPIDNEFGYEDLYSWDEDSDPTKDSYLFINTTGNH 247

>TDEL0E05100 Chr5 (940235..941722) [1488 bp, 495 aa] {ON} Anc_5.120
           YGR211W
          Length = 495

 Score = 32.7 bits (73), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 23/95 (24%), Positives = 50/95 (52%), Gaps = 7/95 (7%)

Query: 154 GFITK---EQRRLKKEQDLASGKR--PKAVKSNDEAGTALVATNIEAKESFSKKIEDFKE 208
           G IT+   EQRR +K Q+L++ +R  P++V     AG +   ++    E+F+ +++ F+ 
Sbjct: 243 GIITRDQLEQRRREKLQELSNRERNPPQSVTVG--AGNSQFLSDATDIENFNNEVQTFRA 300

Query: 209 KTPTGRKIHEMKVRLWDESENPLIVLLRTIGNKVG 243
             P+     E  ++  +      ++++ T+ +K G
Sbjct: 301 SCPSCMNECETHMKPVNIPHFKEVIIMSTVCDKCG 335

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.131    0.363 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 41,464,563
Number of extensions: 1792519
Number of successful extensions: 5592
Number of sequences better than 10.0: 106
Number of HSP's gapped: 5852
Number of HSP's successfully gapped: 109
Length of query: 412
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 300
Effective length of database: 40,638,807
Effective search space: 12191642100
Effective search space used: 12191642100
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 67 (30.4 bits)