Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0F07458g7.194ON31531516930.0
KLTH0E04598g7.194ON32832814160.0
Kwal_55.203807.194ON32332314130.0
ADL120C7.194ON31131813430.0
Ecym_43827.194ON31131813390.0
TDEL0H025307.194ON31132013350.0
KLLA0D16170g7.194ON30731713340.0
Suva_9.1787.194ON31932113140.0
Skud_9.1487.194ON31832113110.0
YIL021W (RPB3)7.194ON31832113080.0
Smik_9.1697.194ON31832112970.0
KAFR0A026507.194ON31231612950.0
NDAI0G020007.194ON31132012761e-178
CAGL0J02420g7.194ON31231912751e-178
NCAS0E018307.194ON31832612751e-178
ZYRO0D15796g7.194ON30831712581e-175
Kpol_1063.117.194ON31632012541e-174
TBLA0J015207.194ON33531212541e-174
TPHA0C045107.194ON31031112351e-172
KNAG0H027007.194ON32632812251e-170
Kpol_1018.1393.428ON3352872482e-23
YPR110C (RPC40)3.428ON3352922323e-21
ZYRO0C12364g3.428ON3352912314e-21
Suva_16.4383.428ON3352922315e-21
KNAG0A076003.428ON3342932271e-20
Smik_16.3533.428ON3352922271e-20
KLTH0F12056g3.428ON3502802272e-20
Kpol_473.33.428ON3202942243e-20
KLLA0D14861g3.428ON3342882235e-20
KAFR0A055203.428ON3343042226e-20
NCAS0A115203.428ON3351972201e-19
TPHA0D039203.428ON3352882201e-19
TDEL0F031003.428ON3351962201e-19
Skud_16.3973.428ON3352882201e-19
NDAI0A047703.428ON3352932183e-19
Kwal_23.39983.428ON3341942165e-19
ADR031C3.428ON3641962166e-19
TBLA0F017003.428ON3331952148e-19
SAKL0F06028g3.428ON3341952131e-18
Ecym_44503.428ON3341952112e-18
CAGL0B04125g3.428ON3342022006e-17
CAGL0G08954g1.371ON59082741.1
Kwal_14.783na 1ON128076685.6
TPHA0F007404.125ON567100668.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0F07458g
         (315 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0F07458g Chr6 complement(570134..571081) [948 bp, 315 aa] {O...   656   0.0  
KLTH0E04598g Chr5 (415348..416334) [987 bp, 328 aa] {ON} similar...   550   0.0  
Kwal_55.20380 s55 (379749..380720) [972 bp, 323 aa] {ON} YIL021W...   548   0.0  
ADL120C Chr4 complement(477033..477968) [936 bp, 311 aa] {ON} Sy...   521   0.0  
Ecym_4382 Chr4 (803602..804537) [936 bp, 311 aa] {ON} similar to...   520   0.0  
TDEL0H02530 Chr8 (425329..426264) [936 bp, 311 aa] {ON} Anc_7.19...   518   0.0  
KLLA0D16170g Chr4 complement(1362809..1363732) [924 bp, 307 aa] ...   518   0.0  
Suva_9.178 Chr9 (300119..301078) [960 bp, 319 aa] {ON} YIL021W (...   510   0.0  
Skud_9.148 Chr9 (282540..283496) [957 bp, 318 aa] {ON} YIL021W (...   509   0.0  
YIL021W Chr9 (312905..313861) [957 bp, 318 aa] {ON}  RPB3RNA pol...   508   0.0  
Smik_9.169 Chr9 (287469..288425) [957 bp, 318 aa] {ON} YIL021W (...   504   0.0  
KAFR0A02650 Chr1 (548878..549816) [939 bp, 312 aa] {ON} Anc_7.19...   503   0.0  
NDAI0G02000 Chr7 (449842..450777) [936 bp, 311 aa] {ON} Anc_7.19...   496   e-178
CAGL0J02420g Chr10 complement(234977..235915) [939 bp, 312 aa] {...   495   e-178
NCAS0E01830 Chr5 (355752..356708) [957 bp, 318 aa] {ON} Anc_7.19...   495   e-178
ZYRO0D15796g Chr4 complement(1319952..1320878) [927 bp, 308 aa] ...   489   e-175
Kpol_1063.11 s1063 (29092..29787,29789..30043) [951 bp, 316 aa] ...   487   e-174
TBLA0J01520 Chr10 (344746..345753) [1008 bp, 335 aa] {ON} Anc_7....   487   e-174
TPHA0C04510 Chr3 complement(973590..974522) [933 bp, 310 aa] {ON...   480   e-172
KNAG0H02700 Chr8 (498753..499733) [981 bp, 326 aa] {ON} Anc_7.19...   476   e-170
Kpol_1018.139 s1018 (370051..371058) [1008 bp, 335 aa] {ON} (370...   100   2e-23
YPR110C Chr16 complement(745828..746835) [1008 bp, 335 aa] {ON} ...    94   3e-21
ZYRO0C12364g Chr3 complement(976920..977927) [1008 bp, 335 aa] {...    94   4e-21
Suva_16.438 Chr16 complement(753618..754625) [1008 bp, 335 aa] {...    94   5e-21
KNAG0A07600 Chr1 complement(1192867..1193871) [1005 bp, 334 aa] ...    92   1e-20
Smik_16.353 Chr16 complement(623974..624981) [1008 bp, 335 aa] {...    92   1e-20
KLTH0F12056g Chr6 (1016695..1017747) [1053 bp, 350 aa] {ON} high...    92   2e-20
Kpol_473.3 s473 complement(6708..7670) [963 bp, 320 aa] {ON} com...    91   3e-20
KLLA0D14861g Chr4 complement(1253023..1254027) [1005 bp, 334 aa]...    91   5e-20
KAFR0A05520 Chr1 (1101190..1102194) [1005 bp, 334 aa] {ON} Anc_3...    90   6e-20
NCAS0A11520 Chr1 complement(2279808..2280815) [1008 bp, 335 aa] ...    89   1e-19
TPHA0D03920 Chr4 complement(821790..822797) [1008 bp, 335 aa] {O...    89   1e-19
TDEL0F03100 Chr6 complement(567682..568689) [1008 bp, 335 aa] {O...    89   1e-19
Skud_16.397 Chr16 complement(710663..711670) [1008 bp, 335 aa] {...    89   1e-19
NDAI0A04770 Chr1 (1091856..1092863) [1008 bp, 335 aa] {ON} Anc_3...    89   3e-19
Kwal_23.3998 s23 (519065..520069) [1005 bp, 334 aa] {ON} YPR110C...    88   5e-19
ADR031C Chr4 complement(761933..763027) [1095 bp, 364 aa] {ON} S...    88   6e-19
TBLA0F01700 Chr6 (423582..424583) [1002 bp, 333 aa] {ON} Anc_3.4...    87   8e-19
SAKL0F06028g Chr6 complement(453180..454184) [1005 bp, 334 aa] {...    87   1e-18
Ecym_4450 Chr4 (921163..922167) [1005 bp, 334 aa] {ON} similar t...    86   2e-18
CAGL0B04125g Chr2 complement(401513..402517) [1005 bp, 334 aa] {...    82   6e-17
CAGL0G08954g Chr7 complement(857016..858788) [1773 bp, 590 aa] {...    33   1.1  
Kwal_14.783 s14 complement(44469..48311) [3843 bp, 1280 aa] {ON}...    31   5.6  
TPHA0F00740 Chr6 (169745..171448) [1704 bp, 567 aa] {ON} Anc_4.1...    30   8.3  

>SAKL0F07458g Chr6 complement(570134..571081) [948 bp, 315 aa] {ON}
           highly similar to uniprot|P16370 Saccharomyces
           cerevisiae YIL021W
          Length = 315

 Score =  656 bits (1693), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/315 (100%), Positives = 315/315 (100%)

Query: 1   MTEEGPQVKIREATKDSVDFILSNVDIALANSFRRVMIAEIPTLAIDSVEVETNTTVLAD 60
           MTEEGPQVKIREATKDSVDFILSNVDIALANSFRRVMIAEIPTLAIDSVEVETNTTVLAD
Sbjct: 1   MTEEGPQVKIREATKDSVDFILSNVDIALANSFRRVMIAEIPTLAIDSVEVETNTTVLAD 60

Query: 61  EFIAHRLGLIPLQSADINDLVYCRDCYCEDHCDRCSVVLTLQAVGESESTTNVYAKDLVI 120
           EFIAHRLGLIPLQSADINDLVYCRDCYCEDHCDRCSVVLTLQAVGESESTTNVYAKDLVI
Sbjct: 61  EFIAHRLGLIPLQSADINDLVYCRDCYCEDHCDRCSVVLTLQAVGESESTTNVYAKDLVI 120

Query: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLKCIAKKGISKEHAKWSPASAIEFEY 180
           VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLKCIAKKGISKEHAKWSPASAIEFEY
Sbjct: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLKCIAKKGISKEHAKWSPASAIEFEY 180

Query: 181 DPWNKLKHTDYWYEQDVAAEWPQSKNCEYEDPPNEDDVFDYNAKPNTFYMSVETVGSLTS 240
           DPWNKLKHTDYWYEQDVAAEWPQSKNCEYEDPPNEDDVFDYNAKPNTFYMSVETVGSLTS
Sbjct: 181 DPWNKLKHTDYWYEQDVAAEWPQSKNCEYEDPPNEDDVFDYNAKPNTFYMSVETVGSLTS 240

Query: 241 DQVVIRGIKTLQDKVADILFSLKKMDQERVNFGGAGGNADNVDVAMDGENEMSDPYTSNQ 300
           DQVVIRGIKTLQDKVADILFSLKKMDQERVNFGGAGGNADNVDVAMDGENEMSDPYTSNQ
Sbjct: 241 DQVVIRGIKTLQDKVADILFSLKKMDQERVNFGGAGGNADNVDVAMDGENEMSDPYTSNQ 300

Query: 301 DQYNGGPSAGFDDAW 315
           DQYNGGPSAGFDDAW
Sbjct: 301 DQYNGGPSAGFDDAW 315

>KLTH0E04598g Chr5 (415348..416334) [987 bp, 328 aa] {ON} similar to
           uniprot|P16370 Saccharomyces cerevisiae YIL021W
          Length = 328

 Score =  550 bits (1416), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 266/328 (81%), Positives = 284/328 (86%), Gaps = 13/328 (3%)

Query: 1   MTEEGPQVKIREATKDSVDFILSNVDIALANSFRRVMIAEIPTLAIDSVEVETNTTVLAD 60
           M EEGPQVKIREATKD+VDFILSNVDI +ANS RRVMIAEIPTLAIDSVEVETNT+VLAD
Sbjct: 1   MAEEGPQVKIREATKDNVDFILSNVDITMANSLRRVMIAEIPTLAIDSVEVETNTSVLAD 60

Query: 61  EFIAHRLGLIPLQSADINDLVYCRDCYCEDHCDRCSVVLTLQAVGESESTTNVYAKDLVI 120
           EFI+HRLGLIPLQS+DINDL+YCRDCYCEDHCDRCSVVLTLQAVGESESTTNVYAKDLVI
Sbjct: 61  EFISHRLGLIPLQSSDINDLIYCRDCYCEDHCDRCSVVLTLQAVGESESTTNVYAKDLVI 120

Query: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLKCIAKKGISKEHAKWSPASAIEFEY 180
           VSNLMGRNIGHPIIQDK+GNGVLICKLRKGQELKLKC+AKKGISKEHAKWSPA+AIEFEY
Sbjct: 121 VSNLMGRNIGHPIIQDKDGNGVLICKLRKGQELKLKCVAKKGISKEHAKWSPAAAIEFEY 180

Query: 181 DPWNKLKHTDYWYEQDVAAEWPQSKNCEYEDPPNEDDVFDYNAKPNTFYMSVETVGSLTS 240
           DPWNKLKHTDYW+E D AAEWPQSKNCEYEDPPNED+ FDYNAKP TFYM+VETVGSLT 
Sbjct: 181 DPWNKLKHTDYWHETDAAAEWPQSKNCEYEDPPNEDEAFDYNAKPTTFYMNVETVGSLTV 240

Query: 241 DQVVIRGIKTLQDKVADILFSLKKMDQERVNFGGAGGNADNVDVAMDGENEMSDPY---- 296
           DQVVIRG+KTLQDKVADILFSLKKMDQ++VNFGG  G  D    AM  E +    Y    
Sbjct: 241 DQVVIRGMKTLQDKVADILFSLKKMDQDKVNFGGTAGMVDQDGGAMPVEPDSGFAYGSGG 300

Query: 297 ---------TSNQDQYNGGPSAGFDDAW 315
                           + GPS+GFDDAW
Sbjct: 301 PSSGSGMGGGPGAPFGHTGPSSGFDDAW 328

>Kwal_55.20380 s55 (379749..380720) [972 bp, 323 aa] {ON} YIL021W
           (RPB3) - 45 kDa subunit of RNA polymerase II [contig
           149] FULL
          Length = 323

 Score =  548 bits (1413), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 262/323 (81%), Positives = 287/323 (88%), Gaps = 8/323 (2%)

Query: 1   MTEEGPQVKIREATKDSVDFILSNVDIALANSFRRVMIAEIPTLAIDSVEVETNTTVLAD 60
           M EEGPQVKIREATKD+VDFILSNVD+A+ANS RRVMIAEIPT+AIDSVEVETNT+VLAD
Sbjct: 1   MAEEGPQVKIREATKDNVDFILSNVDMAMANSLRRVMIAEIPTIAIDSVEVETNTSVLAD 60

Query: 61  EFIAHRLGLIPLQSADINDLVYCRDCYCEDHCDRCSVVLTLQAVGESESTTNVYAKDLVI 120
           EFI+HRLGL+PLQS+DINDL+YCRDCYCED+CDRCSVVLTLQAVGESESTTNVYAKDLVI
Sbjct: 61  EFISHRLGLVPLQSSDINDLIYCRDCYCEDNCDRCSVVLTLQAVGESESTTNVYAKDLVI 120

Query: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLKCIAKKGISKEHAKWSPASAIEFEY 180
           VSNL+GRNIGHPIIQDK+ NGVLICKLRKGQELKLKC+AKKGI+KEHAKWSPA+AIEFEY
Sbjct: 121 VSNLLGRNIGHPIIQDKDANGVLICKLRKGQELKLKCVAKKGIAKEHAKWSPAAAIEFEY 180

Query: 181 DPWNKLKHTDYWYEQDVAAEWPQSKNCEYEDPPNEDDVFDYNAKPNTFYMSVETVGSLTS 240
           DPWNKLKHTDYW+E D AAEWPQSKNCEYEDPPNEDD FDY AKP TFYM+VE+VGSLT 
Sbjct: 181 DPWNKLKHTDYWHETDAAAEWPQSKNCEYEDPPNEDDAFDYRAKPTTFYMNVESVGSLTV 240

Query: 241 DQVVIRGIKTLQDKVADILFSLKKMDQERVNFGGAGGNADNVDVAMDGENE--------M 292
           DQVVIRG+KTLQDKVADILFSLKKMDQ++VNFGGA G A+    AM  E E         
Sbjct: 241 DQVVIRGMKTLQDKVADILFSLKKMDQDKVNFGGAAGLAEQDGGAMAAEPESGFGYGNGG 300

Query: 293 SDPYTSNQDQYNGGPSAGFDDAW 315
           +       D +N GPS+GFDDAW
Sbjct: 301 AGGGPGAGDFHNSGPSSGFDDAW 323

>ADL120C Chr4 complement(477033..477968) [936 bp, 311 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL021W
           (RPB3)
          Length = 311

 Score =  521 bits (1343), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 246/318 (77%), Positives = 282/318 (88%), Gaps = 10/318 (3%)

Query: 1   MTEEGPQVKIREATKDSVDFILSNVDIALANSFRRVMIAEIPTLAIDSVEVETNTTVLAD 60
           M+EEGPQVKIREATKD+VDFILSNVD++LANS RR+MIAEIPTLAIDSVE+E+NT+VLAD
Sbjct: 1   MSEEGPQVKIREATKDNVDFILSNVDLSLANSLRRIMIAEIPTLAIDSVEIESNTSVLAD 60

Query: 61  EFIAHRLGLIPLQSADINDLVYCRDCYCEDHCDRCSVVLTLQAVGESESTTNVYAKDLVI 120
           EFI+HRLGL+PLQS DI+ LVYCRDC+CEDHCDRCSV+LTL AVGESESTTNVYAKDL I
Sbjct: 61  EFISHRLGLVPLQSKDIDQLVYCRDCFCEDHCDRCSVLLTLHAVGESESTTNVYAKDLQI 120

Query: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLKCIAKKGISKEHAKWSPASAIEFEY 180
           VS+L G+NIGHPIIQDKE NGVLICKLRKGQEL+LKC+AKKGI+KEHAKWSPA+AIEFEY
Sbjct: 121 VSDLGGKNIGHPIIQDKEANGVLICKLRKGQELRLKCVAKKGIAKEHAKWSPAAAIEFEY 180

Query: 181 DPWNKLKHTDYWYEQDVAAEWPQSKNCEYEDPPNEDDVFDYNAKPNTFYMSVETVGSLTS 240
           DPWNKL+HTDYW+EQD  AEWP SKNCE+EDPPNEDD FDY+AKPNTFYM+VE+VGS+ S
Sbjct: 181 DPWNKLRHTDYWHEQDPEAEWPHSKNCEFEDPPNEDDQFDYSAKPNTFYMNVESVGSIPS 240

Query: 241 DQVVIRGIKTLQDKVADILFSLKKMDQERVNFGGAGGNADNVDVAMDGENEMSDPYTSNQ 300
           DQVVIRGIKTLQDKVADILFSLKKMDQ++V FGG  G+A  ++V         DPY++  
Sbjct: 241 DQVVIRGIKTLQDKVADILFSLKKMDQDKVAFGGPTGDAAPMEVDQ-------DPYSATS 293

Query: 301 ---DQYNGGPSAGFDDAW 315
              ++YN    A +DDAW
Sbjct: 294 GRFNEYNDNAHAAYDDAW 311

>Ecym_4382 Chr4 (803602..804537) [936 bp, 311 aa] {ON} similar to
           Ashbya gossypii ADL120C
          Length = 311

 Score =  520 bits (1339), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 247/318 (77%), Positives = 281/318 (88%), Gaps = 10/318 (3%)

Query: 1   MTEEGPQVKIREATKDSVDFILSNVDIALANSFRRVMIAEIPTLAIDSVEVETNTTVLAD 60
           M+EEGPQVKIREATKD+VDFILSNVD++LANS RR+MIAEIPTLAIDSVE+ETNT+VLAD
Sbjct: 1   MSEEGPQVKIREATKDNVDFILSNVDLSLANSLRRIMIAEIPTLAIDSVEIETNTSVLAD 60

Query: 61  EFIAHRLGLIPLQSADINDLVYCRDCYCEDHCDRCSVVLTLQAVGESESTTNVYAKDLVI 120
           EFI+HRLGLIPLQS DI+ LVYCRDCYCEDHCDRCSVVLTLQAVGESESTTNVYAKDL I
Sbjct: 61  EFISHRLGLIPLQSKDIDQLVYCRDCYCEDHCDRCSVVLTLQAVGESESTTNVYAKDLQI 120

Query: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLKCIAKKGISKEHAKWSPASAIEFEY 180
           VS+L G+NIGHPIIQDKE NG+L+CKLRKGQEL+LKC+AKKGISKEHAKWSPA+AIEFEY
Sbjct: 121 VSDLGGKNIGHPIIQDKEANGILVCKLRKGQELRLKCVAKKGISKEHAKWSPAAAIEFEY 180

Query: 181 DPWNKLKHTDYWYEQDVAAEWPQSKNCEYEDPPNEDDVFDYNAKPNTFYMSVETVGSLTS 240
           DPWNKLKHTDYW+EQD  +EWP SKNCE+EDP N+DDVFDY+AKPN FY++VE+VGS+TS
Sbjct: 181 DPWNKLKHTDYWFEQDATSEWPHSKNCEFEDPLNDDDVFDYSAKPNIFYINVESVGSITS 240

Query: 241 DQVVIRGIKTLQDKVADILFSLKKMDQERVNFGGAGGNADNVDVAMDGENEMSDPYTSNQ 300
           DQVVIRGIKTLQDKVADILFSLKKMDQ++V FGG    ++N  + +D      DPY+   
Sbjct: 241 DQVVIRGIKTLQDKVADILFSLKKMDQDKVAFGGP--TSENAPMEVD-----HDPYSGTN 293

Query: 301 DQ---YNGGPSAGFDDAW 315
            Q   YN   +  +DDAW
Sbjct: 294 GQYNEYNDNTNTAYDDAW 311

>TDEL0H02530 Chr8 (425329..426264) [936 bp, 311 aa] {ON} Anc_7.194
           YIL021W
          Length = 311

 Score =  518 bits (1335), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 249/320 (77%), Positives = 277/320 (86%), Gaps = 14/320 (4%)

Query: 1   MTEEGPQVKIREATKDSVDFILSNVDIALANSFRRVMIAEIPTLAIDSVEVETNTTVLAD 60
           M+E GPQVKIREATKD+VDFILS VD+A+ANS RR+M+AEIPTLAIDSVE+ETNTTVLAD
Sbjct: 1   MSETGPQVKIREATKDNVDFILSQVDLAMANSLRRIMMAEIPTLAIDSVEIETNTTVLAD 60

Query: 61  EFIAHRLGLIPLQSADINDLVYCRDCYCEDHCDRCSVVLTLQAVGESESTTNVYAKDLVI 120
           EFIAHRLGLIPLQS DI  L YCRDC+CEDHCD+CSVVLTLQA+GESESTTNVYAKDLVI
Sbjct: 61  EFIAHRLGLIPLQSTDIEQLEYCRDCFCEDHCDKCSVVLTLQAIGESESTTNVYAKDLVI 120

Query: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLKCIAKKGISKEHAKWSPASAIEFEY 180
           VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQEL +KC+AKKGISKEHAKW PA+AIEFEY
Sbjct: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELSMKCVAKKGISKEHAKWGPAAAIEFEY 180

Query: 181 DPWNKLKHTDYWYEQDVAAEWPQSKNCEYEDPPNEDDVFDYNAKPNTFYMSVETVGSLTS 240
           DPWNKLKHTDYWYEQD++ EWP SKN EYEDPPN+DD FDY AK NTFYM+VETVGS+ +
Sbjct: 181 DPWNKLKHTDYWYEQDISKEWPLSKNSEYEDPPNKDDAFDYKAKANTFYMNVETVGSIAT 240

Query: 241 DQVVIRGIKTLQDKVADILFSLKKMDQERVNFG-----GAGGNADNVDVAMDGENEMSDP 295
           DQVV+RGI TLQ KVA IL +L +MDQERVNFG     GA  +A NVDVAMDG  +  +P
Sbjct: 241 DQVVLRGIDTLQKKVASILLALNQMDQERVNFGTANNTGAIQDAGNVDVAMDGVQD-QNP 299

Query: 296 YTSNQDQYNGGPSAGFDDAW 315
           Y+      NGG    +D+AW
Sbjct: 300 YS------NGG--GAYDEAW 311

>KLLA0D16170g Chr4 complement(1362809..1363732) [924 bp, 307 aa]
           {ON} highly similar to uniprot|P16370 Saccharomyces
           cerevisiae YIL021W
          Length = 307

 Score =  518 bits (1334), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 250/317 (78%), Positives = 280/317 (88%), Gaps = 12/317 (3%)

Query: 1   MTEEGPQVKIREATKDSVDFILSNVDIALANSFRRVMIAEIPTLAIDSVEVETNTTVLAD 60
           M+EEGPQVKIREATKD+VDFILSNVD+ALANS RRVMI+EIPTLAIDSVE+ETNTTVLAD
Sbjct: 1   MSEEGPQVKIREATKDNVDFILSNVDLALANSLRRVMISEIPTLAIDSVEIETNTTVLAD 60

Query: 61  EFIAHRLGLIPLQSADINDLVYCRDCYCEDHCDRCSVVLTLQAVGESESTTNVYAKDLVI 120
           EFIAHRLGLIPLQSADI+ +VYCRDCYCEDHCDRCSV L L A+GESESTTNVYAKDL I
Sbjct: 61  EFIAHRLGLIPLQSADIDQVVYCRDCYCEDHCDRCSVELILHAIGESESTTNVYAKDLQI 120

Query: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLKCIAKKGISKEHAKWSPASAIEFEY 180
            S+L GRNIGHPIIQD+E NGVLICKLRKGQE+++KCIAKKGISKEHAKWSP++AIEFEY
Sbjct: 121 TSDLKGRNIGHPIIQDREANGVLICKLRKGQEIRVKCIAKKGISKEHAKWSPSAAIEFEY 180

Query: 181 DPWNKLKHTDYWYEQDVAAEWPQSKNCEYEDPPNEDDVFDYNAKPNTFYMSVETVGSLTS 240
           DPWNKLKHTDYWYEQD   EWPQSKNCE+EDPPNED+ FDY AKPNTFY++VE+VGS+TS
Sbjct: 181 DPWNKLKHTDYWYEQDARDEWPQSKNCEFEDPPNEDEDFDYRAKPNTFYINVESVGSITS 240

Query: 241 DQVVIRGIKTLQDKVADILFSLKKMDQERVNFGGAGGNADNVDVAMDGENEMSDPYTSNQ 300
           +QVV+RGIKTLQDKVADILFSLKKMDQE+VNF  AG  + +V   +  E +M DPY    
Sbjct: 241 EQVVVRGIKTLQDKVADILFSLKKMDQEKVNF-AAGAVSTHVSQQVPMEEDM-DPY---- 294

Query: 301 DQYNGGP--SAGFDDAW 315
               GGP   +G+DDAW
Sbjct: 295 ----GGPVGGSGYDDAW 307

>Suva_9.178 Chr9 (300119..301078) [960 bp, 319 aa] {ON} YIL021W
           (REAL)
          Length = 319

 Score =  510 bits (1314), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 242/321 (75%), Positives = 271/321 (84%), Gaps = 8/321 (2%)

Query: 1   MTEEGPQVKIREATKDSVDFILSNVDIALANSFRRVMIAEIPTLAIDSVEVETNTTVLAD 60
           M+EEGPQVKIREA+KD+VDFIL++VD+A+ANS RR+MIAEIPTLAIDSVEVETNTTVLAD
Sbjct: 1   MSEEGPQVKIREASKDNVDFILTSVDLAMANSLRRIMIAEIPTLAIDSVEVETNTTVLAD 60

Query: 61  EFIAHRLGLIPLQSADINDLVYCRDCYCEDHCDRCSVVLTLQAVGESESTTNVYAKDLVI 120
           EFIAHRLGLIPLQS DI  L Y RDC+CEDHCD+CSVVLTLQA GESESTTNVYAKDLVI
Sbjct: 61  EFIAHRLGLIPLQSLDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYAKDLVI 120

Query: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLKCIAKKGISKEHAKWSPASAIEFEY 180
           VSNL+GRNIGHP+IQDKEGNGVLICKLRKGQELKL C+AKKGI+KEHAKW PA+AIEFEY
Sbjct: 121 VSNLLGRNIGHPVIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKEHAKWGPAAAIEFEY 180

Query: 181 DPWNKLKHTDYWYEQDVAAEWPQSKNCEYEDPPNEDDVFDYNAKPNTFYMSVETVGSLTS 240
           DPWNKLKHTDYWYEQD A EWPQSKNCEYEDPPNE D FDY A+ +TFYM+VE+VGS+T 
Sbjct: 181 DPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDAFDYKAEADTFYMNVESVGSITV 240

Query: 241 DQVVIRGIKTLQDKVADILFSLKKMDQERVNFGGAGGN------ADNVDVAMDGENEMSD 294
           DQVV+RGI TLQ KVA IL +L +MDQ++VNF     N        N DV M G  +  D
Sbjct: 241 DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNNVASNMLGTNEDVMMTGAEQ--D 298

Query: 295 PYTSNQDQYNGGPSAGFDDAW 315
           PY +     N G S G+D+AW
Sbjct: 299 PYANASQMGNTGSSGGYDNAW 319

>Skud_9.148 Chr9 (282540..283496) [957 bp, 318 aa] {ON} YIL021W
           (REAL)
          Length = 318

 Score =  509 bits (1311), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 247/321 (76%), Positives = 271/321 (84%), Gaps = 9/321 (2%)

Query: 1   MTEEGPQVKIREATKDSVDFILSNVDIALANSFRRVMIAEIPTLAIDSVEVETNTTVLAD 60
           M+EEGPQVKIREA+KD VDFILSNVD+A+ANS RRVMIAEIPTLAIDSVEVETNTTVLAD
Sbjct: 1   MSEEGPQVKIREASKDGVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLAD 60

Query: 61  EFIAHRLGLIPLQSADINDLVYCRDCYCEDHCDRCSVVLTLQAVGESESTTNVYAKDLVI 120
           EFIAHRLGLIPLQS DI  L Y RDC+CEDHCD+CSVVLTLQA GESESTTNVY+KDLVI
Sbjct: 61  EFIAHRLGLIPLQSMDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYSKDLVI 120

Query: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLKCIAKKGISKEHAKWSPASAIEFEY 180
           VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKL C+AKKGI+KEHAKW PA+AIEFEY
Sbjct: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKEHAKWGPAAAIEFEY 180

Query: 181 DPWNKLKHTDYWYEQDVAAEWPQSKNCEYEDPPNEDDVFDYNAKPNTFYMSVETVGSLTS 240
           DPWNKLKHTDYWYEQD A EWPQSKNCEYEDPPNE D FDY A+ +TFYM+VE+VGS+  
Sbjct: 181 DPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDPFDYKAEADTFYMNVESVGSIPV 240

Query: 241 DQVVIRGIKTLQDKVADILFSLKKMDQERVNFGGAGGNA------DNVDVAMDGENEMSD 294
           DQVV+RGI TLQ KVA IL +L +MDQ++VNF     NA       N DV M G  +  D
Sbjct: 241 DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNNAAPNMLGTNEDVVMTGAEQ--D 298

Query: 295 PYTSNQDQYNGGPSAGFDDAW 315
           PY SN  Q     S+G+D+AW
Sbjct: 299 PY-SNASQMGNTGSSGYDNAW 318

>YIL021W Chr9 (312905..313861) [957 bp, 318 aa] {ON}  RPB3RNA
           polymerase II third largest subunit B44, part of central
           core; similar to prokaryotic alpha subunit
          Length = 318

 Score =  508 bits (1308), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 246/321 (76%), Positives = 270/321 (84%), Gaps = 9/321 (2%)

Query: 1   MTEEGPQVKIREATKDSVDFILSNVDIALANSFRRVMIAEIPTLAIDSVEVETNTTVLAD 60
           M+EEGPQVKIREA+KD+VDFILSNVD+A+ANS RRVMIAEIPTLAIDSVEVETNTTVLAD
Sbjct: 1   MSEEGPQVKIREASKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLAD 60

Query: 61  EFIAHRLGLIPLQSADINDLVYCRDCYCEDHCDRCSVVLTLQAVGESESTTNVYAKDLVI 120
           EFIAHRLGLIPLQS DI  L Y RDC+CEDHCD+CSVVLTLQA GESESTTNVY+KDLVI
Sbjct: 61  EFIAHRLGLIPLQSMDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYSKDLVI 120

Query: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLKCIAKKGISKEHAKWSPASAIEFEY 180
           VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKL C+AKKGI+KEHAKW PA+AIEFEY
Sbjct: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKEHAKWGPAAAIEFEY 180

Query: 181 DPWNKLKHTDYWYEQDVAAEWPQSKNCEYEDPPNEDDVFDYNAKPNTFYMSVETVGSLTS 240
           DPWNKLKHTDYWYEQD A EWPQSKNCEYEDPPNE D FDY A+ +TFYM+VE+VGS+  
Sbjct: 181 DPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDPFDYKAQADTFYMNVESVGSIPV 240

Query: 241 DQVVIRGIKTLQDKVADILFSLKKMDQERVNFGGAGGN------ADNVDVAMDGENEMSD 294
           DQVV+RGI TLQ KVA IL +L +MDQ++VNF     N        N DV M G  +  D
Sbjct: 241 DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNNTASNMLGSNEDVMMTGAEQ--D 298

Query: 295 PYTSNQDQYNGGPSAGFDDAW 315
           PY SN  Q     S G+D+AW
Sbjct: 299 PY-SNASQMGNTGSGGYDNAW 318

>Smik_9.169 Chr9 (287469..288425) [957 bp, 318 aa] {ON} YIL021W
           (REAL)
          Length = 318

 Score =  504 bits (1297), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 245/321 (76%), Positives = 268/321 (83%), Gaps = 9/321 (2%)

Query: 1   MTEEGPQVKIREATKDSVDFILSNVDIALANSFRRVMIAEIPTLAIDSVEVETNTTVLAD 60
           M+EEGPQVKIREA+KD+VDFILSNVD+A+ANS RRVMIAEIPTLAIDSVEVETNTTVLAD
Sbjct: 1   MSEEGPQVKIREASKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLAD 60

Query: 61  EFIAHRLGLIPLQSADINDLVYCRDCYCEDHCDRCSVVLTLQAVGESESTTNVYAKDLVI 120
           EFIAHRLGLIPLQS DI  L Y RDC+CEDHCD+CSVVLTLQA GESESTTNVY+KDLVI
Sbjct: 61  EFIAHRLGLIPLQSMDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYSKDLVI 120

Query: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLKCIAKKGISKEHAKWSPASAIEFEY 180
           VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKL C+AKKGI+KEHAKW PA+AIEFEY
Sbjct: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKEHAKWGPAAAIEFEY 180

Query: 181 DPWNKLKHTDYWYEQDVAAEWPQSKNCEYEDPPNEDDVFDYNAKPNTFYMSVETVGSLTS 240
           DPWNKLKHTDYWYEQD A EWPQSKNCEYED PNE D FDY A+ +TFYM+VE+VGS+  
Sbjct: 181 DPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDAPNEGDPFDYKAEADTFYMNVESVGSIPV 240

Query: 241 DQVVIRGIKTLQDKVADILFSLKKMDQERVNFGGAGGN------ADNVDVAMDGENEMSD 294
           DQVV+RGI TLQ KVA IL +L +MDQ++VNF     N        N DV M G  +  D
Sbjct: 241 DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNNPSSNILGTNEDVMMAGAEQ--D 298

Query: 295 PYTSNQDQYNGGPSAGFDDAW 315
           PY SN  Q     S G+D AW
Sbjct: 299 PY-SNASQMGNSGSGGYDSAW 318

>KAFR0A02650 Chr1 (548878..549816) [939 bp, 312 aa] {ON} Anc_7.194
           YIL021W
          Length = 312

 Score =  503 bits (1295), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 243/316 (76%), Positives = 271/316 (85%), Gaps = 5/316 (1%)

Query: 1   MTEEGPQVKIREATKDSVDFILSNVDIALANSFRRVMIAEIPTLAIDSVEVETNTTVLAD 60
           M+EEGPQVKIREATKD+VDFILSNVD+A+ANS RRVMIAEIPTLAIDSVEVETNTTVLAD
Sbjct: 1   MSEEGPQVKIREATKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLAD 60

Query: 61  EFIAHRLGLIPLQSADINDLVYCRDCYCEDHCDRCSVVLTLQAVGESESTTNVYAKDLVI 120
           EFIAHRLGLIPLQS DI  L Y RDC+CEDHCD+CSVVLTLQAVGESESTTNVYAKDL I
Sbjct: 61  EFIAHRLGLIPLQSTDIEQLEYSRDCFCEDHCDKCSVVLTLQAVGESESTTNVYAKDLTI 120

Query: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLKCIAKKGISKEHAKWSPASAIEFEY 180
           VSNL+GRNIGHPIIQDKEGNGVLICKLRKGQELKL CIAKKGISKEHAKW PA+AIEFEY
Sbjct: 121 VSNLLGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCIAKKGISKEHAKWCPAAAIEFEY 180

Query: 181 DPWNKLKHTDYWYEQDVAAEWPQSKNCEYEDPPNEDDVFDYNAKPNTFYMSVETVGSLTS 240
           DPWNKLKHT+YWYEQD   EWP SKNCEYEDPPNE+D FDY AK +TFYM+VETVGS++ 
Sbjct: 181 DPWNKLKHTNYWYEQDPEKEWPNSKNCEYEDPPNENDPFDYKAKADTFYMNVETVGSISV 240

Query: 241 DQVVIRGIKTLQDKVADILFSLKKMDQERVNFG-GAGGNADNVDVAMDGENEMSDPYTSN 299
           DQVV+RG+ TLQ KVA IL +L +MDQE+VN+  GA  + +  D+AM G  +  D + SN
Sbjct: 241 DQVVVRGVDTLQKKVASILLALNQMDQEKVNYASGATADMNQGDIAMGGAEQ--DAFYSN 298

Query: 300 QDQYNGGPSAGFDDAW 315
               N   +  +D+AW
Sbjct: 299 MP--NSNANGIYDNAW 312

>NDAI0G02000 Chr7 (449842..450777) [936 bp, 311 aa] {ON} Anc_7.194
           YIL021W
          Length = 311

 Score =  496 bits (1276), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 242/320 (75%), Positives = 267/320 (83%), Gaps = 14/320 (4%)

Query: 1   MTEEGPQVKIREATKDSVDFILSNVDIALANSFRRVMIAEIPTLAIDSVEVETNTTVLAD 60
           M+EEGPQVKIREATKD+VDFILSN+D+ALANSFRRVMIAEIPTLAIDSV++ETNTTVLAD
Sbjct: 1   MSEEGPQVKIREATKDNVDFILSNIDLALANSFRRVMIAEIPTLAIDSVQIETNTTVLAD 60

Query: 61  EFIAHRLGLIPLQSADINDLVYCRDCYCEDHCDRCSVVLTLQAVGESESTTNVYAKDLVI 120
           EFIAHRLGLIPLQS DI  L Y RDC+CEDHCD+CSVVLTLQA GESESTTNVYAKDLVI
Sbjct: 61  EFIAHRLGLIPLQSTDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYAKDLVI 120

Query: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLKCIAKKGISKEHAKWSPASAIEFEY 180
           VSNL+GRNIGHPIIQDKE NGVLICKLRKGQELKL C+AKKGI+KEHAKW PA+AIEFEY
Sbjct: 121 VSNLLGRNIGHPIIQDKENNGVLICKLRKGQELKLTCVAKKGIAKEHAKWGPAAAIEFEY 180

Query: 181 DPWNKLKHTDYWYEQDVAAEWPQSKNCEYEDPPNEDDVFDYNAKPNTFYMSVETVGSLTS 240
           DPWNKLKHTDYWYEQD   EWP SKNCEYEDPPNE + FDY AK  TFYM+VETVGS++ 
Sbjct: 181 DPWNKLKHTDYWYEQDPQKEWPNSKNCEYEDPPNEGEPFDYKAKAETFYMNVETVGSISV 240

Query: 241 DQVVIRGIKTLQDKVADILFSLKKMDQERVNF-----GGAGGNADNVDVAMDGENEMSDP 295
           DQVV+RGI TLQ KVA IL +L +MDQE++ +     G  G N  N DV MDG     D 
Sbjct: 241 DQVVVRGINTLQQKVASILLALTQMDQEKMQYATVTEGQQGNNMMNQDVDMDG-----DA 295

Query: 296 YTSNQDQYNGGPSAGFDDAW 315
           Y +     N  P A ++DAW
Sbjct: 296 YANGA---NNQPGA-YNDAW 311

>CAGL0J02420g Chr10 complement(234977..235915) [939 bp, 312 aa] {ON}
           highly similar to uniprot|P16370 Saccharomyces
           cerevisiae YIL021w RPB3
          Length = 312

 Score =  495 bits (1275), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 241/319 (75%), Positives = 269/319 (84%), Gaps = 11/319 (3%)

Query: 1   MTEEGPQVKIREATKDSVDFILSNVDIALANSFRRVMIAEIPTLAIDSVEVETNTTVLAD 60
           M+EEGPQVKIREAT+D+VDFILSNVD+ALANS RRVMIAEIPTLAIDSVEVETNTTVLAD
Sbjct: 1   MSEEGPQVKIREATRDNVDFILSNVDLALANSLRRVMIAEIPTLAIDSVEVETNTTVLAD 60

Query: 61  EFIAHRLGLIPLQSADINDLVYCRDCYCEDHCDRCSVVLTLQAVGESESTTNVYAKDLVI 120
           EF+AHRLGLIPLQS DI  L Y RDC+CEDHCD+CSVVLTLQAVGESESTTNVYAKDL+I
Sbjct: 61  EFLAHRLGLIPLQSTDIEQLEYSRDCFCEDHCDKCSVVLTLQAVGESESTTNVYAKDLLI 120

Query: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLKCIAKKGISKEHAKWSPASAIEFEY 180
           VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKL CIAKKGI+KEHAKW PA+AIEFEY
Sbjct: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCIAKKGIAKEHAKWGPAAAIEFEY 180

Query: 181 DPWNKLKHTDYWYEQDVAAEWPQSKNCEYEDPPNEDDVFDYNAKPNTFYMSVETVGSLTS 240
           DPWNKL+HTDYWYE+D+  EWPQSKNCEYEDPPN+D+ FDY AK +TFYM+VE VGS+  
Sbjct: 181 DPWNKLQHTDYWYEEDIRKEWPQSKNCEYEDPPNDDEPFDYKAKADTFYMNVEAVGSIAV 240

Query: 241 DQVVIRGIKTLQDKVADILFSLKKMDQERVNFGGAGGNADNVDVAMDGENEMSD----PY 296
           DQVV+RGI TLQ KVA I+ +L +MDQE+VNF  A G+A    +  DG+  M +    PY
Sbjct: 241 DQVVLRGIDTLQKKVASIMLALNQMDQEKVNF--ATGDAKGNGIEEDGDAMMMNGHDGPY 298

Query: 297 TSNQDQYNGGPSAGFDDAW 315
                  NG  S  +  AW
Sbjct: 299 GD-----NGRSSDTYGSAW 312

>NCAS0E01830 Chr5 (355752..356708) [957 bp, 318 aa] {ON} Anc_7.194
           YIL021W
          Length = 318

 Score =  495 bits (1275), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 242/326 (74%), Positives = 267/326 (81%), Gaps = 19/326 (5%)

Query: 1   MTEEGPQVKIREATKDSVDFILSNVDIALANSFRRVMIAEIPTLAIDSVEVETNTTVLAD 60
           M+E GPQVKIREATKD+VDFILSNVD+ALANSFRRVMIAEIPTLAIDSV++ETNTTVLAD
Sbjct: 1   MSEAGPQVKIREATKDNVDFILSNVDLALANSFRRVMIAEIPTLAIDSVQIETNTTVLAD 60

Query: 61  EFIAHRLGLIPLQSADINDLVYCRDCYCEDHCDRCSVVLTLQAVGESESTTNVYAKDLVI 120
           EFIAHRLGLIPLQS DI  L Y RDC+CEDHCD+CSVVLTLQA GESESTTNVYAKDLVI
Sbjct: 61  EFIAHRLGLIPLQSLDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYAKDLVI 120

Query: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLKCIAKKGISKEHAKWSPASAIEFEY 180
           VSNL+GRNIGHPIIQD+EGNGVLICKLRKGQELK+ CIAKKGI+KEHAKW PA+AIEFEY
Sbjct: 121 VSNLLGRNIGHPIIQDREGNGVLICKLRKGQELKITCIAKKGIAKEHAKWGPAAAIEFEY 180

Query: 181 DPWNKLKHTDYWYEQDVAAEWPQSKNCEYEDPPNEDDVFDYNAKPNTFYMSVETVGSLTS 240
           DPWNKLKHTDYWYEQD   EWP SKNCEYEDPPNE ++FDY AK  TFYM+VETVGS+  
Sbjct: 181 DPWNKLKHTDYWYEQDATKEWPNSKNCEYEDPPNEGELFDYKAKAETFYMNVETVGSIPV 240

Query: 241 DQVVIRGIKTLQDKVADILFSLKKMDQERVNFG----GAGG-----NADNVDVAMDGENE 291
           DQVV+RG+ TLQ KVA IL +L +MDQE+VNF     G  G     N  + DV MDG  E
Sbjct: 241 DQVVVRGVDTLQKKVASILLALTQMDQEKVNFATNPNGVSGREGMMNGGDNDVNMDGGME 300

Query: 292 MSDPYTSNQDQYN--GGPSAGFDDAW 315
                   Q+ Y     P   +D+AW
Sbjct: 301 --------QNSYANVANPGGAYDNAW 318

>ZYRO0D15796g Chr4 complement(1319952..1320878) [927 bp, 308 aa]
           {ON} highly similar to uniprot|P16370 Saccharomyces
           cerevisiae YIL021W
          Length = 308

 Score =  489 bits (1258), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 234/317 (73%), Positives = 270/317 (85%), Gaps = 11/317 (3%)

Query: 1   MTEEGPQVKIREATKDSVDFILSNVDIALANSFRRVMIAEIPTLAIDSVEVETNTTVLAD 60
           M+EEGPQVKIREAT+++VDFILS+V++A+ANS RRVMIAEIPTLAIDSVEVETNT+VLAD
Sbjct: 1   MSEEGPQVKIREATRENVDFILSHVELAMANSLRRVMIAEIPTLAIDSVEVETNTSVLAD 60

Query: 61  EFIAHRLGLIPLQSADINDLVYCRDCYCEDHCDRCSVVLTLQAVGESESTTNVYAKDLVI 120
           EFIAHRLGLIPLQS DI  L YCRDC+CEDHCD+CSVVLTLQA+GESESTTNVYAKDLVI
Sbjct: 61  EFIAHRLGLIPLQSTDIEQLEYCRDCFCEDHCDKCSVVLTLQAIGESESTTNVYAKDLVI 120

Query: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLKCIAKKGISKEHAKWSPASAIEFEY 180
           VSNLMGRN+GHPIIQDKEGNGVLICKLRKGQEL LKC+AKKGI+KEHAKW P++AIEFEY
Sbjct: 121 VSNLMGRNLGHPIIQDKEGNGVLICKLRKGQELTLKCVAKKGIAKEHAKWGPSAAIEFEY 180

Query: 181 DPWNKLKHTDYWYEQDVAAEWPQSKNCEYEDPPNEDDVFDYNAKPNTFYMSVETVGSLTS 240
           DPWNKLKHT+YW+EQD A EWP SKN EYEDPPNE + FDY A  NTFYM+VE+VGSL++
Sbjct: 181 DPWNKLKHTEYWHEQDPAKEWPLSKNSEYEDPPNEGEPFDYRATANTFYMNVESVGSLST 240

Query: 241 DQVVIRGIKTLQDKVADILFSLKKMDQERVNF--GGAGGNADNVDVAMDGENEMSDPYTS 298
           DQVV+RGI TLQ KVA IL +L +MDQ++VNF  G   G   + D  M+G++    PY +
Sbjct: 241 DQVVLRGIDTLQKKVASILLALTQMDQDKVNFASGAPMGAVGDGDTMMNGDDY---PYGA 297

Query: 299 NQDQYNGGPSAGFDDAW 315
                  G S  +DD+W
Sbjct: 298 T------GGSGVYDDSW 308

>Kpol_1063.11 s1063 (29092..29787,29789..30043) [951 bp, 316 aa]
           {ON} (29092..29787,29789..30043) [951 nt, 317 aa]
          Length = 316

 Score =  487 bits (1254), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 239/320 (74%), Positives = 270/320 (84%), Gaps = 9/320 (2%)

Query: 1   MTEEGPQVKIREATKDSVDFILSNVDIALANSFRRVMIAEIPTLAIDSVEVETNTTVLAD 60
           M+EEGPQVKIREATKD+VDFILS+VD+ALANS RRVMIAEIPTLAIDSVEV TNTTVLAD
Sbjct: 1   MSEEGPQVKIREATKDNVDFILSHVDMALANSLRRVMIAEIPTLAIDSVEVITNTTVLAD 60

Query: 61  EFIAHRLGLIPLQSADINDLVYCRDCYCEDHCDRCSVVLTLQAVGESESTTNVYAKDLVI 120
           EFIAHRLGL+PLQS DI  L YCRDC+CEDHCD+CSVVLTLQAVGESESTTNVY+KDL I
Sbjct: 61  EFIAHRLGLVPLQSTDIEQLEYCRDCFCEDHCDKCSVVLTLQAVGESESTTNVYSKDLDI 120

Query: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLKCIAKKGISKEHAKWSPASAIEFEY 180
           VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKL CIAKKGISKEHAKW PA+AIEFEY
Sbjct: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCIAKKGISKEHAKWGPAAAIEFEY 180

Query: 181 DPWNKLKHTDYWYEQDVAAEWPQSKNCEYEDPPNEDDVFDYNAKPNTFYMSVETVGSLTS 240
           DPWNKLKHTD+W+EQD A EWPQSKNCEYEDPP+E +VFDY A+ + F    ETVG+++S
Sbjct: 181 DPWNKLKHTDFWFEQDPAKEWPQSKNCEYEDPPHEGEVFDYKAQADAFLYECETVGTISS 240

Query: 241 DQVVIRGIKTLQDKVADILFSLKKMDQERVNFG-----GAGGNADNVDVAMDGENEMSDP 295
           DQVV+RGI TLQ KVA IL +L +MDQ++V +      GAGG   N D+ M G    +DP
Sbjct: 241 DQVVLRGIDTLQKKVASILLALTQMDQDKVKYAGNTNIGAGGMEGNGDINMGGTG--NDP 298

Query: 296 YTSNQDQYNGGPSAGFDDAW 315
           Y++N  +     +  +DDAW
Sbjct: 299 YSNNGGEMG--GNGVYDDAW 316

>TBLA0J01520 Chr10 (344746..345753) [1008 bp, 335 aa] {ON} Anc_7.194
           YIL021W
          Length = 335

 Score =  487 bits (1254), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 233/312 (74%), Positives = 264/312 (84%), Gaps = 3/312 (0%)

Query: 1   MTEEGPQVKIREATKDSVDFILSNVDIALANSFRRVMIAEIPTLAIDSVEVETNTTVLAD 60
           M+EEGPQ+KIREATKD+VDFILSN+D+ALANS RRVMIAEIPTLAIDSVEVE NTTVLAD
Sbjct: 1   MSEEGPQIKIREATKDNVDFILSNIDMALANSLRRVMIAEIPTLAIDSVEVEMNTTVLAD 60

Query: 61  EFIAHRLGLIPLQSADINDLVYCRDCYCEDHCDRCSVVLTLQAVGESESTTNVYAKDLVI 120
           EFI+HRLGLIPLQSADI+ L YCRDC+CEDHCD+CSVVLTLQAVGESESTTNVYAKDLVI
Sbjct: 61  EFISHRLGLIPLQSADIDQLEYCRDCFCEDHCDKCSVVLTLQAVGESESTTNVYAKDLVI 120

Query: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLKCIAKKGISKEHAKWSPASAIEFEY 180
           VSNL+GRNIGHPIIQDKEGNGVLICKLRKGQELK+ C+AKKGI+KEHAKW   +AIE+EY
Sbjct: 121 VSNLLGRNIGHPIIQDKEGNGVLICKLRKGQELKMTCVAKKGIAKEHAKWGATAAIEYEY 180

Query: 181 DPWNKLKHTDYWYEQDVAAEWPQSKNCEYEDPPNEDDVFDYNAKPNTFYMSVETVGSLTS 240
           DPWNKLKHTDYWYE D   EWP SKNC+YEDPP E ++FDY AK NTFYM+VE VGS+T+
Sbjct: 181 DPWNKLKHTDYWYENDPLKEWPHSKNCQYEDPPTEGELFDYKAKANTFYMNVEAVGSITT 240

Query: 241 DQVVIRGIKTLQDKVADILFSLKKMDQERVNFGGAGGNADNVDV-AMDGENEMSDPYTSN 299
           DQV+IRGI TLQ K A IL +L +M+QE+VNFG   G  DN D+   D    MS+   ++
Sbjct: 241 DQVIIRGIDTLQKKTAGILLALSQMEQEKVNFG--TGTQDNNDLHQQDDHMGMSNGNDAS 298

Query: 300 QDQYNGGPSAGF 311
              Y G  + G 
Sbjct: 299 YGNYMGSNNDGM 310

>TPHA0C04510 Chr3 complement(973590..974522) [933 bp, 310 aa] {ON}
           Anc_7.194 YIL021W
          Length = 310

 Score =  480 bits (1235), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 231/311 (74%), Positives = 266/311 (85%), Gaps = 7/311 (2%)

Query: 1   MTEEGPQVKIREATKDSVDFILSNVDIALANSFRRVMIAEIPTLAIDSVEVETNTTVLAD 60
           M++EGPQVKIREATKD+VDFI+SNVD+A+AN+FRRVMIAEIPTLAIDSVEV +NTTVLAD
Sbjct: 1   MSDEGPQVKIREATKDNVDFIVSNVDLAMANAFRRVMIAEIPTLAIDSVEVISNTTVLAD 60

Query: 61  EFIAHRLGLIPLQSADINDLVYCRDCYCEDHCDRCSVVLTLQAVGESESTTNVYAKDLVI 120
           EFIAHRLGL+PLQSADI  L Y RDC+CEDHCD+CSVVLTLQA+GESESTTNVY+KDLVI
Sbjct: 61  EFIAHRLGLVPLQSADIEQLEYSRDCFCEDHCDKCSVVLTLQALGESESTTNVYSKDLVI 120

Query: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLKCIAKKGISKEHAKWSPASAIEFEY 180
           VS+L+GRNIGHPIIQDKEGNGVLICKLRKGQELK  CIAKKGI+KEHAKW PA+AIEFEY
Sbjct: 121 VSDLLGRNIGHPIIQDKEGNGVLICKLRKGQELKFTCIAKKGIAKEHAKWGPAAAIEFEY 180

Query: 181 DPWNKLKHTDYWYEQDVAAEWPQSKNCEYEDPPNEDDVFDYNAKPNTFYMSVETVGSLTS 240
           DPWNKLKHT+YWYEQD A EWPQSKNCEYEDPPNE   FDY AK +TFYM+VET+G++TS
Sbjct: 181 DPWNKLKHTEYWYEQDAAKEWPQSKNCEYEDPPNEGSEFDYKAKADTFYMNVETIGTVTS 240

Query: 241 DQVVIRGIKTLQDKVADILFSLKKMDQER----VNFGGAGGNADNVDVAMDGENEMSDPY 296
           DQV++RGI  LQ KVA IL +L ++DQ++     N     G  D  D+ M+G    +DPY
Sbjct: 241 DQVIVRGIDILQKKVASILLALNRLDQDKVNYAGNNNVNNGEMDGEDITMNGTE--NDPY 298

Query: 297 TS-NQDQYNGG 306
            S N + Y+G 
Sbjct: 299 ASGNNNSYDGA 309

>KNAG0H02700 Chr8 (498753..499733) [981 bp, 326 aa] {ON} Anc_7.194
           YIL021W
          Length = 326

 Score =  476 bits (1225), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 233/328 (71%), Positives = 260/328 (79%), Gaps = 15/328 (4%)

Query: 1   MTEEGPQVKIREATKDSVDFILSNVDIALANSFRRVMIAEIPTLAIDSVEVETNTTVLAD 60
           M EEGPQVKIREA +D+VDFILSNV++A+ANS RRVM+AEIPTLAIDSV+VETNTTVLAD
Sbjct: 1   MNEEGPQVKIREANRDNVDFILSNVELAMANSLRRVMVAEIPTLAIDSVQVETNTTVLAD 60

Query: 61  EFIAHRLGLIPLQSADINDLVYCRDCYCEDHCDRCSVVLTLQAVGESESTTNVYAKDLVI 120
           EFIAHRLGLIPLQS DI  L YCRDC+CEDHCD+CSVVLTLQAVGESESTTNVYAKDL I
Sbjct: 61  EFIAHRLGLIPLQSMDIERLEYCRDCFCEDHCDKCSVVLTLQAVGESESTTNVYAKDLTI 120

Query: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLKCIAKKGISKEHAKWSPASAIEFEY 180
           VSNLMGRNIGHPIIQDKE NGVLICKLRKGQELK+ CIAKKGI+KEHAKW P SAIEFEY
Sbjct: 121 VSNLMGRNIGHPIIQDKENNGVLICKLRKGQELKMTCIAKKGIAKEHAKWGPTSAIEFEY 180

Query: 181 DPWNKLKHTDYWYEQDVAAEWPQSKNCEYEDPPNEDDVFDYNAKPNTFYMSVETVGSLTS 240
           DPWNKLKHT YWYE D A EWP S+NCEYEDPP E + FDY +K  TFYM+VET+GS++ 
Sbjct: 181 DPWNKLKHTSYWYEVDAAQEWPNSENCEYEDPPVEGEPFDYKSKAETFYMNVETIGSISV 240

Query: 241 DQVVIRGIKTLQDKVADILFSLKKMDQERVNFGGAGGNADNVDVAMDGENEMSDPYTSNQ 300
           DQVV+RGI TLQ KVA IL SL +M+QE+ NF  A GN   ++  M         +    
Sbjct: 241 DQVVVRGIDTLQKKVASILLSLTQMEQEKTNF--AQGNVPGIEGNMINSGGADTGFAGGN 298

Query: 301 DQYNGGPSAG-------------FDDAW 315
           DQ    P+AG             +DDAW
Sbjct: 299 DQDMYVPNAGTGGNIGSGSGSGVYDDAW 326

>Kpol_1018.139 s1018 (370051..371058) [1008 bp, 335 aa] {ON}
           (370051..371058) [1008 nt, 336 aa]
          Length = 335

 Score =  100 bits (248), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 75/287 (26%), Positives = 131/287 (45%), Gaps = 43/287 (14%)

Query: 7   QVKIREATKDSVDFILSNVDIALANSFRRVMIAEIPTLAIDSVEVETNTTVLADEFIAHR 66
           ++ I        +F L N+D ++AN+FRR+MI+E+P++A++ V    NT+VL DE +AHR
Sbjct: 41  EINISSINSREANFDLINIDTSIANAFRRIMISEVPSVAVEYVYFLNNTSVLQDEVLAHR 100

Query: 67  LGLIPLQ-SADINDLVYCRDCYCEDHCDRCSVVLTLQAVGESE--------------STT 111
           +GL+PL+   D+   +       E   D  ++VL+L                       +
Sbjct: 101 IGLVPLKVDPDMLSWIDSELPEEEKFTDENTIVLSLNVKCTMNPDAPKDCTDPKILYKNS 160

Query: 112 NVYAKDLVIVSNLMGRNI----GHPIIQDKEGNGVLICKLRKGQELKLKCIAKKGISKEH 167
           NVYA+DL       G+ +     +P++       +L+CKLR GQE+ LK     GI  +H
Sbjct: 161 NVYARDLKFEP--QGKQVESFANYPVVP--ANPDILLCKLRPGQEISLKAHCILGIGSDH 216

Query: 168 AKWSPASAIEFEYDPWNKL----------KHTDYWY----------EQDVAAEWPQSKNC 207
           AK+SP +   +   P   +          K   Y+           E  V      + + 
Sbjct: 217 AKFSPVATASYRLMPHINITQPITGEDAKKFQKYFMPGVIGINDNGEAYVKDARKDTVSR 276

Query: 208 EYEDPPNEDDVFDYNAKPNTFYMSVETVGSLTSDQVVIRGIKTLQDK 254
           E    P  +         N F ++VE+ G++T +++  + ++ L++K
Sbjct: 277 EVFRHPEFEGKVKLGRVRNHFIVNVESTGAMTPEEIFFKSVRILRNK 323

>YPR110C Chr16 complement(745828..746835) [1008 bp, 335 aa] {ON}
           RPC40RNA polymerase subunit AC40, common to RNA
           polymerase I and III
          Length = 335

 Score = 94.0 bits (232), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 77/292 (26%), Positives = 131/292 (44%), Gaps = 52/292 (17%)

Query: 7   QVKIREATKDSVDFILSNVDIALANSFRRVMIAEIPTLAIDSVEVETNTTVLADEFIAHR 66
           +V I        +F L N+D ++AN+FRR+MI+E+P++A + V    NT+V+ DE +AHR
Sbjct: 41  EVNISSLDAREANFDLINIDTSIANAFRRIMISEVPSVAAEYVYFFNNTSVIQDEVLAHR 100

Query: 67  LGLIPLQSADINDLVYCRDCYCEDH--CDRCSVVLTLQA--------------VGESEST 110
           +GL+PL+  D + L +      +D    D  ++VL+L                  E  + 
Sbjct: 101 IGLVPLK-VDPDMLTWVDSNLPDDEKFTDENTIVLSLNVKCTRNPDAPKGSTDPKELYNN 159

Query: 111 TNVYAKDLVIVSNLMGRNIGH----PIIQDKEGNGVLICKLRKGQELKLKCIAKKGISKE 166
            +VYA+DL       GR        P++       +L+ KLR GQE+ LK     GI  +
Sbjct: 160 AHVYARDLKF--EPQGRQSTTFADCPVV--PADPDILLAKLRPGQEISLKAHCILGIGGD 215

Query: 167 HAKWSPASAIEFEYDPWNKL------------------------KHTDYWYEQDVAAEWP 202
           HAK+SP S   +   P   +                        + +D  Y +D   +  
Sbjct: 216 HAKFSPVSTASYRLLPQINILQPIKGESARRFQKCFPPGVIGIDEGSDEAYVKDARKDTV 275

Query: 203 QSKNCEYEDPPNEDDVFDYNAKPNTFYMSVETVGSLTSDQVVIRGIKTLQDK 254
             +   YE+     D        N F  +VE+ G++T +++  + ++ L++K
Sbjct: 276 SREVLRYEE---FADKVKLGRVRNHFIFNVESAGAMTPEEIFFKSVRILKNK 324

>ZYRO0C12364g Chr3 complement(976920..977927) [1008 bp, 335 aa] {ON}
           highly similar to uniprot|P07703 Saccharomyces
           cerevisiae YPR110C RPC40 RNA polymerase subunit common
           to RNA polymerase I and III
          Length = 335

 Score = 93.6 bits (231), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 73/291 (25%), Positives = 133/291 (45%), Gaps = 52/291 (17%)

Query: 8   VKIREATKDSVDFILSNVDIALANSFRRVMIAEIPTLAIDSVEVETNTTVLADEFIAHRL 67
           V+I   T+   +F L +VD ++AN+FRR+MI+E+P++A + V    NT+V+ DE +AHR+
Sbjct: 42  VRIGSLTEREANFDLVHVDTSIANAFRRIMISEVPSVATEYVYFLNNTSVIQDEVLAHRI 101

Query: 68  GLIPLQSADINDLVYCRDCYCEDH--CDRCSVVLTLQAVGESE--------------STT 111
           GL+PL+  D + L +      E+    D  ++V+TL                       +
Sbjct: 102 GLVPLK-VDPDMLTWVDHSLPEEEKFTDENTIVMTLNVKCTRNPDAPKDCTDPKILYRNS 160

Query: 112 NVYAKDLVIVSNLMGRNIGH----PIIQDKEGNGVLICKLRKGQELKLKCIAKKGISKEH 167
           ++YA+DL       G  +      P+I       +L+ KLR GQE+ L+     G+  +H
Sbjct: 161 HIYARDLKF--EPQGSQVETFAKCPVIPTDP--DILLAKLRPGQEISLRAHCILGVGSDH 216

Query: 168 AKWSPASAIEFEYDPWNKLKH------------------------TDYWYEQDVAAEWPQ 203
           AK+SP +   +   P   ++                         TD  Y QD   +   
Sbjct: 217 AKFSPVATASYRLLPHIDIREPIKGELAQKFQKCFPPGVIGINESTDEAYVQDARKDTVS 276

Query: 204 SKNCEYEDPPNEDDVFDYNAKPNTFYMSVETVGSLTSDQVVIRGIKTLQDK 254
            +   +E+  N+          + F  +VE+ G++T +++  + ++ L++K
Sbjct: 277 REVLRHEEFSNK---VKLGRVRDHFVFNVESTGAMTPEEIFFKSVRVLKNK 324

>Suva_16.438 Chr16 complement(753618..754625) [1008 bp, 335 aa] {ON}
           YPR110C (REAL)
          Length = 335

 Score = 93.6 bits (231), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 78/292 (26%), Positives = 131/292 (44%), Gaps = 52/292 (17%)

Query: 7   QVKIREATKDSVDFILSNVDIALANSFRRVMIAEIPTLAIDSVEVETNTTVLADEFIAHR 66
           +V I        +F L N+D ++AN+FRR+MI+E+P +A + V    NT+V+ DE +AHR
Sbjct: 41  EVNISSLDARDANFDLINIDTSIANAFRRIMISEVPAVAAEYVYFFNNTSVIQDEVLAHR 100

Query: 67  LGLIPLQSADINDLVYCRDCYCEDH--CDRCSVVLTLQAV------GESEST-------- 110
           +GL+PL+  D + L +      +D    D  +VVL+L            +ST        
Sbjct: 101 IGLVPLK-VDPDMLTWVDSSLPDDEKFTDENTVVLSLNVKCTRNLDAPKDSTDPKQLYNN 159

Query: 111 TNVYAKDLVIVSNLMGRN----IGHPIIQDKEGNGVLICKLRKGQELKLKCIAKKGISKE 166
            +VYA+DL       GR        P++       +L+ KLR GQE+ LK     G+  +
Sbjct: 160 AHVYARDLKF--EPQGRQSTTFANCPVL--PADPDILLAKLRPGQEISLKAHCILGVGGD 215

Query: 167 HAKWSPASAIEFEYDPWNKL------------------------KHTDYWYEQDVAAEWP 202
           HAK+SP S   +   P   +                        + +D  Y +D   +  
Sbjct: 216 HAKFSPVSTASYRLLPQIDILQPIKGESAKRFEKCFPPGVIGIDESSDEAYVKDARKDTV 275

Query: 203 QSKNCEYEDPPNEDDVFDYNAKPNTFYMSVETVGSLTSDQVVIRGIKTLQDK 254
             +   YE+     D        N F  +VE+ G++T +++  + ++ L++K
Sbjct: 276 SREVLRYEE---FTDKVKLGRVRNHFVFNVESAGAMTPEEIFFKSVRILKNK 324

>KNAG0A07600 Chr1 complement(1192867..1193871) [1005 bp, 334 aa]
           {ON} Anc_3.428 YPR110C
          Length = 334

 Score = 92.0 bits (227), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 76/293 (25%), Positives = 135/293 (46%), Gaps = 57/293 (19%)

Query: 8   VKIREATKDSVDFILSNVDIALANSFRRVMIAEIPTLAIDSVEVETNTTVLADEFIAHRL 67
           +KI   ++   +F L ++D ++AN+FRR+MI+E+P++A + V V  NT+V+ DE +AHR+
Sbjct: 42  IKISSMSEREANFDLVHIDTSVANAFRRIMISEVPSVAAEYVYVMNNTSVIQDEVLAHRI 101

Query: 68  GLIPLQSADINDLVYCRDCYCEDH--CDRCSVVLTLQAVGESE--------------STT 111
           G+IPL+  D + L +      E+    D  +VVLTL                       +
Sbjct: 102 GMIPLK-VDPDMLTWIDQSLSEEEKFTDENTVVLTLNVKCTRNLNAPKDCTDPKILYKNS 160

Query: 112 NVYAKDLVIVSNLMGRNIGH----PIIQDKEGNGVLICKLRKGQELKLKCIAKKGISKEH 167
           +VYA+DL       G+ +      P++       +L+ KLR  QE+ L+     GI  +H
Sbjct: 161 SVYARDLRF--EPQGKQLETFADCPVVPSDP--DILLAKLRPNQEISLRVHCILGIGSDH 216

Query: 168 AKWSPASAIEFEYDPW-NKLKHTDYWYEQDVAAEWPQS---------------------- 204
           AK+SP +   +   P  N L+       +   A +PQ                       
Sbjct: 217 AKFSPVATASYRLLPHINILEPITGESAKRFQACFPQGVIGIDSEGKAVVENARKDTVSR 276

Query: 205 ---KNCEYEDPPNEDDVFDYNAKPNTFYMSVETVGSLTSDQVVIRGIKTLQDK 254
              +  E++D      V D+      F  +VE+ G++T +++  + ++ L++K
Sbjct: 277 EVLRYEEFKDKVKLGRVRDH------FIFNVESTGAMTPEEIFFKSVRILKNK 323

>Smik_16.353 Chr16 complement(623974..624981) [1008 bp, 335 aa] {ON}
           YPR110C (REAL)
          Length = 335

 Score = 92.0 bits (227), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 75/292 (25%), Positives = 131/292 (44%), Gaps = 52/292 (17%)

Query: 7   QVKIREATKDSVDFILSNVDIALANSFRRVMIAEIPTLAIDSVEVETNTTVLADEFIAHR 66
           +V I        +F L N+D ++AN+FRR+MI+E+P++A + V    NT+V+ DE +AHR
Sbjct: 41  EVNISSLDAREANFDLINIDTSIANAFRRIMISEVPSVAAEYVYFFNNTSVIQDEVLAHR 100

Query: 67  LGLIPLQSADINDLVYCRDCYCEDH--CDRCSVVLTLQA--------------VGESEST 110
           +GL+PL+  D + L +      +D    D  ++VL+L                  E  + 
Sbjct: 101 IGLVPLK-VDPDMLTWVDSNLPDDEKFTDENTIVLSLNVKCTRNPDAPKGSTDPKELYNN 159

Query: 111 TNVYAKDLVIVSNLMGRN----IGHPIIQDKEGNGVLICKLRKGQELKLKCIAKKGISKE 166
            +VYA+DL       G+        P++       +L+ KLR GQE+ LK     GI  +
Sbjct: 160 AHVYARDLKF--EPQGKQSTTFADFPVV--PADPDILLAKLRPGQEISLKAHCILGIGGD 215

Query: 167 HAKWSPASAIEFEYDPWNKL------------------------KHTDYWYEQDVAAEWP 202
           HAK+SP S   +   P   +                        + +D  Y +D   +  
Sbjct: 216 HAKFSPVSTASYRLLPQINILQPIKGESARRFQKCFPPGVIGIDESSDEVYVKDARKDTV 275

Query: 203 QSKNCEYEDPPNEDDVFDYNAKPNTFYMSVETVGSLTSDQVVIRGIKTLQDK 254
             +   Y++     D        N F  +VE+ G++T +++  + ++ L++K
Sbjct: 276 SREVLRYDE---FADKVKLGRVRNHFIFNVESAGAMTPEEIFFKSVRILKNK 324

>KLTH0F12056g Chr6 (1016695..1017747) [1053 bp, 350 aa] {ON} highly
           similar to uniprot|P07703 Saccharomyces cerevisiae
           YPR110C RPC40 RNA polymerase subunit common to RNA
           polymerase I and III
          Length = 350

 Score = 92.0 bits (227), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 75/280 (26%), Positives = 124/280 (44%), Gaps = 53/280 (18%)

Query: 19  DFILSNVDIALANSFRRVMIAEIPTLAIDSVEVETNTTVLADEFIAHRLGLIPLQ-SADI 77
           +F L NVD ++AN+FRR+MIAE+P++A + V    NT+V+ DE +AHR+GL PL+   D+
Sbjct: 69  NFDLVNVDASIANAFRRIMIAEVPSVAAEYVYFFNNTSVIQDEVLAHRIGLTPLKVDPDM 128

Query: 78  NDLVYCRDCYCEDHCDRCSVVLTLQAVGESE--------------STTNVYAKDLVIVSN 123
              V       E   D  ++VLTL                        ++YA+DL     
Sbjct: 129 LSWVDTSVPEAERFTDENTIVLTLNVRCTRNPDAPKDCTDPKILYRNAHIYARDLKFEPQ 188

Query: 124 LMGRNI--GHPIIQDKEGNGVLICKLRKGQELKLKCIAKKGISKEHAKWSPASAIEFEYD 181
              R     +P++       +L+ KLR GQE+ L+     GI  +HAK+SP S   +   
Sbjct: 189 GKQRETFAKNPVVPADP--DILLAKLRPGQEISLRAHCVLGIGSDHAKFSPVSTASYRLM 246

Query: 182 PWNKLKHTDYWYEQDVAAEWPQS--------------------KNCEYEDPPNE---DDV 218
           P   +        Q +  E  Q                     K+  ++    E    + 
Sbjct: 247 PHINIT-------QPITGESAQRFAKCFSPGVIGINDNGEAFVKDARHDTVSREVLRHEE 299

Query: 219 FDYNAK----PNTFYMSVETVGSLTSDQVVIRGIKTLQDK 254
           F+   K     N F  +VE+ G++T +++  + ++ L++K
Sbjct: 300 FEGKVKLGRVKNHFIFNVESAGAMTPEEIFFKSVRILKNK 339

>Kpol_473.3 s473 complement(6708..7670) [963 bp, 320 aa] {ON}
           complement(6708..7670) [963 nt, 321 aa]
          Length = 320

 Score = 90.9 bits (224), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 75/294 (25%), Positives = 134/294 (45%), Gaps = 51/294 (17%)

Query: 4   EGPQVKIREATKDSVDFILSNVDIALANSFRRVMIAEIPTLAIDSVEVETNTTVLADEFI 63
           E  ++ I +  +   +  L NVD ++AN+ RR+MI+E+P++A + + +  NT+V+ DE I
Sbjct: 24  ENLEINISKVGERETNLDLINVDTSIANALRRIMISEVPSVAAEYIYILNNTSVIQDEVI 83

Query: 64  AHRLGLIPLQSADINDLVYCRDCYCEDH--CDRCSVVLTLQAVGESE------------- 108
           A R+GLIPL+  D + L +  +   ED    D  ++VL+L                    
Sbjct: 84  AQRIGLIPLK-VDPDRLTWLNNDLPEDEKFTDENTIVLSLNVKCTRNLDAPKDCTDPSIL 142

Query: 109 -STTNVYAKDLVIVSNLMGRN----IGHPIIQDKEGNGVLICKLRKGQELKLKCIAKKGI 163
               ++YA+DL       G+        P++       +LI KLR GQE+ L+     GI
Sbjct: 143 YHNAHIYARDLKFEPQ--GKQEETFADSPVVS--ADPDILIAKLRPGQEISLRAHCILGI 198

Query: 164 SKEHAKWSPASAIEFEYDP----WNKLK-------------------HTDYWYEQDVAAE 200
             +HAK+SP     +   P      K+K                     D  Y +D   +
Sbjct: 199 GADHAKFSPVCTASYRLMPKIIITEKIKGESAKRFQKCFPPGVIDINENDEAYVKDARKD 258

Query: 201 WPQSKNCEYEDPPNEDDVFDYNAKPNTFYMSVETVGSLTSDQVVIRGIKTLQDK 254
               +   +E+     D    +   N F  ++ETVG+++++++ ++ +K L++K
Sbjct: 259 TMTREVLRHEE---FQDKVKLDRVRNHFIFNIETVGAMSAEEIFLKSVKILKNK 309

>KLLA0D14861g Chr4 complement(1253023..1254027) [1005 bp, 334 aa]
           {ON} highly similar to uniprot|P07703 Saccharomyces
           cerevisiae YPR110C RPC40 RNA polymerase subunit common
           to RNA polymerase I and III
          Length = 334

 Score = 90.5 bits (223), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 79/288 (27%), Positives = 135/288 (46%), Gaps = 47/288 (16%)

Query: 8   VKIREATKDSVDFILSNVDIALANSFRRVMIAEIPTLAIDSVEVETNTTVLADEFIAHRL 67
           V+I    +  V+F L +VD ++AN+FRR+MI+E+P++A + V    NT+VL DE +AHR+
Sbjct: 42  VQIESLDEREVNFDLVHVDTSIANAFRRIMISEVPSVAPEYVYFFNNTSVLQDEVLAHRI 101

Query: 68  GLIPLQ-SADINDLVYCRDCYCEDHCDRCSVVLTLQ--------AVGESE------STTN 112
           GL+PL+   D+   V       E   D  ++V++L         A  + E         +
Sbjct: 102 GLVPLKVDPDMLSWVDTSLPESERFTDENTIVMSLNVKCTRNPDAPKDCEDPKVLYRNAH 161

Query: 113 VYAKDLVIVSNLMGRNIGH----PIIQDKEGNGVLICKLRKGQELKLKCIAKKGISKEHA 168
           +YA+DL       G+ +      P++       +L+ KLR GQE+ L+     GI  +HA
Sbjct: 162 IYARDLKF--EPQGKQVEQFAKCPVVA--ADPDILLAKLRPGQEISLRAHCILGIGADHA 217

Query: 169 KWSPASAIEFEYDPWNKL---------KHTDYWYEQDVAAEWPQSKNCEYEDPPNEDDV- 218
           K+SP S   +   P  ++         K     + + VA      K   Y   P +D V 
Sbjct: 218 KFSPVSTASYRLLPHIQITQPITGDDAKKFVKCFPKGVADV--NEKGEAYIKDPRKDTVS 275

Query: 219 --------FDYNAK----PNTFYMSVETVGSLTSDQVVIRGIKTLQDK 254
                   F    K     + F  +VE+ G++T +++  + ++ L++K
Sbjct: 276 REVLRHDEFQGKVKLGRVRDHFIFNVESSGAMTPEEIFFKSVRILKNK 323

>KAFR0A05520 Chr1 (1101190..1102194) [1005 bp, 334 aa] {ON}
           Anc_3.428 YPR110C
          Length = 334

 Score = 90.1 bits (222), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 78/304 (25%), Positives = 133/304 (43%), Gaps = 69/304 (22%)

Query: 3   EEGPQVKIREATKDSVDFILSNVDIALANSFRRVMIAEIPTLAIDSVEVETNTTVLADEF 62
            E   VKI    +   +F L ++D ++AN+FRR+MI+E+P +A++ V    NT+V+ DE 
Sbjct: 37  RESFDVKISSMNEREANFDLVHIDTSVANAFRRIMISEVPAVAVEYVYFLNNTSVIQDEV 96

Query: 63  IAHRLGLIPLQSADINDLVYCRDCYCEDH--CDRCSVVLTLQAVGESE------------ 108
           +AHR+GL+PL+  D + L +      +D    D  ++VLTL                   
Sbjct: 97  LAHRIGLVPLK-VDPDMLTWIDSSLPDDEKFTDENTIVLTLNVKCTRNPDAPRDCTDPNI 155

Query: 109 --STTNVYAKDLVIVSNLMGRNIGHPIIQDKEGNGVLIC-------KLRKGQELKLKCIA 159
               +NVYA DL       G+      ++    N V+ C       KLR GQE+ L+   
Sbjct: 156 LYRNSNVYASDLKF--EPQGKQ-----VETFANNAVVPCDPKILLAKLRPGQEISLRAHC 208

Query: 160 KKGISKEHAKWSPASAIEFEYDP---------------WNK--------LKHTDYWYEQD 196
             GI  +HAK+SP +   +   P               + K        +K     Y QD
Sbjct: 209 ILGIGSDHAKFSPVATASYRLLPHIEITEPITGESAKRFQKCFPAGVIGIKENGDAYVQD 268

Query: 197 VAAEWPQSKNCEYEDPPNEDDVFDYNAK------PNTFYMSVETVGSLTSDQVVIRGIKT 250
              +    +   +E         ++N K       + F  +VE+ G++T +++  + ++ 
Sbjct: 269 SRKDTVSREVYRHE---------EFNGKVKLGRIRDHFVFNVESTGAMTPEEIFFKSVRI 319

Query: 251 LQDK 254
           L++K
Sbjct: 320 LKNK 323

>NCAS0A11520 Chr1 complement(2279808..2280815) [1008 bp, 335 aa]
           {ON} Anc_3.428 YPR110C
          Length = 335

 Score = 89.4 bits (220), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 65/197 (32%), Positives = 102/197 (51%), Gaps = 27/197 (13%)

Query: 7   QVKIREATKDSVDFILSNVDIALANSFRRVMIAEIPTLAIDSVEVETNTTVLADEFIAHR 66
           +V+I    +   +F L N+D ++AN+FRR+MI+E+P +A + V    NT+V+ DE +AHR
Sbjct: 41  KVEISSLNEREANFDLINIDTSIANAFRRIMISEVPAVAAEYVYFLNNTSVIQDEVLAHR 100

Query: 67  LGLIPLQSADINDLVYCRDCYC--EDHCDRCSVVLTLQ--------AVGESESTTNVYAK 116
           +GLIPL+  D + L +  +     E   D  ++VLTL         A  ++     +Y  
Sbjct: 101 IGLIPLK-VDPDLLTWVDNELPDEEKFNDTNTIVLTLNVKCTRNPDAPKDATDPKILYRN 159

Query: 117 DLVIVSNL----MGRNI----GHPII---QDKEGNGVLICKLRKGQELKLKCIAKKGISK 165
             V  S+L     G+ I    G P++   QD     +L+ KLR GQE+ L+     G   
Sbjct: 160 SSVYASDLKFEPQGKQIETFAGTPVVPCDQD-----ILLAKLRPGQEISLRAHCILGTGG 214

Query: 166 EHAKWSPASAIEFEYDP 182
           +HAK+SP S   +   P
Sbjct: 215 DHAKFSPVSTASYRLLP 231

>TPHA0D03920 Chr4 complement(821790..822797) [1008 bp, 335 aa] {ON}
           Anc_3.428 YPR110C
          Length = 335

 Score = 89.4 bits (220), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 76/288 (26%), Positives = 133/288 (46%), Gaps = 47/288 (16%)

Query: 8   VKIREATKDSVDFILSNVDIALANSFRRVMIAEIPTLAIDSVEVETNTTVLADEFIAHRL 67
           + I   T+   +F L ++D ++AN+FRR+MIAE+P++A + V    NT+V+ DE +AHR+
Sbjct: 42  IHISSLTEKEANFDLVHIDTSIANAFRRIMIAEVPSVAAEYVYFMNNTSVIQDEVLAHRI 101

Query: 68  GLIPLQSADINDLVYCRDCYC--EDHCDRCSVVLTLQAV------GESEST--------T 111
           GLIPL+  D + L +        E   D  ++V+TL A          ++T         
Sbjct: 102 GLIPLR-VDPDKLSWIDSELPDEEKFTDENTIVITLDAKCTRNPDAPKDATDPKVLYRNA 160

Query: 112 NVYAKDLVIVSNLMGRNIGHPIIQDKEG--NGVLICKLRKGQELKLKCIAKKGISKEHAK 169
           +VYA+DL       G+       Q  E     +LI KLR GQE+ L+     GI  +HAK
Sbjct: 161 HVYARDLKF--EPQGKQAELFADQPVEAIDPDILIAKLRPGQEISLRAHCILGIGGDHAK 218

Query: 170 WSPASAIEFEYDPWNKLKHTDYWYEQDVAAEWPQSKNCEYEDPPNEDDVFDYNAKPNT-- 227
           +SP +   +   P   +         + A  + +          ++D+ F  +A+ +T  
Sbjct: 219 FSPVATASYRLLPHINITSP---ISGESAKRFQKCFPSGVIGINDKDEAFVKDARKDTVS 275

Query: 228 ---------------------FYMSVETVGSLTSDQVVIRGIKTLQDK 254
                                F  +VE+ G++T +++  + ++ L++K
Sbjct: 276 REVLRHEEFQNKVKLGRVRDHFVFNVESTGAMTPEEIFFKSVRILKNK 323

>TDEL0F03100 Chr6 complement(567682..568689) [1008 bp, 335 aa] {ON}
           Anc_3.428 YPR110C
          Length = 335

 Score = 89.4 bits (220), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 61/196 (31%), Positives = 98/196 (50%), Gaps = 27/196 (13%)

Query: 8   VKIREATKDSVDFILSNVDIALANSFRRVMIAEIPTLAIDSVEVETNTTVLADEFIAHRL 67
           V+I   T+   +F L ++D ++AN+FRR+MI+E+P+LA + V    NT+V+ DE +AHR+
Sbjct: 42  VQIESLTEREANFDLIHIDTSIANAFRRIMISEVPSLAPEHVYFLNNTSVIQDEVLAHRI 101

Query: 68  GLIPLQSADINDLVYCRDCYCEDH--CDRCSVVLTLQAVGESE--------------STT 111
           GL+PL+  D + L +      E+    D  ++VLTL                       +
Sbjct: 102 GLVPLK-VDPDMLTWVDSTLPEEERFTDENTIVLTLNVTCTRNPDAPKDCTDPKILYRNS 160

Query: 112 NVYAKDLVI-----VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLKCIAKKGISKE 166
           +VYA DL        + L  +    P   D     +L+ KLR GQE+ L+     G+  +
Sbjct: 161 SVYAHDLKFEPQGRQAELFAKCPVVPADPD-----ILLAKLRPGQEISLRAHCILGVGGD 215

Query: 167 HAKWSPASAIEFEYDP 182
           HAK+SP +   +   P
Sbjct: 216 HAKFSPVATASYRLLP 231

>Skud_16.397 Chr16 complement(710663..711670) [1008 bp, 335 aa] {ON}
           YPR110C (REAL)
          Length = 335

 Score = 89.4 bits (220), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 75/288 (26%), Positives = 126/288 (43%), Gaps = 44/288 (15%)

Query: 7   QVKIREATKDSVDFILSNVDIALANSFRRVMIAEIPTLAIDSVEVETNTTVLADEFIAHR 66
           +V I    +   +F L N+D ++AN+FRR+MI+E+P +A + V    NT+V+ DE +AHR
Sbjct: 41  KVNISSLDEREANFDLINIDASIANAFRRIMISEVPCVAAEYVYFFNNTSVIQDEVLAHR 100

Query: 67  LGLIPLQSADINDLVYCRDCYCEDH--CDRCSVVLTLQA--------------VGESEST 110
           +GL+PL+  D + L +      +D    D  ++VL+L                  E  + 
Sbjct: 101 IGLVPLK-VDPDMLTWVDSSLPDDEKFTDENTIVLSLNVKCTRNPDAPKDCTDPKELYNN 159

Query: 111 TNVYAKDLVIVSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLKCIAKKGISKEHAKW 170
            +VYA+DL                       +L+ KLR GQE+ LK     GI  +HAK+
Sbjct: 160 AHVYARDLKFEPQGRQSTTFAACSVVPADPDILLAKLRPGQEISLKAHCILGIGGDHAKF 219

Query: 171 SPASAIEFEYDPW-NKLKH-----------------------TDYWYEQDVAAEWPQSKN 206
           SP S   +   P  N L+                        +   Y +D   +    + 
Sbjct: 220 SPVSTASYRLLPQINILQSIKGESAKRFQKCFPPGVIGIDDTSREAYVKDARKDTVSREV 279

Query: 207 CEYEDPPNEDDVFDYNAKPNTFYMSVETVGSLTSDQVVIRGIKTLQDK 254
             YE+     D        N F  +VE+ G++T +++  + ++ L++K
Sbjct: 280 LRYEE---FADKVKLGRVRNHFIFNVESAGAMTPEEIFFKSVRILKNK 324

>NDAI0A04770 Chr1 (1091856..1092863) [1008 bp, 335 aa] {ON}
           Anc_3.428 YPR110C
          Length = 335

 Score = 88.6 bits (218), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 75/293 (25%), Positives = 135/293 (46%), Gaps = 52/293 (17%)

Query: 8   VKIREATKDSVDFILSNVDIALANSFRRVMIAEIPTLAIDSVEVETNTTVLADEFIAHRL 67
           V+I   ++   +F L N+D ++AN+FRR+MI+E+P++A + V   TNT+V+ DE +AHR+
Sbjct: 42  VQITSLSEREANFDLINIDTSMANAFRRIMISEVPSVAAEYVYFLTNTSVIQDEVLAHRI 101

Query: 68  GLIPLQSADINDLVYCRDCYCEDH--CDRCSVVLTLQAVGESE--------------STT 111
           G+IPL+  D + L +      E+    D  +VV++L                       +
Sbjct: 102 GMIPLK-VDPDMLSWIDTSLSEEEKFTDDNTVVMSLNIKCTRNLNAPKDCTDPKILYHNS 160

Query: 112 NVYAKDLVIVSNLMGRNIGH----PIIQDKEGNGVLICKLRKGQELKLKCIAKKGISKEH 167
           +VYAKDL       G+ +      P++       +L+ KLR  QE+ L+     G+  +H
Sbjct: 161 SVYAKDLKF--EPQGKQVETFAKCPVVPSDP--DILLAKLRPDQEISLRVHCILGVGGDH 216

Query: 168 AKWSPASAIEFEYDPW-NKLK-----------------------HTDYWYEQDVAAEWPQ 203
           AK+SP S   +   P  N LK                        T   Y +D   +   
Sbjct: 217 AKFSPVSTASYRLLPHINILKPITGEQAIKFQKCFLPGVIGINEETGEAYVKDARKDTVS 276

Query: 204 SKNCEYEDPPNEDDVFDYNAKPNTFYMSVETVGSLTSDQVVIRGIKTLQDKVA 256
            +   +E+    +D        + F  +VE+ G++T +++  + ++ L++K +
Sbjct: 277 REVLRHEE---FNDKVKLGRIRDHFIFNVESTGAMTPEEIFFKSVRILKNKAS 326

>Kwal_23.3998 s23 (519065..520069) [1005 bp, 334 aa] {ON} YPR110C
           (RPC40) - RNA polymerase III (C) subunit [contig 255]
           FULL
          Length = 334

 Score = 87.8 bits (216), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 61/194 (31%), Positives = 95/194 (48%), Gaps = 23/194 (11%)

Query: 8   VKIREATKDSVDFILSNVDIALANSFRRVMIAEIPTLAIDSVEVETNTTVLADEFIAHRL 67
           V+I    +   +F L NVD ++AN+FRR+MI+E+P++A + V    NT+V+ DE +AHR+
Sbjct: 42  VRISSLDEREANFDLVNVDASIANAFRRIMISEVPSVAPEYVYFFNNTSVIQDEVLAHRI 101

Query: 68  GLIPLQ-SADINDLVYCRDCYCEDHCDRCSVVLTLQAVGESE--------------STTN 112
           GL PL+   D+   V       E   D  ++VLTL                        +
Sbjct: 102 GLTPLKVDPDMLSWVDSSVPEAERFTDENTIVLTLNVKCTRNPDAPKDCTDPKILYRNAH 161

Query: 113 VYAKDLVIVSNLMGRNI----GHPIIQDKEGNGVLICKLRKGQELKLKCIAKKGISKEHA 168
           +YA+DL       G+ +     +P++       VL+ KLR GQE+ L+     GI  +HA
Sbjct: 162 IYARDLKF--EPQGKQLETFAKNPVV--PADPDVLLAKLRPGQEISLRAHCILGIGSDHA 217

Query: 169 KWSPASAIEFEYDP 182
           K+SP     +   P
Sbjct: 218 KFSPVCTASYRLMP 231

>ADR031C Chr4 complement(761933..763027) [1095 bp, 364 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR110C
           (RPC40)
          Length = 364

 Score = 87.8 bits (216), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 60/196 (30%), Positives = 99/196 (50%), Gaps = 25/196 (12%)

Query: 8   VKIREATKDSVDFILSNVDIALANSFRRVMIAEIPTLAIDSVEVETNTTVLADEFIAHRL 67
           V+I+   +   +F L  VD ++AN+FRR+MI+E+P++A + V    NT+V+ DE +AHR+
Sbjct: 72  VQIKSLDEREANFDLLRVDTSIANAFRRIMISEVPSVAPEYVYFFNNTSVIQDEVLAHRI 131

Query: 68  GLIPLQSADINDLVYCRDCY--CEDHCDRCSVVLTLQA--------------VGESESTT 111
           GL+PL+  D + L +        E   D  +VVL+L                  E     
Sbjct: 132 GLVPLK-VDPDMLTWVDKSLPEAERFTDENTVVLSLNVKCTHNPDAPKGSTDPKELYRNA 190

Query: 112 NVYAKDLVIVSNLMGRNIGH----PIIQDKEGNGVLICKLRKGQELKLKCIAKKGISKEH 167
           ++YA+DL       G+ +      P++       +L+ KLR GQE+ L+     GI  +H
Sbjct: 191 HIYARDLKFEPQ--GKQLETFAKCPVV--PADPDILLAKLRPGQEISLRVHCILGIGSDH 246

Query: 168 AKWSPASAIEFEYDPW 183
           AK+SP +   +   P+
Sbjct: 247 AKFSPVATASYRLMPY 262

>TBLA0F01700 Chr6 (423582..424583) [1002 bp, 333 aa] {ON} Anc_3.428
           YPR110C
          Length = 333

 Score = 87.0 bits (214), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 59/195 (30%), Positives = 97/195 (49%), Gaps = 25/195 (12%)

Query: 8   VKIREATKDSVDFILSNVDIALANSFRRVMIAEIPTLAIDSVEVETNTTVLADEFIAHRL 67
           +KI    +    F L N+D ++AN+FRR+M+AE+P +A + V    NT+V+ DE +AHR+
Sbjct: 42  IKISNLDERDATFDLINIDTSIANAFRRIMMAEVPAVAAEHVYFLNNTSVIQDEVLAHRI 101

Query: 68  GLIPLQSADINDLVYCRDCYCEDH--CDRCSVVLTLQAVGESE--------------STT 111
           GL+PL+  D + L +      E+    D  ++VL+L                     +  
Sbjct: 102 GLVPLK-VDPDMLTWVDQTLPEEERFTDENTIVLSLNVKCTKNDKAPKDCTDPKILYNNA 160

Query: 112 NVYAKDLVIVSNLMGRNI----GHPIIQDKEGNGVLICKLRKGQELKLKCIAKKGISKEH 167
           +VYA+DL       G+ +      P++       +L+ KLR GQE+ L+     GI  +H
Sbjct: 161 HVYARDLKF--EPQGKQVETFANCPVVPTDP--DILLAKLRPGQEISLRAHCILGIGSDH 216

Query: 168 AKWSPASAIEFEYDP 182
           AK+SP +   +   P
Sbjct: 217 AKFSPVATASYRLLP 231

>SAKL0F06028g Chr6 complement(453180..454184) [1005 bp, 334 aa] {ON}
           highly similar to uniprot|P07703 Saccharomyces
           cerevisiae YPR110C RPC40 RNA polymerase subunit common
           to RNA polymerase I and III
          Length = 334

 Score = 86.7 bits (213), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 59/195 (30%), Positives = 98/195 (50%), Gaps = 25/195 (12%)

Query: 8   VKIREATKDSVDFILSNVDIALANSFRRVMIAEIPTLAIDSVEVETNTTVLADEFIAHRL 67
           VKI    +   +F L ++D ++AN+FRR+MI+E+P++A + V    NT+V+ DE +AHR+
Sbjct: 42  VKISSLDEREANFDLIHIDTSIANAFRRIMISEVPSVAPEYVYFFNNTSVIQDEVLAHRI 101

Query: 68  GLIPLQSADINDLVYCRDCYCEDH--CDRCSVVLTLQAVGESE--------------STT 111
           GL+PL+  D + L +  +   E+    D  ++VLTL                       +
Sbjct: 102 GLVPLK-VDPDMLSWIDNSLTEEEKFTDENTIVLTLNVKCTRNPDAPKDCTDPKVLYRNS 160

Query: 112 NVYAKDLVIVSNLMGRNI----GHPIIQDKEGNGVLICKLRKGQELKLKCIAKKGISKEH 167
           N+YA+ L       G+ +      P++       +L+ KLR GQE+ L+     GI  +H
Sbjct: 161 NIYARHLKF--EPQGKQLETFAKSPVV--PADPDILLAKLRPGQEISLRAHCILGIGSDH 216

Query: 168 AKWSPASAIEFEYDP 182
           AK+SP     +   P
Sbjct: 217 AKFSPVCTASYRLMP 231

>Ecym_4450 Chr4 (921163..922167) [1005 bp, 334 aa] {ON} similar to
           Ashbya gossypii ADR031C
          Length = 334

 Score = 85.9 bits (211), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 57/195 (29%), Positives = 98/195 (50%), Gaps = 25/195 (12%)

Query: 8   VKIREATKDSVDFILSNVDIALANSFRRVMIAEIPTLAIDSVEVETNTTVLADEFIAHRL 67
           V+I        +F L ++D ++AN+FRR+MI+E+P++A + V    NT+V+ DE +AHR+
Sbjct: 42  VQISHLDDREANFDLIHIDASIANAFRRIMISEVPSVAAEYVYFFNNTSVIQDEVLAHRI 101

Query: 68  GLIPLQSADINDLVYCRDCY--CEDHCDRCSVVLTLQA--------------VGESESTT 111
           GL+PL+  D + L +        E   D  +VV++L                  E  +  
Sbjct: 102 GLVPLK-VDPDMLTWVDKSLPEAERFTDENTVVMSLNVKCTANPDAPKGSTDPKELYNNA 160

Query: 112 NVYAKDLVIVSNLMGRNI----GHPIIQDKEGNGVLICKLRKGQELKLKCIAKKGISKEH 167
           ++Y++DL       G+ +     HP++       +L+ KLR GQE+ L+     G+  +H
Sbjct: 161 HIYSRDLKF--EPQGKQLDSFAKHPVLPTDP--DILLAKLRPGQEISLRVHCILGVGGDH 216

Query: 168 AKWSPASAIEFEYDP 182
           AK+SP     +   P
Sbjct: 217 AKFSPVCTASYRLMP 231

>CAGL0B04125g Chr2 complement(401513..402517) [1005 bp, 334 aa] {ON}
           highly similar to uniprot|P07703 Saccharomyces
           cerevisiae YPR110c RPC40 DNA-directed RNA polymerase I
           III
          Length = 334

 Score = 81.6 bits (200), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 59/202 (29%), Positives = 104/202 (51%), Gaps = 39/202 (19%)

Query: 8   VKIREATKDSVDFILSNVDIALANSFRRVMIAEIPTLAIDSVEVETNTTVLADEFIAHRL 67
           +++    +  ++F +  +D +LAN+FRR+MIAE+P +A + V ++ NT+V+ DE +AHR+
Sbjct: 42  IQVSSHEERELNFDMIGIDTSLANAFRRIMIAEVPAVAPEYVYIQNNTSVIQDEVLAHRI 101

Query: 68  GLIPLQ----------SADINDLVYCRDCYCEDHCDRCSVVLTLQAVGESE--------- 108
           GL+PL+          ++D ++L        E H D+ ++V+TL                
Sbjct: 102 GLVPLKVDPEKLERLDTSDPDNL--------EFH-DKNTIVMTLNVKCTRNPDAPKDCTD 152

Query: 109 -----STTNVYAKDLVIV--SNLMGRNIGHPIIQ-DKEGNGVLICKLRKGQELKLKCIAK 160
                +  +VYA+DL     S+ +      P++  D +   +L+ KLR GQE+ L     
Sbjct: 153 PTILYNNAHVYARDLKFEPHSSQVETFADCPVVPCDPD---ILLAKLRPGQEISLSTHCI 209

Query: 161 KGISKEHAKWSPASAIEFEYDP 182
            G  K+HAK+SP +   +   P
Sbjct: 210 LGEGKDHAKFSPVATASYRLLP 231

>CAGL0G08954g Chr7 complement(857016..858788) [1773 bp, 590 aa] {ON}
           some similarities with uniprot|Q08157 Saccharomyces
           cerevisiae YOL019w TOS7
          Length = 590

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 35/82 (42%), Gaps = 7/82 (8%)

Query: 29  LANSFRRVMIAEIPTLAIDSVEVETNTTVLADEFIAHRLGLIPLQSADINDLVYCRDCYC 88
           +A   R VM   +  LA  S+      +V A  F  H++GL     A  N   Y    YC
Sbjct: 1   MAERKRTVMFLVVGLLAFISMAFFIIASVTAPAF--HQIGL-----AKSNGFTYGTLGYC 53

Query: 89  EDHCDRCSVVLTLQAVGESEST 110
           +D C R S     + + + E+T
Sbjct: 54  QDGCSRASASYHPETLDDDENT 75

>Kwal_14.783 s14 complement(44469..48311) [3843 bp, 1280 aa] {ON}
           YKL215C - Hypothetical ORF [contig 245] FULL
          Length = 1280

 Score = 30.8 bits (68), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 33/76 (43%), Gaps = 11/76 (14%)

Query: 213 PNEDDVFDYNAKPNTFYMSVETVG-----SLTSDQVVIRGIKTLQDKVADILFSLKKM-- 265
           PNED+  D     N F    +T+      + + DQ+    IK   + +A  + SL +   
Sbjct: 421 PNEDESLDLETTTNKFGELTQTINRDLGTTFSIDQIAYGFIKVANESMARPIRSLTEAKG 480

Query: 266 ----DQERVNFGGAGG 277
                 + V FGGAGG
Sbjct: 481 HVISSHQLVTFGGAGG 496

>TPHA0F00740 Chr6 (169745..171448) [1704 bp, 567 aa] {ON} Anc_4.125
           YAR002W
          Length = 567

 Score = 30.0 bits (66), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 24/100 (24%), Positives = 48/100 (48%), Gaps = 2/100 (2%)

Query: 201 WPQSKNCEYEDPPNEDDVFDYNAKPNTFYMSVETVGSLTSDQVVIRGIKTLQDKV-ADIL 259
            P  +N      P    +FDY+  P+T+  +V    SL S   V      +Q+K   + +
Sbjct: 199 LPSPRNLSLPIYPKRRRIFDYSRTPSTYRTTVLKYSSLPSSYTVSESTLPIQEKNDFNKV 258

Query: 260 FSLKKMDQERVNFGGAGGN-ADNVDVAMDGENEMSDPYTS 298
            S++K  ++  N   A  +  DN +  ++  +E+++PY++
Sbjct: 259 NSVQKKKKKISNTASALLSLLDNQESEVNESSELANPYSA 298

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.133    0.397 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 35,004,702
Number of extensions: 1552504
Number of successful extensions: 4297
Number of sequences better than 10.0: 54
Number of HSP's gapped: 4415
Number of HSP's successfully gapped: 56
Length of query: 315
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 206
Effective length of database: 40,982,805
Effective search space: 8442457830
Effective search space used: 8442457830
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 66 (30.0 bits)