Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0F06886g3.455ON1183118363110.0
Ecym_44043.455ON1196119331180.0
AGR251C3.455ON1193114729630.0
Kwal_55.204643.455ON1189118929140.0
KLTH0E05104g3.455ON1185118329020.0
Smik_16.3713.455ON1208120626970.0
NCAS0A116303.455ON1201115926750.0
YPR122W (AXL1)3.455ON1208120726560.0
Skud_16.4123.455ON1208121126460.0
TDEL0F034003.455ON1170118526050.0
Kpol_1050.883.455ON1213118226050.0
NDAI0A046503.455ON1199121226010.0
Suva_16.4513.455ON1218121625980.0
ZYRO0C06336g3.455ON1189115725870.0
KAFR0A053703.455ON1201121125350.0
TBLA0C054503.455ON1202116724230.0
KNAG0A077403.455ON1197120122980.0
KLLA0D15631g3.455ON1170116122620.0
TPHA0D040603.455ON1201116421740.0
CAGL0D04686g3.455ON1181118415370.0
NCAS0J014704.246ON9959704972e-50
KLLA0E05105g4.246ON10049604972e-50
TDEL0E012504.246ON9959694963e-50
KNAG0B060804.246ON9969644768e-48
TPHA0B022604.246ON10419384671e-46
Kwal_23.42374.246ON10019854661e-46
NDAI0J022404.246ON9999994642e-46
KLTH0D14278g4.246ON10019504624e-46
TBLA0I029404.246ON9655174349e-43
CAGL0H06457g4.246ON10084034294e-42
YLR389C (STE23)4.246ON10274614269e-42
SAKL0H03124g4.246ON10063974214e-41
Skud_12.4744.246ON10223994171e-40
ZYRO0B12320g4.246ON9944124171e-40
KAFR0A059704.246ON10114054162e-40
Smik_12.4764.246ON10254314125e-40
Suva_10.5064.246ON10232394117e-40
Kpol_1055.834.246ON10203954028e-39
AER053C4.246ON10132413778e-36
Ecym_32734.246ON10239973769e-36
TBLA0A080504.246ON9953993402e-31
KNAG0A027608.376ON4672371173e-05
KLTH0F08954g8.376ON4582251131e-04
Kwal_23.33458.376ON4582421094e-04
NDAI0G023208.376ON4632271084e-04
AGL138C8.376ON4702041050.001
KAFR0H020308.376ON4622271040.001
YLR163C (MAS1)8.376ON462217990.005
TBLA0H010108.376ON499232970.008
Smik_12.2258.376ON462204970.009
NCAS0C029708.376ON461211960.011
TPHA0C024508.376ON469217940.019
NCAS0C049503.93ON1032220930.031
Ecym_41918.376ON462237920.033
TDEL0F050008.376ON456237910.040
KLLA0D18095g8.376ON469243890.079
Skud_12.2308.376ON462217890.087
Suva_10.2608.376ON462204880.11
CAGL0H02739g8.376ON465204880.11
SAKL0H14168g8.376ON461233880.11
NDAI0G042803.93ON1034223860.21
TPHA0P010403.93ON1038183860.24
Kpol_1024.23singletonOFF454207850.26
Kpol_YGOB_1024.238.376ON464207850.26
KNAG0C031705.541ON994177840.34
SAKL0C10406g3.127ON49587810.71
ZYRO0C03806g8.376ON465237791.3
TDEL0D053103.93ON1035189791.6
ZYRO0C11088g5.268ON485130753.6
TBLA0A069405.541ON991115763.6
YKL203C (TOR2)1.515ON2474137763.8
KLTH0E05764g4.14ON310275746.3
TPHA0K017204.90ON811104737.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0F06886g
         (1183 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0F06886g Chr6 (524553..528104) [3552 bp, 1183 aa] {ON} simil...  2435   0.0  
Ecym_4404 Chr4 complement(840532..844122) [3591 bp, 1196 aa] {ON...  1205   0.0  
AGR251C Chr7 complement(1213371..1216952) [3582 bp, 1193 aa] {ON...  1145   0.0  
Kwal_55.20464 s55 complement(414783..418352) [3570 bp, 1189 aa] ...  1127   0.0  
KLTH0E05104g Chr5 complement(449481..453038) [3558 bp, 1185 aa] ...  1122   0.0  
Smik_16.371 Chr16 (659341..662967) [3627 bp, 1208 aa] {ON} YPR12...  1043   0.0  
NCAS0A11630 Chr1 (2311038..2314643) [3606 bp, 1201 aa] {ON} Anc_...  1035   0.0  
YPR122W Chr16 (782045..785671) [3627 bp, 1208 aa] {ON}  AXL1Hapl...  1027   0.0  
Skud_16.412 Chr16 (741265..744891) [3627 bp, 1208 aa] {ON} YPR12...  1023   0.0  
TDEL0F03400 Chr6 (628126..631638) [3513 bp, 1170 aa] {ON} Anc_3....  1008   0.0  
Kpol_1050.88 s1050 (199457..203098) [3642 bp, 1213 aa] {ON} (199...  1008   0.0  
NDAI0A04650 Chr1 complement(1046461..1050060) [3600 bp, 1199 aa]...  1006   0.0  
Suva_16.451 Chr16 (784213..787869) [3657 bp, 1218 aa] {ON} YPR12...  1005   0.0  
ZYRO0C06336g Chr3 (479075..482644) [3570 bp, 1189 aa] {ON} simil...  1001   0.0  
KAFR0A05370 Chr1 (1059317..1062922) [3606 bp, 1201 aa] {ON} Anc_...   981   0.0  
TBLA0C05450 Chr3 complement(1312984..1316592) [3609 bp, 1202 aa]...   937   0.0  
KNAG0A07740 Chr1 complement(1226949..1230542) [3594 bp, 1197 aa]...   889   0.0  
KLLA0D15631g Chr4 (1319185..1322697) [3513 bp, 1170 aa] {ON} sim...   875   0.0  
TPHA0D04060 Chr4 (867294..870899) [3606 bp, 1201 aa] {ON} Anc_3....   842   0.0  
CAGL0D04686g Chr4 (457938..461483) [3546 bp, 1181 aa] {ON} simil...   596   0.0  
NCAS0J01470 Chr10 complement(261880..264867) [2988 bp, 995 aa] {...   196   2e-50
KLLA0E05105g Chr5 (447645..450659) [3015 bp, 1004 aa] {ON} simil...   196   2e-50
TDEL0E01250 Chr5 (243919..246906) [2988 bp, 995 aa] {ON} Anc_4.2...   195   3e-50
KNAG0B06080 Chr2 complement(1197765..1200755) [2991 bp, 996 aa] ...   187   8e-48
TPHA0B02260 Chr2 (517138..520263) [3126 bp, 1041 aa] {ON} Anc_4....   184   1e-46
Kwal_23.4237 s23 (630432..633437) [3006 bp, 1001 aa] {ON} YLR389...   184   1e-46
NDAI0J02240 Chr10 complement(547488..550487) [3000 bp, 999 aa] {...   183   2e-46
KLTH0D14278g Chr4 complement(1172523..1175528) [3006 bp, 1001 aa...   182   4e-46
TBLA0I02940 Chr9 complement(699857..702754) [2898 bp, 965 aa] {O...   171   9e-43
CAGL0H06457g Chr8 (633721..636747) [3027 bp, 1008 aa] {ON} highl...   169   4e-42
YLR389C Chr12 complement(899577..902660) [3084 bp, 1027 aa] {ON}...   168   9e-42
SAKL0H03124g Chr8 (291984..295004) [3021 bp, 1006 aa] {ON} simil...   166   4e-41
Skud_12.474 Chr12 complement(839782..842850) [3069 bp, 1022 aa] ...   165   1e-40
ZYRO0B12320g Chr2 complement(996046..999030) [2985 bp, 994 aa] {...   165   1e-40
KAFR0A05970 Chr1 (1206007..1209042) [3036 bp, 1011 aa] {ON} Anc_...   164   2e-40
Smik_12.476 Chr12 complement(838321..841398) [3078 bp, 1025 aa] ...   163   5e-40
Suva_10.506 Chr10 complement(865239..868310) [3072 bp, 1023 aa] ...   162   7e-40
Kpol_1055.83 s1055 (216511..219573) [3063 bp, 1020 aa] {ON} (216...   159   8e-39
AER053C Chr5 complement(735402..738443) [3042 bp, 1013 aa] {ON} ...   149   8e-36
Ecym_3273 Chr3 (515048..518119) [3072 bp, 1023 aa] {ON} similar ...   149   9e-36
TBLA0A08050 Chr1 (1988388..1991375) [2988 bp, 995 aa] {ON} Anc_4...   135   2e-31
KNAG0A02760 Chr1 (301136..302539) [1404 bp, 467 aa] {ON} Anc_8.3...    50   3e-05
KLTH0F08954g Chr6 (770605..771981) [1377 bp, 458 aa] {ON} highly...    48   1e-04
Kwal_23.3345 s23 (253614..254990) [1377 bp, 458 aa] {ON} YLR163C...    47   4e-04
NDAI0G02320 Chr7 (518661..520052) [1392 bp, 463 aa] {ON} Anc_8.3...    46   4e-04
AGL138C Chr7 complement(453737..455149) [1413 bp, 470 aa] {ON} S...    45   0.001
KAFR0H02030 Chr8 (374862..376250) [1389 bp, 462 aa] {ON} Anc_8.3...    45   0.001
YLR163C Chr12 complement(491866..493254) [1389 bp, 462 aa] {ON} ...    43   0.005
TBLA0H01010 Chr8 (217060..218559) [1500 bp, 499 aa] {ON} Anc_8.3...    42   0.008
Smik_12.225 Chr12 complement(439006..440394) [1389 bp, 462 aa] {...    42   0.009
NCAS0C02970 Chr3 (558478..559863) [1386 bp, 461 aa] {ON} Anc_8.376     42   0.011
TPHA0C02450 Chr3 (545815..547224) [1410 bp, 469 aa] {ON} Anc_8.3...    41   0.019
NCAS0C04950 Chr3 complement(1009698..1012796) [3099 bp, 1032 aa]...    40   0.031
Ecym_4191 Chr4 (396094..397482) [1389 bp, 462 aa] {ON} similar t...    40   0.033
TDEL0F05000 Chr6 complement(942516..943886) [1371 bp, 456 aa] {O...    40   0.040
KLLA0D18095g Chr4 complement(1526808..1528217) [1410 bp, 469 aa]...    39   0.079
Skud_12.230 Chr12 complement(438565..439953) [1389 bp, 462 aa] {...    39   0.087
Suva_10.260 Chr10 complement(463944..465332) [1389 bp, 462 aa] {...    39   0.11 
CAGL0H02739g Chr8 (248511..249908) [1398 bp, 465 aa] {ON} highly...    39   0.11 
SAKL0H14168g Chr8 (1211470..1212855) [1386 bp, 461 aa] {ON} high...    39   0.11 
NDAI0G04280 Chr7 (1027206..1030310) [3105 bp, 1034 aa] {ON} Anc_...    38   0.21 
TPHA0P01040 Chr16 (208875..211991) [3117 bp, 1038 aa] {ON} Anc_3...    38   0.24 
Kpol_1024.23 s1024 (68467..69831) [1365 bp, 454 aa] {OFF} (68467...    37   0.26 
Kpol_YGOB_1024.23 s1024 (68437..69831) [1395 bp, 464 aa] {ON} AN...    37   0.26 
KNAG0C03170 Chr3 (625226..628210) [2985 bp, 994 aa] {ON} Anc_5.5...    37   0.34 
SAKL0C10406g Chr3 complement(946709..948196) [1488 bp, 495 aa] {...    36   0.71 
ZYRO0C03806g Chr3 complement(301873..303270) [1398 bp, 465 aa] {...    35   1.3  
TDEL0D05310 Chr4 (961842..964949) [3108 bp, 1035 aa] {ON} Anc_3....    35   1.6  
ZYRO0C11088g Chr3 complement(857314..858771) [1458 bp, 485 aa] {...    33   3.6  
TBLA0A06940 Chr1 complement(1694417..1697392) [2976 bp, 991 aa] ...    34   3.6  
YKL203C Chr11 complement(55935..63359) [7425 bp, 2474 aa] {ON}  ...    34   3.8  
KLTH0E05764g Chr5 complement(507436..516744) [9309 bp, 3102 aa] ...    33   6.3  
TPHA0K01720 Chr11 (363438..365873) [2436 bp, 811 aa] {ON} Anc_4....    33   7.4  

>SAKL0F06886g Chr6 (524553..528104) [3552 bp, 1183 aa] {ON} similar to
            uniprot|P40851 Saccharomyces cerevisiae YPR122W AXL1
            Haploid specific endoprotease that performs one of two
            N-terminal cleavages during maturation of a- factor
            mating pheromone required for axial budding pattern of
            haploid cells
          Length = 1183

 Score = 2435 bits (6311), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1183/1183 (100%), Positives = 1183/1183 (100%)

Query: 1    MSSFGVRNFDVQFYTPISCSSRSHRVIQLDNGMLVLLISNPAEKATSCALSVATGSHNDP 60
            MSSFGVRNFDVQFYTPISCSSRSHRVIQLDNGMLVLLISNPAEKATSCALSVATGSHNDP
Sbjct: 1    MSSFGVRNFDVQFYTPISCSSRSHRVIQLDNGMLVLLISNPAEKATSCALSVATGSHNDP 60

Query: 61   KEILGLAHFCEHMILSAGSKSYPDPNAYHDVISKNGGSQNAFTTGEQTTFCFELPNLSNS 120
            KEILGLAHFCEHMILSAGSKSYPDPNAYHDVISKNGGSQNAFTTGEQTTFCFELPNLSNS
Sbjct: 61   KEILGLAHFCEHMILSAGSKSYPDPNAYHDVISKNGGSQNAFTTGEQTTFCFELPNLSNS 120

Query: 121  DELVFDKVLDIFSSSFKKPLFNELLVNKEIYAINSEHTANKSSRDKIFYHATRLLANGDH 180
            DELVFDKVLDIFSSSFKKPLFNELLVNKEIYAINSEHTANKSSRDKIFYHATRLLANGDH
Sbjct: 121  DELVFDKVLDIFSSSFKKPLFNELLVNKEIYAINSEHTANKSSRDKIFYHATRLLANGDH 180

Query: 181  PFSQFSTGDITTLSDILQLNKVDLRTEVIKYFKNNFYAENMCLCIKGPQSLNTLGKLVFS 240
            PFSQFSTGDITTLSDILQLNKVDLRTEVIKYFKNNFYAENMCLCIKGPQSLNTLGKLVFS
Sbjct: 181  PFSQFSTGDITTLSDILQLNKVDLRTEVIKYFKNNFYAENMCLCIKGPQSLNTLGKLVFS 240

Query: 241  KFNDIKGLPISRPLRTKNQPWLKLKSRNFSNDGFGLGLESFKILSRNWLQKYGNVGIFTG 300
            KFNDIKGLPISRPLRTKNQPWLKLKSRNFSNDGFGLGLESFKILSRNWLQKYGNVGIFTG
Sbjct: 241  KFNDIKGLPISRPLRTKNQPWLKLKSRNFSNDGFGLGLESFKILSRNWLQKYGNVGIFTG 300

Query: 301  CDNHNTVLVDSQKLPALRLIFPIHHRLTRLTKKEIDLLSQCWCELFGDESEGSLCHFMKK 360
            CDNHNTVLVDSQKLPALRLIFPIHHRLTRLTKKEIDLLSQCWCELFGDESEGSLCHFMKK
Sbjct: 301  CDNHNTVLVDSQKLPALRLIFPIHHRLTRLTKKEIDLLSQCWCELFGDESEGSLCHFMKK 360

Query: 361  NDYITELTAFMSHFAVNDNALILELYLTNTGWKNLQMIVAVFFNKYVPIVIECGTYELAE 420
            NDYITELTAFMSHFAVNDNALILELYLTNTGWKNLQMIVAVFFNKYVPIVIECGTYELAE
Sbjct: 361  NDYITELTAFMSHFAVNDNALILELYLTNTGWKNLQMIVAVFFNKYVPIVIECGTYELAE 420

Query: 421  FLSELNCIELLKFLYQDVTLSSMEECSNLSSLLLTDIESLGPSFILKGNPMNDCNEIDSE 480
            FLSELNCIELLKFLYQDVTLSSMEECSNLSSLLLTDIESLGPSFILKGNPMNDCNEIDSE
Sbjct: 421  FLSELNCIELLKFLYQDVTLSSMEECSNLSSLLLTDIESLGPSFILKGNPMNDCNEIDSE 480

Query: 481  LGSFAESEESRMWWIGHAIKFQSFIKEFINFENVRLVLMGDLKECPLMKTDLTSLKLNIE 540
            LGSFAESEESRMWWIGHAIKFQSFIKEFINFENVRLVLMGDLKECPLMKTDLTSLKLNIE
Sbjct: 481  LGSFAESEESRMWWIGHAIKFQSFIKEFINFENVRLVLMGDLKECPLMKTDLTSLKLNIE 540

Query: 541  PYYEFEYHKCRSDQSNFKLTVEEISYSFHIPYKNVFLPSVGFNLSLIKNALLASSNRSQT 600
            PYYEFEYHKCRSDQSNFKLTVEEISYSFHIPYKNVFLPSVGFNLSLIKNALLASSNRSQT
Sbjct: 541  PYYEFEYHKCRSDQSNFKLTVEEISYSFHIPYKNVFLPSVGFNLSLIKNALLASSNRSQT 600

Query: 601  AALSLGSQNANPHVLPKLLGKNCFYEMWVKEEDFELTFKSKSIVTFEIISTHLNPEPSYT 660
            AALSLGSQNANPHVLPKLLGKNCFYEMWVKEEDFELTFKSKSIVTFEIISTHLNPEPSYT
Sbjct: 601  AALSLGSQNANPHVLPKLLGKNCFYEMWVKEEDFELTFKSKSIVTFEIISTHLNPEPSYT 660

Query: 661  MMLEILCELLGDMLSSQLYPSEKIGYTYEIAASSKGDVRIGFTVSGFSEGVYKIIEKIVG 720
            MMLEILCELLGDMLSSQLYPSEKIGYTYEIAASSKGDVRIGFTVSGFSEGVYKIIEKIVG
Sbjct: 661  MMLEILCELLGDMLSSQLYPSEKIGYTYEIAASSKGDVRIGFTVSGFSEGVYKIIEKIVG 720

Query: 721  TLVQIVYSEVVIARDLFRKSRIAVRNKYEEAASVNSTTLVNIGLLIVLEKYMWRLESRLE 780
            TLVQIVYSEVVIARDLFRKSRIAVRNKYEEAASVNSTTLVNIGLLIVLEKYMWRLESRLE
Sbjct: 721  TLVQIVYSEVVIARDLFRKSRIAVRNKYEEAASVNSTTLVNIGLLIVLEKYMWRLESRLE 780

Query: 781  ALESTDMESFKQFLSDFFGNSTYMNLFIQGDQTYTDQINIFLDRNLTGHLSKKRDAVKIL 840
            ALESTDMESFKQFLSDFFGNSTYMNLFIQGDQTYTDQINIFLDRNLTGHLSKKRDAVKIL
Sbjct: 781  ALESTDMESFKQFLSDFFGNSTYMNLFIQGDQTYTDQINIFLDRNLTGHLSKKRDAVKIL 840

Query: 841  NEPTSTILKPGSNLFITHKGFKDDPNNSIVYFIQTGDRTDNYSYTLTAFTAFLISLTLVP 900
            NEPTSTILKPGSNLFITHKGFKDDPNNSIVYFIQTGDRTDNYSYTLTAFTAFLISLTLVP
Sbjct: 841  NEPTSTILKPGSNLFITHKGFKDDPNNSIVYFIQTGDRTDNYSYTLTAFTAFLISLTLVP 900

Query: 901  DLRGRKQVGYIVLGGLRTLSSTVGLHITITSSSPPHFLEEKIGEYLSYLEKDLLDNLKPQ 960
            DLRGRKQVGYIVLGGLRTLSSTVGLHITITSSSPPHFLEEKIGEYLSYLEKDLLDNLKPQ
Sbjct: 901  DLRGRKQVGYIVLGGLRTLSSTVGLHITITSSSPPHFLEEKIGEYLSYLEKDLLDNLKPQ 960

Query: 961  LFREKYVKEYLNVILSGKMEKTERELAPVNLMSRIKANVRSGNLDRVGRTMKSHRRIRAQ 1020
            LFREKYVKEYLNVILSGKMEKTERELAPVNLMSRIKANVRSGNLDRVGRTMKSHRRIRAQ
Sbjct: 961  LFREKYVKEYLNVILSGKMEKTERELAPVNLMSRIKANVRSGNLDRVGRTMKSHRRIRAQ 1020

Query: 1021 ISSKRYNFEDEDEPIDLQLIESLDFVHYMQFFKQKISIYSSLRSKISVMVSSPMSRSEIY 1080
            ISSKRYNFEDEDEPIDLQLIESLDFVHYMQFFKQKISIYSSLRSKISVMVSSPMSRSEIY
Sbjct: 1021 ISSKRYNFEDEDEPIDLQLIESLDFVHYMQFFKQKISIYSSLRSKISVMVSSPMSRSEIY 1080

Query: 1081 NRKVFLQLESFLKLKGFKISGEQLQKIVRKSDGKPTVLMKELFRYFASRGESLKICTVML 1140
            NRKVFLQLESFLKLKGFKISGEQLQKIVRKSDGKPTVLMKELFRYFASRGESLKICTVML
Sbjct: 1081 NRKVFLQLESFLKLKGFKISGEQLQKIVRKSDGKPTVLMKELFRYFASRGESLKICTVML 1140

Query: 1141 KEITRQLSSSLKNLGARKSPNFERPNGSPTVPLTEIVDPDAYF 1183
            KEITRQLSSSLKNLGARKSPNFERPNGSPTVPLTEIVDPDAYF
Sbjct: 1141 KEITRQLSSSLKNLGARKSPNFERPNGSPTVPLTEIVDPDAYF 1183

>Ecym_4404 Chr4 complement(840532..844122) [3591 bp, 1196 aa] {ON}
            similar to Ashbya gossypii AGR251C
          Length = 1196

 Score = 1205 bits (3118), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 603/1193 (50%), Positives = 828/1193 (69%), Gaps = 27/1193 (2%)

Query: 9    FDVQFYTPISCSSRSHRVIQLDNGMLVLLISNPAEKATSCALSVATGSHNDPKEILGLAH 68
            FDV  YTPIS S RSHR+IQL N +L LLIS+P+E   SCA+SVATGSHNDP E+ GLAH
Sbjct: 10   FDVTLYTPISSSKRSHRIIQLSNNLLALLISDPSETIASCAISVATGSHNDPPELPGLAH 69

Query: 69   FCEHMILSAGSKSYPDPNAYHDVISKNGGSQNAFTTGEQTTFCFELPNLSNSDELVFDKV 128
            FCEHM+LS+GSK YP+PN +H+ +++N GS+NA TTGEQT+F FE+P+ ++++  VF+++
Sbjct: 70   FCEHMVLSSGSKKYPEPNFFHESLTRNNGSKNAHTTGEQTSFYFEVPHTTSAELHVFEQL 129

Query: 129  LDIFSSSFKKPLFNELLVNKEIYAINSEHTANKSSRDKIFYHATRLLANGDHPFSQFSTG 188
            +DI ++SFK+P+F+++LVNKEIYAI+SEH  NKS+  K+ YHATRLLAN +HPFS FSTG
Sbjct: 130  IDILAASFKEPVFHDILVNKEIYAIHSEHMGNKSTLSKMLYHATRLLANENHPFSHFSTG 189

Query: 189  DITTLSDILQLNKVDLRTEVIKYFKNNFYAENMCLCIKGPQSLNTLGKLVFSKFNDI--- 245
            ++ TL+++ ++NK++L+TE+IKYFK +F AE M +CI+G QSLN L KL   KF DI   
Sbjct: 190  NVFTLTNMPRVNKLNLKTELIKYFKEHFRAEKMVVCIRGSQSLNQLSKLAQLKFGDIPGS 249

Query: 246  --KGLPISRPLRTKNQPWLKLKSRNFSNDGFG--LGLESFKILSRNWLQKYGNVGIFTGC 301
               G P S PL+ K+  W    S   S D       L+  +IL   WL +Y    +FT  
Sbjct: 250  AAAGSPTSSPLKLKS--WRSSNSITSSVDTSSTLASLDESRILKDTWLPRYSKEPVFTPR 307

Query: 302  DNHNTVLVDSQKLPALRLIFPIHHRLTRLTKKEIDLLSQCWCELFGDESEGSLCHFMKKN 361
              +N++++ S+K P +R IFP+++  TR T KEI   ++ WC++ GDE  GS CHF+++N
Sbjct: 308  PKYNSMMIQSKKPPVIRFIFPVNYLSTRFTDKEIATYTKAWCDIIGDEGYGSFCHFLRQN 367

Query: 362  DYITELTAFMSHFAVNDNALILELYLTNTGWKNLQMIVAVFFNKYVPIVIECGTYELAEF 421
            +YI++L AF S FAVND+ LIL+L+LTN GW N+ +IV +F+   V  +++    ++ ++
Sbjct: 368  NYISDLLAFSSSFAVNDDGLILQLHLTNYGWANVSIIVPLFWKYTVNTILDTSLSKIGQY 427

Query: 422  LSELNCIELLKFLYQDVTLSSMEECSNLSSLLLTDIESLGPSFILKGNP-MNDCNEID-S 479
            LSELN I+LLKFLYQDV  S ME C+ L   L+ D+  + P FILK +  M DCN+    
Sbjct: 428  LSELNSIDLLKFLYQDVERSPMERCAELCDQLMQDLSVVPPPFILKTSGLMFDCNDPRIQ 487

Query: 480  ELGSFAESEESRMWWIGHAIKFQSFIKEFINFENVRLVLMGDLKECPLMKTDLTSLKLNI 539
            ++GS++ES+ S  WW G AIKFQ+F+KEF   ENV+++++G L +CP       S++L  
Sbjct: 488  KIGSYSESQNSTDWWRGQAIKFQTFVKEFTTIENVKMIMLGPLSKCPFYS---NSMQLTA 544

Query: 540  EPYYEFEYHKCRSDQSNFKLTVEEISYSFHIPYKNVFLPSVGFNLSLIKNALLASSNRSQ 599
            + +YE++Y K   + +  +    E  Y FHIP  N FL  VG  LS IK ALLA+S +S+
Sbjct: 545  DTHYEYDYLKAYIEITELEAIDNE--YEFHIPSPNQFLVPVGHKLSYIKKALLAASAQSE 602

Query: 600  TAALSLGSQNANPHVLPKLLGKNCFYEMWVKEEDFELTFKSKSIVTFEIISTHLNPEPSY 659
             ++L + +Q+      P L GKN FYE+W KEED  L+FKSKSIV+ E+IST L P P Y
Sbjct: 603  NSSLFIVTQSDLLQTTPSLAGKNAFYELWTKEEDINLSFKSKSIVSLEVISTTLKPAPEY 662

Query: 660  TMMLEILCELLGDMLSSQLYPSEKIGYTYEIAASSKGDVRIGFTVSGFSEGVYKIIEKIV 719
            TM LEIL +LL  ++S  LYP+E+ GYTYE++ SSKGDVR+G T+SGF+EG+  I+  I+
Sbjct: 663  TMQLEILGQLLFSIISPVLYPAERAGYTYELSLSSKGDVRLGITLSGFTEGIMGILNIIL 722

Query: 720  GTLVQIVYSEVVIARDLFRKSRIAVRNKYEEAASVNSTTLVNIGLLIVLEKYMWRLESRL 779
             +L+++    V I++ +FR++R+ VR KYEEAAS N  TL ++GLLIVLE  MW LE RL
Sbjct: 723  DSLLELGEDSVEISKGMFRRARVMVRTKYEEAASENCATLASLGLLIVLEGCMWTLEDRL 782

Query: 780  EALESTDMESFKQFLSDFFGNSTYMNLFIQG-DQTYTDQINIFLDRNLTGHLSKKRDAVK 838
             ALE  DMESF QF+  F     Y+NL +QG D +  D++N  +D  LT H+S       
Sbjct: 783  NALEDIDMESFVQFMKLFINGRNYLNLLVQGSDLSLADKVNDCVDAKLTHHMSSLETGKN 842

Query: 839  ILNEPTSTILKPGSNLFITHKGFKDDPNNSIVYFIQTGDRTDNYSYTLTAFTAFLISLTL 898
            IL EPT+  +  GSNL +   G  DDPNNSIVYFIQTG R +NY+YTLT FT FL+S+TL
Sbjct: 843  ILVEPTTHFIPRGSNLCVKKSGSHDDPNNSIVYFIQTGTRDNNYAYTLTVFTEFLMSMTL 902

Query: 899  VPDLRGRKQVGYIVLGGLRTLSSTVGLHITITSSSPPHFLEEKIGEYLSYLEKDLLDNLK 958
            VPDLRG+KQ+GY+VLGGLR LS TVGLHIT  SS+PP +LE+KI EYLSYLE  +L  L 
Sbjct: 903  VPDLRGKKQIGYVVLGGLRVLSDTVGLHITTMSSNPPEYLEKKIDEYLSYLESMVLMKLN 962

Query: 959  PQLFREKYVKEYLNVILSGKMEKTERELAPVNLMSRIKANVRSGNLDRVGRTMKSHRRIR 1018
             + F+  Y+ ++L ++ S  + K E+   P NLMS+I+ANVRSG+ +     MKSH+RIR
Sbjct: 963  NEQFKMNYLNKFLRLVESNSLSKIEKTSGPANLMSQIEANVRSGSQNG-SMAMKSHKRIR 1021

Query: 1019 AQISSKRYNFEDEDEPIDLQLIESLDFVHYMQFFKQKISIYSSLRSKISVMVSSPMSRSE 1078
             QIS +RYNFE+EDEPI+ + I +L    YM FF +KIS+YS  R+K+SVMV+SPMS+ E
Sbjct: 1022 NQISYRRYNFEEEDEPINAKTIRNLTLREYMAFFHEKISVYSKSRAKMSVMVTSPMSKDE 1081

Query: 1079 IYNRKVFLQLESFLKLKGFKISGEQLQKIVRKSDGKPTVLMKELFRYFASRGESLKICTV 1138
            + ++ +FLQ+ESFLK+KGF I  E L+ I+ KS GKPTVL+K LF YF  RGES+K+ T 
Sbjct: 1082 VQSKMMFLQIESFLKMKGFNIPSEDLKSIIVKSGGKPTVLLKHLFSYFRVRGESIKLLTA 1141

Query: 1139 MLKEITRQLSSSLKNLGARKSPNFERPNG---------SPTVPLTEIVDPDAY 1182
            ++KEI +Q S+      A+ S      +G         +P VPL E+ D ++Y
Sbjct: 1142 IVKEIVKQASNKPPGSAAKTSATPTGTSGTLQAMSQTVAPAVPLIEVTDVNSY 1194

>AGR251C Chr7 complement(1213371..1216952) [3582 bp, 1193 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YPR122W
            (AXL1)
          Length = 1193

 Score = 1145 bits (2963), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 576/1147 (50%), Positives = 808/1147 (70%), Gaps = 17/1147 (1%)

Query: 9    FDVQFYTPISCSSRSHRVIQLDNGMLVLLISNPAEKATSCALSVATGSHNDPKEILGLAH 68
            FDV+ YTPIS S+RSHR+I+L+N +L  LIS+P+E   SCA+S+ATGSHNDP EI GLAH
Sbjct: 10   FDVKLYTPISSSNRSHRIIRLNNNLLTFLISDPSETVASCAVSIATGSHNDPVEIPGLAH 69

Query: 69   FCEHMILSAGSKSYPDPNAYHDVISKNGGSQNAFTTGEQTTFCFELPNLSNSDELVFDKV 128
            FCEHM+LS+GSK +P+PNA+H+ +SKN GSQNA T+GEQT+F FELP+  +SD LVFD+V
Sbjct: 70   FCEHMVLSSGSKRHPEPNAFHETLSKNNGSQNAHTSGEQTSFYFELPSSQSSDSLVFDQV 129

Query: 129  LDIFSSSFKKPLFNELLVNKEIYAINSEHTANKSSRDKIFYHATRLLANGDHPFSQFSTG 188
            + I + + K+P+F+++L+NKEIYAINSEH  NKSS  K+ YHA RLLA+ +HPF QF TG
Sbjct: 130  VGILADALKEPIFHDVLINKEIYAINSEHVGNKSSLTKMMYHAVRLLASPEHPFHQFGTG 189

Query: 189  DITTLSDILQLNKVDLRTEVIKYFKNNFYAENMCLCIKGPQSLNTLGKLVFSKFNDIKGL 248
            +I TL+++ +L+K+ L+ E++KYF+ +F+AENM LC++GPQSLN L K+  ++F+DI  +
Sbjct: 190  NIFTLTNMPKLHKLSLKNELVKYFREHFFAENMVLCLRGPQSLNQLSKIAQARFSDIPSI 249

Query: 249  P---ISRPLRTKNQPWLKLKSRNFSNDGFGLGLESFKILSRNWLQKYGNVGIFTGCDNHN 305
            P   + R LR ++      K+RN S       LESF+IL   W  +Y    +F     HN
Sbjct: 250  PTLQVPRLLRWRSSSSFD-KNRNLSVR----PLESFQILKDAWSARYAKKPVFDKTPMHN 304

Query: 306  TVLVDSQKLPALRLIFPIHHRLTRLTKKEIDLLSQCWCELFGDESEGSLCHFMKKNDYIT 365
            +++V S K P +R +FPI++  TR T +E+   +Q WCEL GDE EGSLCH+++ + YIT
Sbjct: 305  SIMVQSSKSPVIRFVFPINYFSTRFTDRELATYTQIWCELLGDECEGSLCHYLRSHSYIT 364

Query: 366  ELTAFMSHFAVNDNALILELYLTNTGWKNLQMIVAVFFNKYVPIVIECGTYELAEFLSEL 425
            EL A+ S+FAVND  LIL+L+LTN GW N+Q I+ + +   +P +++     LA+++SEL
Sbjct: 365  ELIAYSSNFAVNDTGLILQLHLTNHGWLNVQKIIPIVWKYLIPAILDAPLSSLAQYISEL 424

Query: 426  NCIELLKFLYQDVTLSSMEECSNLSSLLLTDIESLGPSFILKGN-PMNDCNEID-SELGS 483
            N ++LLKFLYQ++  S M+ C++L   LL D+ ++  SF+LK      +CN +  + LG+
Sbjct: 425  NSLDLLKFLYQELERSPMDRCADLCESLLQDLSAIDLSFLLKSTLTYFECNNLSVANLGT 484

Query: 484  FAESEESRMWWIGHAIKFQSFIKEFINFENVRLVLMGDLKECPLMKTDLTSLKLNIEPYY 543
            + E++ S+ WW G A+KFQ+F+ EF++ + VR++L+G+L +C     +    K+  + Y+
Sbjct: 485  YRENQTSKDWWRGEAVKFQAFVNEFMSQDTVRIILLGNLSKCYF---NCNPDKITTDTYF 541

Query: 544  EFEYHKCRSDQSNFKLTVEEISYSFHIPYKNVFLPSVGFNLSLIKNALLASSNRSQTAAL 603
            E+EY K   D     L  ++I Y F IP  N F+  VG  LS IK+ALLASS +S+ +AL
Sbjct: 542  EYEYVKIFIDLE--VLGCDDIHYRFTIPGPNPFMVPVGHKLSFIKHALLASSVQSENSAL 599

Query: 604  SLGSQNANPHVLPKLLGKNCFYEMWVKEEDFELTFKSKSIVTFEIISTHLNPEPSYTMML 663
            S+ +Q+      P+L GKN +YE+W+KEED +L+F+SKSI + E+IST L P P YTM L
Sbjct: 600  SVVAQSDLVRASPRLAGKNSYYELWLKEEDVDLSFRSKSIFSMELISTSLEPAPEYTMHL 659

Query: 664  EILCELLGDMLSSQLYPSEKIGYTYEIAASSKGDVRIGFTVSGFSEGVYKIIEKIVGTLV 723
            EIL +LL  +L   LYP+E+ GYTYE++ SSKGDVR+G T+SGF++G+  +++ IV  +V
Sbjct: 660  EILGQLLYSILGPILYPAERAGYTYELSLSSKGDVRLGLTISGFTDGILNLLKIIVDAIV 719

Query: 724  QIVYSEVVIARDLFRKSRIAVRNKYEEAASVNSTTLVNIGLLIVLEKYMWRLESRLEALE 783
             +      I +D+FRK+RI VR KY+EA+S +  TL ++GLLI+LE  MW LE RLEALE
Sbjct: 720  NLSQDLNSIPKDIFRKARILVRTKYKEASSESCVTLASLGLLILLENCMWPLEDRLEALE 779

Query: 784  STDMESFKQFLSDFFGNSTYMNLFIQG-DQTYTDQINIFLDRNLTGHLSKKRDAVKILNE 842
               +ESF+ FL  F     Y+N+ IQG D T  D IN +L   LT H+S+  D V  L+E
Sbjct: 780  DIYVESFRIFLEKFINGDNYLNILIQGSDMTIADNINEYLSERLTHHISRADDNVCRLSE 839

Query: 843  PTSTILKPGSNLFITHKGFKDDPNNSIVYFIQTGDRTDNYSYTLTAFTAFLISLTLVPDL 902
            P + ++  GSNLF    GF DDPNNSIVYFIQTG+R +NY YTLT  T F++S TLVPDL
Sbjct: 840  PATYVIPEGSNLFFKRVGFHDDPNNSIVYFIQTGERDNNYIYTLTVLTEFIMSQTLVPDL 899

Query: 903  RGRKQVGYIVLGGLRTLSSTVGLHITITSSSPPHFLEEKIGEYLSYLEKDLLDNLKPQLF 962
            R +KQ+GYIVLGGLR LS TVGLHIT  + SPP FLEEKI EYL+YLE  +L  L    F
Sbjct: 900  RQKKQIGYIVLGGLRVLSDTVGLHITTMAGSPPEFLEEKINEYLAYLEDMVLAKLTAPQF 959

Query: 963  REKYVKEYLNVILSGKMEKTERELAPVNLMSRIKANVRSGNLDRVGRTMKSHRRIRAQIS 1022
            +  YV E L+++ S  + K E+   P NLMS+I+ANV SG  +     MKSH+R+R QIS
Sbjct: 960  KHDYVDELLSLLTSNSLGKLEKTSGPANLMSQIEANVHSGQRN-TSLAMKSHKRLRTQIS 1018

Query: 1023 SKRYNFEDEDEPIDLQLIESLDFVHYMQFFKQKISIYSSLRSKISVMVSSPMSRSEIYNR 1082
             +RYNF+++DEP+D + +++L    YM+FF+Q+ISIYS  R+K+S+MV S MS+ E+  +
Sbjct: 1019 YRRYNFDEDDEPVDARTLQNLKLSEYMRFFRQRISIYSGKRAKLSIMVYSAMSKEEVQGK 1078

Query: 1083 KVFLQLESFLKLKGFKISGEQLQKIVRKSDGKPTVLMKELFRYFASRGESLKICTVMLKE 1142
             ++LQ+ESFLK+KGF I  + L  IV+KS GKPT L+K L  YF S+GESLK+ + +L+E
Sbjct: 1079 MLYLQIESFLKMKGFNIPSKDLNAIVQKSKGKPTALLKGLLSYFRSQGESLKLLSTVLRE 1138

Query: 1143 ITRQLSS 1149
            + +QL S
Sbjct: 1139 VVKQLFS 1145

>Kwal_55.20464 s55 complement(414783..418352) [3570 bp, 1189 aa] {ON}
            YPR122W (AXL1) - putative homolog of human
            insulin-degrading endoprotease [contig 148] FULL
          Length = 1189

 Score = 1127 bits (2914), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 582/1189 (48%), Positives = 790/1189 (66%), Gaps = 21/1189 (1%)

Query: 1    MSSFGVRNFDVQFYTPISCSSRSHRVIQLDNGMLVLLISNPAEKATSCALSVATGSHNDP 60
            MS    +NFD+ FYTPIS SSR  ++ QL NGMLV LIS+P++   SC++SVATGSHNDP
Sbjct: 1    MSFESTKNFDLVFYTPISGSSRGSKLCQLSNGMLVFLISDPSDTVGSCSVSVATGSHNDP 60

Query: 61   KEILGLAHFCEHMILSAGSKSYPDPNAYHDVISKNGGSQNAFTTGEQTTFCFELPNLSNS 120
             E LGLAH CEH ILS GSK YP  N YH+V+++NGGS NA+TTGE TTF FELP +S+S
Sbjct: 61   DEALGLAHLCEHAILSGGSKKYPGANYYHEVLAQNGGSHNAYTTGETTTFYFELPAISDS 120

Query: 121  DELVFDKVLDIFSSSFKKPLFNELLVNKEIYAINSEHTANKSSRDKIFYHATRLLANGDH 180
             EL FDK LD+ +SS K PLF+++L+NKEIYAI SEH  NK+   K  YHA+RLLAN  H
Sbjct: 121  GELHFDKALDVLASSLKAPLFSDILINKEIYAIESEHNINKALVGKQLYHASRLLANPSH 180

Query: 181  PFSQFSTGDITTLSDILQLNKVDLRTEVIKYFKNNFYAENMCLCIKGPQSLNTLGKLVFS 240
            PFS+F TG+ TTL  +  LNK +++  +  + K  +   NM LC++G QSLNTL KL   
Sbjct: 181  PFSRFCTGNFTTLCTLPSLNKFNIKAALTSFHKRYYKTSNMSLCLRGSQSLNTLTKLAIR 240

Query: 241  KFNDI--KGLPISRPLRTKNQPWLKLKSRNFSNDGFGLGLESFKILSRNWLQKYGNVGIF 298
             F D+   G  I+RP            S  FSN G    +  FKIL   W  KY +V  F
Sbjct: 241  FFGDLPASGQNIARPS----------SSSLFSNKGTAQSMPYFKILKYEWTPKYKDVRAF 290

Query: 299  TGCDNHNTVLVDSQKLPALRLIFPIHHRLTRLTKKEIDLLSQCWCELFGDESEGSLCHFM 358
            +   + N V + S K P LRLIFP+ H+ TRL+  +I   S  WC+ FGDES GSL   +
Sbjct: 291  SQ-GSSNVVAIQSSKCPVLRLIFPVSHKSTRLSSSDITTFSSTWCDFFGDESVGSLADCL 349

Query: 359  KKNDYITELTAFMSHFAVNDNALILELYLTNTGWKNLQMIVAVFFNKYVPIVIECGTYEL 418
            K    I+ + + +SHFA  ++ L LEL LT  GWKN+  I+ + F+ Y+P +I   T ++
Sbjct: 350  KGCGLISGIVSSVSHFATEEDGLTLELTLTQHGWKNIPTIMCILFDDYIPKLIHDKTEDI 409

Query: 419  AEFLSELNCIELLKFLYQDVTLSSMEECSNLSSLLLTDIESLGPSFILKGNPMNDCNEID 478
            A  LSELN IELLKFLYQ    S M+ C+NLS+ LL D+E+L P  +LKG+P+ +CN+  
Sbjct: 410  ARCLSELNAIELLKFLYQSTEKSPMDMCANLSAYLLLDLETLDPKCLLKGSPLIECNQEH 469

Query: 479  SELGSFAESEESRMWWIGHAIKFQSFIKEFINFENVRLVLMGDLKECPLMKTDLTSLKLN 538
            S +G ++E+ ES+ WWIG AIKFQ+ + EF+N +N+R V++GD  +   + +  ++ K  
Sbjct: 470  SRIGDYSENTESQTWWIGRAIKFQNLVSEFVNRQNLRAVMLGDQSKSNFLASVRSTTK-- 527

Query: 539  IEPYYEFEYHKCRSDQSNFKLT-VEEISYSFHIPYKNVFLPSVGFNLSLIKNALLASSNR 597
             + YYEF+Y     D  + +L      +Y FH P  + FLP V   LSLIK AL  SS R
Sbjct: 528  TDAYYEFDYRIAYVDMLSIQLDDYTAPNYHFHAPSYDTFLPMVARKLSLIKQALQVSSTR 587

Query: 598  SQTAALSLGSQNANPHVLPKLLGKNCFYEMWVKEEDFELTFKSKSIVTFEIISTHLNPEP 657
            +Q+A+L L  ++      P+L GKN  YE+WVKEE+ +L+F SKSIV+FEIIS  +   P
Sbjct: 588  AQSASLHLIPRSDFLQTPPRLAGKNSNYEVWVKEEELDLSFSSKSIVSFEIISKSVCASP 647

Query: 658  SYTMMLEILCELLGDMLSSQLYPSEKIGYTYEIAASSKGDVRIGFTVSGFSEGVYKIIEK 717
              TM LEIL +LL   LS+ LYPSEK+GYTYEI+ SSKGDVR+G TVSGF EGVY +I K
Sbjct: 648  KNTMYLEILGQLLAGTLSATLYPSEKLGYTYEISPSSKGDVRLGLTVSGFPEGVYNLI-K 706

Query: 718  IVGTLVQIVYSEVVIARDLFRKSRIAVRNKYEEAASVNSTTLVNIGLLIVLEKYMWRLES 777
            I+   ++   S  +I+  +FR++RIAVR+KYEEAA+ N T L ++GLLI+LE+ MW +E 
Sbjct: 707  IIVEEIKSFSSRDIISSKVFREARIAVRSKYEEAAAANCTALASLGLLIILEECMWPIED 766

Query: 778  RLEALESTDMESFKQFLSDFFGNSTYMNLFIQGDQTYTDQINIFLDRNLTGHLSKKRDAV 837
            RLEALE    E+F  F S F  + TYMNLFIQGD +  ++IN FL  +LT HL   R+  
Sbjct: 767  RLEALEEISQETFTMFCSHFLTSPTYMNLFIQGDMSCMEKINSFLKWSLTSHLEDTREYQ 826

Query: 838  KILNEPTSTILKPGSNLFITHKGFKDDPNNSIVYFIQTGDRTDNYSYTLTAFTAFLISLT 897
              + EP + ILK G+N+F+    F DDPNNSIVYFIQTG+R D  +YT T    F +SLT
Sbjct: 827  GPVREPGAKILKAGTNIFVKRNAFSDDPNNSIVYFIQTGEREDARAYTYTCLAEFFLSLT 886

Query: 898  LVPDLRGRKQVGYIVLGGLRTLSSTVGLHITITSSSPPHFLEEKIGEYLSYLEKDLLDNL 957
            LVPDLR +KQ+GY V GGLR LS+++GLHIT  S+SPP  LE +I EYLSYLEK LLD +
Sbjct: 887  LVPDLRNKKQIGYAVFGGLRLLSTSIGLHITCMSNSPPEHLEVQIEEYLSYLEKCLLDTM 946

Query: 958  KPQLFREKYVKEYLNVILSGKMEKTERELAPVNLMSRIKANVRSGNLDRVGRTMKSHRRI 1017
              + F+E Y+++Y  ++ + ++ + ++   P +LM +I+ANVRSGNL+  G  M+ H+  
Sbjct: 947  TEEEFQEHYIRKYRVMVENNQVNRMQKTAGPADLMGQIEANVRSGNLEEQGSAMRLHKNT 1006

Query: 1018 RAQISSKRYNFEDEDEPIDLQLIESLDFVHYMQFFKQKISIYSSLRSKISVMVSSPMSRS 1077
            + QIS++RYNF  E+EP++  ++ ++    +  FF +KISIYS  RSK+SVM++SPM+  
Sbjct: 1007 KNQISNRRYNFGMEEEPVNRDILRTITLSEFRSFFSEKISIYSLKRSKLSVMIASPMTAE 1066

Query: 1078 EIYNRKVFLQLESFLKLKGFKISGEQLQKIVRKSDGKPTVLMKELFRYFASRGESLKICT 1137
            EI  +++FLQ+ESFLKLKG KIS   L  I+  S G+ + +++ LFRYF++ GE++K+C 
Sbjct: 1067 EISQKRLFLQVESFLKLKGLKISSSDLHDIIETSLGRTSGILRGLFRYFSANGETMKLCN 1126

Query: 1138 VMLKEITRQLSSSLKNLGARKSPNFERPNGSPTV----PLTEIVDPDAY 1182
            V++KEI++ L  SLKN   R   +      S  V    PLTEI D + +
Sbjct: 1127 VIIKEISKALVLSLKNPSQRTRVDDALRGLSKIVTSALPLTEIKDVNQF 1175

>KLTH0E05104g Chr5 complement(449481..453038) [3558 bp, 1185 aa] {ON}
            similar to uniprot|P40851 Saccharomyces cerevisiae
            YPR122W AXL1 Haploid specific endoprotease that performs
            one of two N-terminal cleavages during maturation of a-
            factor mating pheromone required for axial budding
            pattern of haploid cells
          Length = 1185

 Score = 1122 bits (2902), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 580/1183 (49%), Positives = 799/1183 (67%), Gaps = 24/1183 (2%)

Query: 3    SFGVRNFDVQFYTPISCSSRSHRVIQLDNGMLVLLISNPAEKATSCALSVATGSHNDPKE 62
            S  V++FDV FYTPIS S++   + +L NG+LVLLIS+PA+ + S ++SVA+GSH DP E
Sbjct: 5    SDAVQHFDVAFYTPISSSNKGVELCRLANGILVLLISDPADTSVSSSVSVASGSHADPDE 64

Query: 63   ILGLAHFCEHMILSAGSKSYPDPNAYHDVISKNGGSQNAFTTGEQTTFCFELPNLSNSDE 122
            +LGLAH CEH ILSAGSK +P  + YH+++++NGGS NA+TTGE TTF FELP  ++S E
Sbjct: 65   VLGLAHLCEHTILSAGSKKFPRSSHYHEIVAQNGGSHNAYTTGENTTFYFELPASNDSGE 124

Query: 123  LVFDKVLDIFSSSFKKPLFNELLVNKEIYAINSEHTANKSSRDKIFYHATRLLANGDHPF 182
            L+FDKVLD  +SSFK P+F++  +NKEIYAI SEH  NK+S  K  YHATRLLAN  HPF
Sbjct: 125  LLFDKVLDTLASSFKNPVFSDSSINKEIYAIESEHNVNKASTPKQLYHATRLLANPRHPF 184

Query: 183  SQFSTGDITTLSDILQLNKVDLRTEVIKYFKNNFYAENMCLCIKGPQSLNTLGKLVFSKF 242
            S+F TG+  TL D   L+KV+++  + +YFK N+ A  M LC++GPQSLN L KL    F
Sbjct: 185  SRFCTGNFATLCDEPNLHKVNVKATLCQYFKTNYDATRMALCLRGPQSLNALAKLAKKYF 244

Query: 243  NDIKGLPISRPLRTKNQPWLKLKSRNFSNDGFGLGLESFKILSRNWLQKYGNVGIFTGCD 302
             D   LP SR       P  K  S   ++    +    FK    N  Q+      F   D
Sbjct: 245  GD---LPASRDRDPTRPPLKKRPSSGVASQDLHVRPLDFK----NSKQQTQVQDAFVP-D 296

Query: 303  NHNTVLVDSQKLPALRLIFPIHHRLTRLTKKEIDLLSQCWCELFGDESEGSLCHFMKKND 362
              N V + S K P LRL+FP+ H+ TRLT  +I  LS+ WC+ FGDE  GSL H +K N+
Sbjct: 297  TSNLVAIQSSKNPVLRLVFPVSHKSTRLTSNDIVALSENWCDFFGDEGVGSLTHCLKTNN 356

Query: 363  YITELTAFMSHFAVNDNALILELYLTNTGWKNLQMIVAVFFNKYVPIVIECGTYELAEFL 422
             I  + A ++HF+  ++ L LE  LTN GW + Q+I+ V F+ ++P +I   T ++A+ L
Sbjct: 357  LINGVVASVAHFSAGNDGLTLEFTLTNLGWSSAQLIITVLFDLFIPRLIHDKTKDIAKCL 416

Query: 423  SELNCIELLKFLYQDVTLSSMEECSNLSSLLLTDIESLGPSFILKGNPMNDCNEIDSELG 482
            SELNC +LL FLYQ    SSME C+ LSS LL+  E+L P  +LKG+P+ +CN+  S +G
Sbjct: 417  SELNCTDLLTFLYQGAEKSSMEMCAVLSSRLLSVFETLDPKCLLKGSPLIECNQNPSAIG 476

Query: 483  SFAESEESRMWWIGHAIKFQSFIKEFINFENVRLVLMGDLKECPLMKTDLTSLKLNI--- 539
             ++ES ESR WWIG AIKFQ+F+ EF+N +N+R+V++G+   CP  K+DL S   ++   
Sbjct: 477  DYSESTESRTWWIGRAIKFQNFVSEFVNRQNLRIVMLGN---CP--KSDLLSSVTSVSKT 531

Query: 540  EPYYEFEYHKCRSDQSNFKLTVEEI-SYSFHIPYKNVFLPSVGFNLSLIKNALLASSNRS 598
            + YYEF Y   + D  + +  +  I  +SF +P  ++FLP+VG  L LIK AL ASSNRS
Sbjct: 532  DAYYEFTYQISKIDMLSVREELYRIPGFSFRVPCYDMFLPTVGRKLGLIKQALQASSNRS 591

Query: 599  QTAALSLGSQNANPHVLPKLLGKNCFYEMWVKEEDFELTFKSKSIVTFEIISTHLNPEPS 658
            QT+ L++ ++NA    +P+L GKN  +E+WVKEED +L+FKSKSI++ E+ S  +   PS
Sbjct: 592  QTSLLTVVARNAYLQTIPRLAGKNSNHELWVKEEDSDLSFKSKSIISIEVASKTIEACPS 651

Query: 659  YTMMLEILCELLGDMLSSQLYPSEKIGYTYEIAASSKGDVRIGFTVSGFSEGVYKIIEKI 718
            YTM LE+L +LLGD LS+ LYPSEK+GYTYEI+ S+KG  R+ FT+SGF EGV  ++  I
Sbjct: 652  YTMCLEVLAQLLGDSLSTVLYPSEKLGYTYEISPSAKGHARLSFTISGFPEGVCAMVRVI 711

Query: 719  VGTLVQIVYSEVVIARDLFRKSRIAVRNKYEEAASVNSTTLVNIGLLIVLEKYMWRLESR 778
            +     ++ S+ V    +FRK+R+AVRNKYEEAAS NSTTL  +GLLIVLE+ MW +E R
Sbjct: 712  IDQTKSLINSDTVTPA-MFRKARVAVRNKYEEAASANSTTLATLGLLIVLEECMWPVEDR 770

Query: 779  LEALESTDMESFKQFLSDFFGNSTYMNLFIQGDQTYTDQINIFLDRNLTGHLSKKRDAVK 838
            L+ALE  D+ESF+ F S F    TY+N+F QGD +YT++I+ FLD  LT HLS++     
Sbjct: 771  LDALEEIDIESFRTFCSGFISKPTYLNVFSQGDLSYTEEISTFLDSGLTSHLSRRTWHEP 830

Query: 839  ILNEPTSTILKPGSNLFITHKGFKDDPNNSIVYFIQTGDRTDNYSYTLTAFTAFLISLTL 898
             + EP +  LKPG+N+FI    F +DP++SIVYFIQTGDR D    +LT  T FL+S+TL
Sbjct: 831  AVREPVTHALKPGTNMFIRRSAFVEDPSSSIVYFIQTGDRDDAQMLSLTCLTEFLMSMTL 890

Query: 899  VPDLRGRKQVGYIVLGGLRTLSSTVGLHITITSSSPPHFLEEKIGEYLSYLEKDLLDNLK 958
            VPDLR +KQ+GY V  GLR LS+T+GLHIT  SSSPP  LE +I +YL+Y+E D+L  + 
Sbjct: 891  VPDLRTKKQIGYAVFSGLRLLSTTMGLHITCMSSSPPEHLESQIDQYLAYMEHDVLSAMS 950

Query: 959  PQLFREKYVKEYLNVILSGKMEKTERELAPVNLMSRIKANVRSGNLDRVGRTMKSHRRIR 1018
             + F+E+Y++++  +     +  T     P +L+++I+ANV SGNL   G  M+ H+RIR
Sbjct: 951  EEEFQERYIRKFRAMFERENVTSTSDAAGPADLLAQIEANVHSGNLPEQGAAMRQHKRIR 1010

Query: 1019 AQISSKRYNFEDEDEPIDLQLIESLDFVHYMQFFKQKISIYSSLRSKISVMVSSPMSRSE 1078
             QIS  RYNF  + EP DL L+ +L    + +FF++KISI S+ RSK+SVMV+SP+S  E
Sbjct: 1011 NQISIHRYNFTSDLEPADLGLLRALTLGQFRRFFQEKISICSTTRSKLSVMVASPVSADE 1070

Query: 1079 IYNRKVFLQLESFLKLKGFKISGEQLQKIVRKSDGKPTVLMKELFRYFASRGESLKICTV 1138
            I  +++FLQ+ES+LKLKG KI   +L+ IV  S GKP+ LM+ LF++F +RGE+L++C V
Sbjct: 1071 IAEKRLFLQIESYLKLKGLKIPSSELRAIVESSQGKPSTLMRGLFKFFLARGETLRLCNV 1130

Query: 1139 MLKEITRQLSSSLK-----NLGARKSPNFERPNGSPTVPLTEI 1176
            +LKE+++ +  SLK     N  A    N  R   S  VPL E+
Sbjct: 1131 ILKELSKAVVLSLKPRPTNNNSAGVLQNV-RKEVSTAVPLIEV 1172

>Smik_16.371 Chr16 (659341..662967) [3627 bp, 1208 aa] {ON} YPR122W
            (REAL)
          Length = 1208

 Score = 1043 bits (2697), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 547/1206 (45%), Positives = 767/1206 (63%), Gaps = 27/1206 (2%)

Query: 1    MSSFGVRNFDVQFYTPISCSSRSHRVIQLDNGMLVLLISNPAEKATSCALSVATGSHNDP 60
            MS   V N++V F+ P+S S+R+H++ +L NG+L LLIS+P + ++SC+LSV TGSHNDP
Sbjct: 1    MSLREVTNYEVSFHIPLSYSNRAHKICKLPNGILALLISDPTDTSSSCSLSVCTGSHNDP 60

Query: 61   KEILGLAHFCEHMILSAGSKSYPDPNAYHDVISKNGGSQNAFTTGEQTTFCFELPNLSNS 120
             +I GLAH CEHMILSAGSK YPDP  +H +I+KN GSQNA+TTGEQTTF FELPN  N+
Sbjct: 61   MDIPGLAHLCEHMILSAGSKKYPDPGLFHALIAKNNGSQNAYTTGEQTTFYFELPNTQNN 120

Query: 121  DELVFDKVLDIFSSSFKKPLFNELLVNKEIYAINSEHTANKSSRDKIFYHATRLLANGDH 180
             E  F+ +LD+F+S FK PLFN LL++KEIYAI SEH  N SS  KIFYHA R+LAN DH
Sbjct: 121  GEFAFESILDVFASFFKDPLFNPLLISKEIYAIQSEHEGNISSTTKIFYHAARILANSDH 180

Query: 181  PFSQFSTGDITTLSDILQLNKVDLRTEVIKYFKNNFYAENMCLCIKGPQSLNTLGKLVFS 240
            PFS+FSTG+I +LS I QL K++L++ +  YF++NF+ EN+ LCI+G QS+N L KL  S
Sbjct: 181  PFSRFSTGNIHSLSSIPQLKKINLKSSLNTYFRSNFFGENITLCIRGSQSVNILTKLAIS 240

Query: 241  KFNDIKGLPI--SRPLRTKNQPWLK----LKSRNFSNDGFGLGLESFKILSRNWLQKYGN 294
            KF D+K   I   R       P+ K     +S N   + +   LE FKIL   W +KY N
Sbjct: 241  KFGDVKPKSIVKERHFSIGKGPFRKSTSLRRSLNSPKNDYR-NLEDFKILDTVWEKKYQN 299

Query: 295  VGIFTGCDNHNTVLVDSQKLPALRLIFPIHHRLTRLTKKEIDLLSQCWCELFGDESEGSL 354
               F      N++ ++S K+P +R +FP+  R TR TK +I + S  WCELFGDES GSL
Sbjct: 300  TMCFQHAPECNSIFINSNKMPVMRFLFPVSDRNTRFTKDDIKIYSHLWCELFGDESPGSL 359

Query: 355  CHFMKKNDYITELTAFMSHFAVNDNALILELYLTNTGWKNLQMIVAVFFNKYVPIVIECG 414
             H++    +IT+  AF S FA+ D  LILEL LTN+GWK+++ I    F++ +P      
Sbjct: 360  SHYLVSRGWITKCFAFTSEFAIGDIGLILELELTNSGWKSIKNITTTIFSELLPSFYVKN 419

Query: 415  TYELAEFLSELNCIELLKFLYQDVTLSSMEECSNLSSLLLTDIESLGPSFILKGNPMNDC 474
               L  FL E N I+L +FLYQ      MEECSNLSS L  ++E L PS + KG      
Sbjct: 420  IDHLVTFLKEQNLIDLARFLYQSSENLPMEECSNLSSFLQENLECLTPSNVFKG--FKSL 477

Query: 475  NEIDS-ELGSFAESEESRMWWIGHAIKFQSFIKEFINFENVRLVLMGDLKECPLMKTDLT 533
             EID   +  + E++ +  WW G AIKFQ+F+K  +  +N RL+L+GD+K   +      
Sbjct: 478  IEIDDPNIEKYEETKANVRWWTGQAIKFQNFLKSHMKHDNTRLLLLGDIKSHKIFHIIEN 537

Query: 534  SLKLNIEPYYEFEYHKCRSDQSNFKLTVEEISYSFHIPYKNVFLPSVGFNLSLIKNALLA 593
              ++  + +YEFEY+      +       + SY F+ P  N+FLP    +   ++   L 
Sbjct: 538  KSEIRTDFFYEFEYYTGSVHLAEENKYYPKSSYEFNFPKSNLFLPDYISDPLKLRQLFLE 597

Query: 594  SSNRSQTAALSLGSQNANPHVLPKLLGKNCFYEMWVKEEDFELTFKSKSIVTFEIISTHL 653
             S +S+ A L     +      P+L+ +N  YEMW+ +ED      +KS+V+FE++   +
Sbjct: 598  CSLKSKFATLRPQIYSEPTRREPQLVSENLNYEMWILKEDPNFASNNKSVVSFEVLGLGI 657

Query: 654  NPEPSYTMMLEILCELLGDMLSSQLYPSEKIGYTYEIAASSKGDVRIGFTVSGFSEGVYK 713
             P P  T+ LE+L ++L  + SS LYP+ +IGYTYEIA+SSKG V + FT+SGF EGV+K
Sbjct: 658  KPSPEATIHLEVLAQVLFIITSSHLYPALRIGYTYEIASSSKGSVTLRFTISGFPEGVFK 717

Query: 714  IIEKIVGTLVQIVYSEVVIARDLFRKSRIAVRNKYEEAASVNSTTLVNIGLLIVLEKYMW 773
            I++  V TL  I      +++D  RK+RI VR+KYE A+S N   L +IGLLIVLE+++W
Sbjct: 718  IVKTFVDTLKLIATDPTFLSKDTLRKARIFVRSKYESASSDNCVKLASIGLLIVLEEFIW 777

Query: 774  RLESRLEALESTDMESFKQFLSDFFGNSTYMNLFIQGDQTYTDQINIFLDRNLTGHL--- 830
             L+ R+ ALE T+MESFK+F S F+ N   + L +QG   Y D+IN +L+RN T HL   
Sbjct: 778  TLQDRINALELTEMESFKEFCSLFWKNPKQLVLLVQGSLDYADEINHYLNRNFTQHLKVC 837

Query: 831  -SKKRDAVKILNEPTSTILKPGSNLFITHKGFKDDPNNSIVYFIQTGDRTDNYSYTLTAF 889
                +  + +   P++  L  G+N FI++ G +DDPNNSIVYFIQT  R D  +  LT  
Sbjct: 838  NEGSKSTIHLYPSPSTKNLDEGTNAFISYNGHQDDPNNSIVYFIQTAQRDDIENLALTFL 897

Query: 890  TAFLISLTLVPDLRGRKQVGYIVLGGLRTLSSTVGLHITITSSSPPHFLEEKIGEYLSYL 949
            T +L SLTLVPDLR RKQ+GYIVLGGLR L+ TVG+H+T+ S S  H LE KI EYLSYL
Sbjct: 898  TEYLFSLTLVPDLRNRKQIGYIVLGGLRVLTDTVGIHVTVMSGSSAHNLETKINEYLSYL 957

Query: 950  EKDLLDNLKPQLFREKYVKEYLNVILSGKMEKTERELAPVNLMSRIKANVRSG-NLDRVG 1008
            E  +LDNL    FR+  ++ +L ++    + K E    PV+L++ I ANV++G N     
Sbjct: 958  ELQVLDNLTEIDFRKMLLEPFLTLLKQNSITKFEESAGPVDLLNEIVANVQNGDNYTLNN 1017

Query: 1009 RTMKSHRRIRAQISSKRYNFEDEDEPIDLQLIESLDFVHYMQFFKQKISIYSSLRSKISV 1068
            R MK HR++R +I+ KR NF++E E +++  ++ L    Y++FF+ KISIYS+ RSKIS+
Sbjct: 1018 RQMKQHRKVRNKITEKRLNFQEEYEMVNIPFLQKLTLKKYLRFFQAKISIYSTQRSKISI 1077

Query: 1069 MVSSPMSRSEIYNRKVFLQLESFLKLKGFKISGEQLQKIVRKSDGKPTVLMKELFRYFAS 1128
            M++SPM+  +I +R++FLQLE+FLK+KGF I  E L+KIV  S+G P +L+K LF +F  
Sbjct: 1078 MIASPMAEEKIASRRIFLQLEAFLKIKGFAIKNEDLKKIVEHSEGSPMLLVKNLFTHFRK 1137

Query: 1129 RGESLKICTVMLKEITRQLSSSLK------------NLGARKSPNFERPNGSPTVPLTEI 1176
            R E+ K+ TV+L+EI + +  + K            N   +   NF + +  P +PL E+
Sbjct: 1138 RNEAFKLGTVVLQEILKIIGMNFKQGYGSVLGFSSHNSEGQDVKNFWKNDIEPVIPLQEL 1197

Query: 1177 VDPDAY 1182
             DP+ +
Sbjct: 1198 PDPNFF 1203

>NCAS0A11630 Chr1 (2311038..2314643) [3606 bp, 1201 aa] {ON} Anc_3.455
            YPR122W
          Length = 1201

 Score = 1035 bits (2675), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 554/1159 (47%), Positives = 766/1159 (66%), Gaps = 14/1159 (1%)

Query: 1    MSSFGVRNFDVQFYTPISCSSRSHRVIQLDNGMLVLLISNPAEKATSCALSVATGSHNDP 60
            MS   +++FDV  Y P++ S+R H++  L NG+L LLIS+PA+  TSC+LSVA+GSHNDP
Sbjct: 1    MSWQEIKDFDVPLYLPLAYSNRVHKLCLLPNGLLTLLISDPADTVTSCSLSVASGSHNDP 60

Query: 61   KEILGLAHFCEHMILSAGSKSYPDPNAYHDVISKNGGSQNAFTTGEQTTFCFELPNLSNS 120
            K+I GLAH CEHMIL+AGSKSYPDP  YH+ +SKN G  NAFTTGEQTTF FE+PN+ + 
Sbjct: 61   KDIQGLAHLCEHMILAAGSKSYPDPGLYHETLSKNNGVHNAFTTGEQTTFYFEVPNVHHG 120

Query: 121  DELVFDKVLDIFSSSFKKPLFNELLVNKEIYAINSEHTANKSSRDKIFYHATRLLANGDH 180
             ELVFD++LDIF+S FK+PLFN LL NKEIYAI SEH  N SS  KI YHATR+L++  H
Sbjct: 121  GELVFDEILDIFASFFKEPLFNPLLTNKEIYAIQSEHDGNMSSVTKILYHATRMLSDPGH 180

Query: 181  PFSQFSTGDITTLSDILQLNKVDLRTEVIKYFKNNFYAENMCLCIKGPQSLNTLGKLVFS 240
            PFSQFSTG++ TL+ I +L  V+L+  + +YFK N+YA  M LC++GPQS+N L K   S
Sbjct: 181  PFSQFSTGNMNTLASIPKLQGVNLQRTLFQYFKKNYYASKMTLCLRGPQSVNILTKYALS 240

Query: 241  KFNDIK---GLPISRPLRTKNQPWLKLKSRNFSNDGFGLGLESFKILSRNWLQKYGNVGI 297
            KF DIK    L  SR     +    +    +  N      LESF IL  +W QKY ++  
Sbjct: 241  KFGDIKENTALTRSRFGSMSSISTKRSSKSSTENHSTKNDLESFNILEESWRQKYCDIPC 300

Query: 298  FTGCDNHNTVLVDSQKLPALRLIFPIHHRLTRLTKKEIDLLSQCWCELFGDESEGSLCHF 357
            F      N + + S K P LR++FP+    TR TK EI +    WCELFGDE++GSLC++
Sbjct: 301  FPEISKENMIFIKSSKQPTLRILFPVTDNKTRFTKGEIKIFGDLWCELFGDETKGSLCYY 360

Query: 358  MKKNDYITELTAFMSHFAVNDNALILELYLTNTGWKNLQMIVAVFFNKYVPIVIECGTYE 417
            +    +IT   A+ S FA+ +  LI+EL LT+TGW+N   I+ +   K V    E   +E
Sbjct: 361  LVGKSWITSCYAYTSSFALGNIGLIIELTLTSTGWENSDTIIEIVLGKLVETFSEQYVHE 420

Query: 418  LAEFLSELNCIELLKFLYQDVTLSSMEECSNLSSLLLTDIESLGPSFILKGN-PMNDCNE 476
            LA F+ + N I+L++FLYQ    + MEECSNLS LL  D+++   ++I KG+ P+ D +E
Sbjct: 421  LANFMEDQNSIDLIRFLYQVPKKNPMEECSNLSELLQNDLKAPNMAYIFKGSPPITDMHE 480

Query: 477  IDSELGSFAESEESRMWWIGHAIKFQSFIKEFINFENVRLVLMGDLKECP-LMKTDLTSL 535
                +G    SE ++ WWI  AIKFQSF+K+F+N  N R++L+G L+  P L K ++ + 
Sbjct: 481  --GNVGGI-NSEHNQEWWIDQAIKFQSFMKKFMNSSNARVILLGSLERIPELFKKEIQN- 536

Query: 536  KLNIEPYYEFEYHKCRSDQSNFKLTVEEISYSFHIPYKNVFLPSVGFNLSLIKNALLASS 595
             L  EP+YEFEY   +    N K +    +Y F IP+KN F+PS      +++   L SS
Sbjct: 537  TLTTEPFYEFEY---KISTINLKASQSVNTYEFCIPHKNKFIPSACKGDGVLEQLFLESS 593

Query: 596  NRSQTAALSLGSQNANPHVLPKLLGKNCFYEMWVKEEDFELTFKSKSIVTFEIISTHLNP 655
             +SQ + L L   + +    P+L+G+N  YEMW  +ED       KSIV+FE++ST +  
Sbjct: 594  LKSQYSNLHLQINSMSFENKPQLVGRNQRYEMWTLKEDLNSIMDLKSIVSFEVLSTDMKG 653

Query: 656  EPSYTMMLEILCELLGDMLSSQLYPSEKIGYTYEIAASSKGDVRIGFTVSGFSEGVYKII 715
             P  T+ LEIL +++  ++S QLYP+ K+GY YEI+ASSKGDV++ FT+ GFSEG+  +I
Sbjct: 654  SPENTIHLEILNQIIFTLISPQLYPAIKLGYFYEISASSKGDVQLRFTIGGFSEGILMLI 713

Query: 716  EKIVGTLVQIVYSEVVIARDLFRKSRIAVRNKYEEAASVNSTTLVNIGLLIVLEKYMWRL 775
            E I+ T++ I  +    +++L R++R+ VR+ YE AA+ N   L ++GLLIVLE+ MW L
Sbjct: 714  EIIIKTIIFITTTPDFPSKELLRRARVLVRSNYENAAADNCVKLASLGLLIVLEENMWSL 773

Query: 776  ESRLEALESTDMESFKQFLSDFFGNSTYMNLFIQGDQTYTDQINIFLDRNLTGHLSKKRD 835
            E R++ALE   M SFK+F   F   S Y+ LFIQG+ +Y D+IN FL+ N T HL   +D
Sbjct: 774  EDRIDALEDVTMASFKEFCQSFLNGSKYLTLFIQGNLSYADKINQFLNLNFTKHLDINKD 833

Query: 836  AVKILNEPTST-ILKPGSNLFITHKGFKDDPNNSIVYFIQTGDRTDNYSYTLTAFTAFLI 894
                LN  TST ILKPG+N+F  + G  DDPNNSIVYFIQTG R+D    TLT+FT +++
Sbjct: 834  TSLPLNAHTSTHILKPGTNIFAEYPGPLDDPNNSIVYFIQTGLRSDTDLCTLTSFTEYIM 893

Query: 895  SLTLVPDLRGRKQVGYIVLGGLRTLSSTVGLHITITSSSPPHFLEEKIGEYLSYLEKDLL 954
            SLTLVP+LR +KQ+GY+V+GGLR L+ T+G++IT+ S S P  LE KI EY++++E  +L
Sbjct: 894  SLTLVPELRNKKQIGYLVMGGLRVLTDTIGVYITVMSGSEPIDLESKIDEYIAFIENGVL 953

Query: 955  DNLKPQLFREKYVKEYLNVILSGKMEKTERELAPVNLMSRIKANVRSGNLDRVGRT-MKS 1013
            + L    F  +Y + YL ++      K  +   P NL++ I  NV+ G+ D++  T MK 
Sbjct: 954  NRLTEATFEREYKQAYLTLLGDNNQNKGGKLSGPANLLNEIVPNVQVGSSDQLNSTSMKL 1013

Query: 1014 HRRIRAQISSKRYNFEDEDEPIDLQLIESLDFVHYMQFFKQKISIYSSLRSKISVMVSSP 1073
            HRR R QIS K+YNF DE+  ID+ LIE L    Y+ FFK KISI+S  RSK+S+M++S 
Sbjct: 1014 HRRFRNQISDKQYNFTDEELHIDIPLIEKLTLSSYLNFFKDKISIFSPTRSKLSIMITSS 1073

Query: 1074 MSRSEIYNRKVFLQLESFLKLKGFKISGEQLQKIVRKSDGKPTVLMKELFRYFASRGESL 1133
            M+  +I NRK +LQLE+FLK+KGF I  E+LQ+IV  +DG  ++L+K LF YF SR E  
Sbjct: 1074 MAAKDIINRKTYLQLEAFLKIKGFTIKKEKLQEIVDSADGNSSLLIKNLFNYFRSRNEGW 1133

Query: 1134 KICTVMLKEITRQLSSSLK 1152
            K+CTV+LKE+ +   +SLK
Sbjct: 1134 KLCTVVLKEVVKMSITSLK 1152

>YPR122W Chr16 (782045..785671) [3627 bp, 1208 aa] {ON}  AXL1Haploid
            specific endoprotease that performs one of two N-terminal
            cleavages during maturation of a-factor mating pheromone;
            required for axial budding pattern of haploid cells
          Length = 1208

 Score = 1027 bits (2656), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 544/1207 (45%), Positives = 768/1207 (63%), Gaps = 29/1207 (2%)

Query: 1    MSSFGVRNFDVQFYTPISCSSRSHRVIQLDNGMLVLLISNPAEKATSCALSVATGSHNDP 60
            MS   V N++V FY P+S S+R+H+V +L NG+L L+IS+P + ++SC+L+V TGSHNDP
Sbjct: 1    MSLREVTNYEVSFYIPLSYSNRTHKVCKLPNGILALIISDPTDTSSSCSLTVCTGSHNDP 60

Query: 61   KEILGLAHFCEHMILSAGSKSYPDPNAYHDVISKNGGSQNAFTTGEQTTFCFELPNLSNS 120
            K+I GLAH CEHMILSAGSK YPDP  +H +I+KN GSQNAFTTGEQTTF FELPN  N+
Sbjct: 61   KDIAGLAHLCEHMILSAGSKKYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQNN 120

Query: 121  DELVFDKVLDIFSSSFKKPLFNELLVNKEIYAINSEHTANKSSRDKIFYHATRLLANGDH 180
             E  F+ +LD+F+S FK+PLFN LL++KEIYAI SEH  N SS  KIFYHA R+LAN DH
Sbjct: 121  GEFTFESILDVFASFFKEPLFNPLLISKEIYAIQSEHEGNISSTTKIFYHAARILANPDH 180

Query: 181  PFSQFSTGDITTLSDILQLNKVDLRTEVIKYFKNNFYAENMCLCIKGPQSLNTLGKLVFS 240
            PFS+FSTG+I +LS I QL K+ L++ +  YF+NNF+ EN+ LCI+GPQS+N L KL  S
Sbjct: 181  PFSRFSTGNIHSLSSIPQLKKIKLKSSLNTYFENNFFGENITLCIRGPQSVNILTKLALS 240

Query: 241  KFNDIKGLPIS----RPLRTKNQPWLK---LKSRNFSNDGFGLGLESFKILSRNWLQKYG 293
            KF DIK  P S    R +  + + + +   LK R  S+      L++FKIL+  W +KY 
Sbjct: 241  KFGDIK--PKSAVKERSISIRTRSFRRSKSLKKRQDSSKNDYSDLKTFKILNTTWEKKYK 298

Query: 294  NVGIFTGCDNHNTVLVDSQKLPALRLIFPIHHRLTRLTKKEIDLLSQCWCELFGDESEGS 353
            N   F      N++ ++S K+P +RL+FP+  + TR TK +I + S  WCELFGDES GS
Sbjct: 299  NTMCFQQFPECNSIFINSNKVPIMRLLFPVSDKNTRFTKDDIKIYSHLWCELFGDESPGS 358

Query: 354  LCHFMKKNDYITELTAFMSHFAVNDNALILELYLTNTGWKNLQMIVAVFFNKYVPIVIEC 413
            L +++    ++T   AF S FA+ D  LILEL LTN+GW+N++ I  +  N+ +P     
Sbjct: 359  LSYYLASKGWLTGCFAFTSEFAIGDIGLILELELTNSGWENIKRITTIVLNRLLPSFYVM 418

Query: 414  GTYELAEFLSELNCIELLKFLYQDVTLSSMEECSNLSSLLLTDIESLGPSFILKGNPMND 473
                L  FL E N I+L+ FLYQ      MEECS LS +L  D+E L P  I KG     
Sbjct: 419  NIDYLITFLKEQNLIDLVSFLYQSSEDLPMEECSKLSGILQDDLECLTPPNIFKG--FKS 476

Query: 474  CNEIDS-ELGSFAESEESRMWWIGHAIKFQSFIKEFINFENVRLVLMGDLKECPLMKTDL 532
              EID   +  +  ++ +  WW G AIKFQ+F+K F+N +N+RL+L+G++K   +     
Sbjct: 477  LIEIDDPNIEKYENTKANIQWWTGQAIKFQNFLKSFMNHDNMRLLLLGNIKSGNIFDKMK 536

Query: 533  TSLKLNIEPYYEFEYHKCRSDQSNFKLTVEEISYSFHIPYKNVFLPSVGFNLSLIKNALL 592
                +  + +YEFEY+      ++        SY F+ P  N+FLP    +   ++   L
Sbjct: 537  NKSDICTDFFYEFEYYTANVHLASDNKFHSNSSYEFNFPTGNLFLPDCVSDPLKLQQLFL 596

Query: 593  ASSNRSQTAALSLGSQNANPHVLPKLLGKNCFYEMWVKEEDFELTFKSKSIVTFEIISTH 652
              S +S+ A L     +      P+L+ +N  YEMW+ +ED      +KS+V+FE++   
Sbjct: 597  ECSLKSKFATLRPQIYSEPTRTKPQLVSENQNYEMWILKEDPNFASDNKSVVSFEVLGLG 656

Query: 653  LNPEPSYTMMLEILCELLGDMLSSQLYPSEKIGYTYEIAASSKGDVRIGFTVSGFSEGVY 712
            + P P  T+ LE+L + L  + SS LYP+ +IGYTYEIA+SSKG+V + FT+SGF EGV+
Sbjct: 657  IKPSPEATIHLEVLAQALFIITSSFLYPALRIGYTYEIASSSKGNVTLRFTISGFPEGVF 716

Query: 713  KIIEKIVGTLVQIVYSEVVIARDLFRKSRIAVRNKYEEAASVNSTTLVNIGLLIVLEKYM 772
             I++  V TL  I      +++D  RK+RI VRNKY+ A+S N   L ++GLLIVLEKY+
Sbjct: 717  TIVKTFVDTLKLIATDPTFLSKDTLRKARILVRNKYKNASSDNCVKLASVGLLIVLEKYI 776

Query: 773  WRLESRLEALESTDMESFKQFLSDFFGNSTYMNLFIQGDQTYTDQINIFLDRNLTGHL-- 830
            W LE R+ ALE T++ESF++F   F+ N  ++ LF+QG   Y D IN +L+ N T HL  
Sbjct: 777  WTLEDRINALELTELESFEKFCFLFWRNPKHLVLFMQGSLEYADAINRYLNNNFTQHLKI 836

Query: 831  --SKKRDAVKILNEPTSTILKPGSNLFITHKGFKDDPNNSIVYFIQTGDRTDNYSYTLTA 888
                 +  +++   P++  L  G+N FI++ G +DDPNNSIVYFIQT  R D  + TLT 
Sbjct: 837  SNEGSKPTIRLYPPPSTKDLDQGTNAFISYNGHQDDPNNSIVYFIQTAQRDDIKNLTLTF 896

Query: 889  FTAFLISLTLVPDLRGRKQVGYIVLGGLRTLSSTVGLHITITSSSPPHFLEEKIGEYLSY 948
             T +L SLTLVPDLR +KQ+GYIVLGGLR L+ TVG+HIT+ S S  H LE +I EYLSY
Sbjct: 897  LTEYLFSLTLVPDLRNKKQIGYIVLGGLRVLTDTVGIHITVMSGSSGHNLETRINEYLSY 956

Query: 949  LEKDLLDNLKPQLFREKYVKEYLNVILSGKMEKTERELAPVNLMSRIKANVRSG-NLDRV 1007
            L+  +L+      FR   ++ +LN++     ++ E    PV+L++ I ANV++G N    
Sbjct: 957  LQLQVLNRFTEFDFRRILLEPFLNLLKQNSTKQFEGSAGPVDLLNEIVANVQNGDNYTLN 1016

Query: 1008 GRTMKSHRRIRAQISSKRYNFEDEDEPIDLQLIESLDFVHYMQFFKQKISIYSSLRSKIS 1067
             + M+ HR++R +I+  R NF+++ E ID+  ++ L    Y+ FF+ KISIYS+ RSK+S
Sbjct: 1017 NKQMRQHRKVRNKIAEGRLNFQEDHEMIDISFLQKLTLKKYLAFFESKISIYSAQRSKLS 1076

Query: 1068 VMVSSPMSRSEIYNRKVFLQLESFLKLKGFKISGEQLQKIVRKSDGKPTVLMKELFRYFA 1127
            +M++SPM+  EI +RK+FLQLE+FLK+ GF I  E L+KIV  S G P +L+K LF YF 
Sbjct: 1077 IMITSPMAEKEIASRKMFLQLEAFLKINGFAIKNEDLKKIVEHSKGNPILLVKNLFTYFR 1136

Query: 1128 SRGESLKICTVMLKEITRQLSSSLKN-----LG-------ARKSPNFERPNGSPTVPLTE 1175
             R E  K+ TV+L+EI + +  +LK      LG        ++   F   + SP VPL E
Sbjct: 1137 RRNEVFKLGTVVLQEILKIIGMNLKQRYGSILGFSSQDGEGQEIEKFWNNDTSPIVPLQE 1196

Query: 1176 IVDPDAY 1182
            + +P+ +
Sbjct: 1197 LPEPNFF 1203

>Skud_16.412 Chr16 (741265..744891) [3627 bp, 1208 aa] {ON} YPR122W
            (REAL)
          Length = 1208

 Score = 1023 bits (2646), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 548/1211 (45%), Positives = 760/1211 (62%), Gaps = 37/1211 (3%)

Query: 1    MSSFGVRNFDVQFYTPISCSSRSHRVIQLDNGMLVLLISNPAEKATSCALSVATGSHNDP 60
            MS   V N++V  Y P+S S+R+H++ +L NG+L LLIS+P + ++SC+LSV TGSHNDP
Sbjct: 1    MSLREVINYEVPIYIPLSYSNRTHKICKLPNGILALLISDPTDTSSSCSLSVCTGSHNDP 60

Query: 61   KEILGLAHFCEHMILSAGSKSYPDPNAYHDVISKNGGSQNAFTTGEQTTFCFELPNLSNS 120
            K+ LGLAH CEHMIL+AGSK YPD   +H +I+KN GSQNA+TTGEQTTF FELPN  ++
Sbjct: 61   KDTLGLAHLCEHMILAAGSKQYPDAGLFHTLIAKNNGSQNAYTTGEQTTFYFELPNSQSN 120

Query: 121  DELVFDKVLDIFSSSFKKPLFNELLVNKEIYAINSEHTANKSSRDKIFYHATRLLANGDH 180
             E  F+ +LD+F+S FK PLFN LL++KEIYAI SEH  N SS  KIFYHA RLLAN DH
Sbjct: 121  GEFAFEFILDVFASFFKNPLFNPLLISKEIYAIQSEHEGNISSTTKIFYHAARLLANSDH 180

Query: 181  PFSQFSTGDITTLSDILQLNKVDLRTEVIKYFKNNFYAENMCLCIKGPQSLNTLGKLVFS 240
            PFS+FSTG+I +LS I QL K++L+  +  YFKNN++ EN+ +CI+GPQS+N L KL  S
Sbjct: 181  PFSRFSTGNIHSLSSIPQLKKINLKNSLNAYFKNNYFGENITICIRGPQSVNILAKLAIS 240

Query: 241  KFNDIKGLPISRPLRTKNQPWLKLKSRNF-------SNDGFGLG----LESFKILSRNWL 289
            KF DIK      P  +       +++ +F       S   F       LESFKIL   W 
Sbjct: 241  KFGDIK------PKNSVEGNNFSIRAGSFRRSRSVKSTGDFSKNDHRKLESFKILETVWE 294

Query: 290  QKYGNVGIFTGCDNHNTVLVDSQKLPALRLIFPIHHRLTRLTKKEIDLLSQCWCELFGDE 349
            +KY N   F      NT+ ++S K P +R +FP+  + TR TK++I + S  WCELFGDE
Sbjct: 295  EKYKNSKCFEHPPGKNTIFINSNKSPVIRFLFPVSDKNTRFTKEDIKIYSHLWCELFGDE 354

Query: 350  SEGSLCHFMKKNDYITELTAFMSHFAVNDNALILELYLTNTGWKNLQMIVAVFFNKYVPI 409
            S GSL  ++    +IT+  AF S FA+ +  L+LEL LTN+GW++++ I    F+K +P 
Sbjct: 355  SPGSLGSYLVSRGWITKCFAFTSEFAIGNIGLMLELELTNSGWESIKDITTTIFSKLLPS 414

Query: 410  VIECGTYELAEFLSELNCIELLKFLYQDVTLSSMEECSNLSSLLLTDIESLGPSFILKGN 469
                    L  FL E N I++ +FLYQ      MEECSNLS++L  ++E L PS + KG 
Sbjct: 415  FYVKNIDYLITFLKEQNLIDIARFLYQSSEDIPMEECSNLSTILQENLEYLTPSNVFKG- 473

Query: 470  PMNDCNEIDS-ELGSFAESEESRMWWIGHAIKFQSFIKEFINFENVRLVLMGDLKECPLM 528
                  EID   +  +  SE +  WWIG AIKFQ+F+K  +N EN RL+++G++K   + 
Sbjct: 474  -FKSLIEIDDPNIDKYENSEANMQWWIGQAIKFQNFLKSHMNHENTRLLILGNVKSYEVF 532

Query: 529  KTDLTSLKLNIEPYYEFEYHKCRSDQSNFKLTVEEISYSFHIPYKNVFLPSVGFNLSLIK 588
                   ++  + +YEFEY+  + D +    +  +  Y F+ P  N+FLP    +   ++
Sbjct: 533  DKIEKRSEMYTDFFYEFEYYTGKVDLTRDDESYAKSYYEFNFPTSNIFLPDYINDPLKLQ 592

Query: 589  NALLASSNRSQTAALSLGSQNANPHVLPKLLGKNCFYEMWVKEEDFELTFKSKSIVTFEI 648
               L  S +S+ A L    Q+     LP+L+ KN  YEMWV +ED      +KSIV+FEI
Sbjct: 593  QLFLECSLKSKFATLRPQIQSEPTKRLPQLVSKNLNYEMWVLKEDPNFISDNKSIVSFEI 652

Query: 649  ISTHLNPEPSYTMMLEILCELLGDMLSSQLYPSEKIGYTYEIAASSKGDVRIGFTVSGFS 708
            +   + P P  T+ LE+L ++L  + SS LYP+ ++GYTYEIA+SSKG+V + FT+SGFS
Sbjct: 653  LGLGIKPSPEATIHLEVLAQVLFIITSSYLYPALRVGYTYEIASSSKGNVTLRFTISGFS 712

Query: 709  EGVYKIIEKIVGTLVQIVYSEVVIARDLFRKSRIAVRNKYEEAASVNSTTLVNIGLLIVL 768
            EGVY I +  V TL +I      +++D  RK+RI VR KYE A+S N   L +IGLLIVL
Sbjct: 713  EGVYTIAKTFVDTLKKIATDATFLSKDTVRKARILVRRKYEGASSDNCVKLASIGLLIVL 772

Query: 769  EKYMWRLESRLEALESTDMESFKQFLSDFFGNSTYMNLFIQGDQTYTDQINIFLDRNLTG 828
            E+YMW L+ R++ALE T+  SFK+F   F+ N   + L IQG+  Y D+IN +L+ N T 
Sbjct: 773  EEYMWTLQDRIDALELTETSSFKEFCYLFWNNPKRLVLLIQGNLEYADEINHYLNNNFTQ 832

Query: 829  HL----SKKRDAVKILNEPTSTILKPGSNLFITHKGFKDDPNNSIVYFIQTGDRTDNYSY 884
            HL       R  + +   P++  L  G+N F+++ G +DDPNNSIVYFIQT  R D  S 
Sbjct: 833  HLKVSNEDNRPTICLYPSPSTKNLDRGTNTFVSYNGHQDDPNNSIVYFIQTAKRNDIESM 892

Query: 885  TLTAFTAFLISLTLVPDLRGRKQVGYIVLGGLRTLSSTVGLHITITSSSPPHFLEEKIGE 944
            TLT  T +L SLTLVPDLR +KQ+GYIVLGGLR L+ TVG+HIT+ S  P H LE KI E
Sbjct: 893  TLTFLTEYLFSLTLVPDLRNKKQIGYIVLGGLRVLTETVGIHITVMSGGPAHNLENKINE 952

Query: 945  YLSYLEKDLLDNLKPQLFREKYVKEYLNVILSGKMEKTERELAPVNLMSRIKANVRSG-N 1003
            YLSYL+  +L+      FR   ++ +L ++      K E    PVNL++ I ANV++G N
Sbjct: 953  YLSYLQLQVLNTFTESDFRRILLEPFLALLKQNSFNKLESSSGPVNLLNEIVANVQNGDN 1012

Query: 1004 LDRVGRTMKSHRRIRAQISSKRYNFEDEDEPIDLQLIESLDFVHYMQFFKQKISIYSSLR 1063
                 R MK HR+IR +I  +R++F+DE E  D+  ++ L    Y++FF+ KISIYS  R
Sbjct: 1013 YTLNNRQMKQHRKIRNKIIERRFSFQDEYEMFDIPFLQGLTLKRYLEFFESKISIYSRQR 1072

Query: 1064 SKISVMVSSPMSRSEIYNRKVFLQLESFLKLKGFKISGEQLQKIVRKSDGKPTVLMKELF 1123
            SK+S+M++SPM+  +I +RK+FLQLE+FLK+KGF I  E L+ IV  S G P +L+K LF
Sbjct: 1073 SKLSIMITSPMAEEDIVSRKMFLQLEAFLKIKGFAIKSEDLKSIVDNSKGSPVLLIKNLF 1132

Query: 1124 RYFASRGESLKICTVMLKEITRQLSSSLKN-----LGARKSPN-------FERPNGSPTV 1171
              F  R E+ K+  V+L+EI++ +  S K      LG     N       F + +  P +
Sbjct: 1133 TSFRRRNEAFKLGAVVLQEISKIIIVSFKQRYDSILGFPLHKNEHQDIEKFWKTDIKPII 1192

Query: 1172 PLTEIVDPDAY 1182
            PL  + DP+ +
Sbjct: 1193 PLQGLPDPNVF 1203

>TDEL0F03400 Chr6 (628126..631638) [3513 bp, 1170 aa] {ON} Anc_3.455
            YPR122W
          Length = 1170

 Score = 1008 bits (2605), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 519/1185 (43%), Positives = 757/1185 (63%), Gaps = 23/1185 (1%)

Query: 1    MSSFGVRNFDVQFYTPISCSSRSHRVIQLDNGMLVLLISNPAEKATSCALSVATGSHNDP 60
            MS   V++ +V F+TP+S S+R+H++ QL NG+L+LLIS+P E  ++C+L+VA GS+ND 
Sbjct: 1    MSWSQVKHINVPFFTPLSYSNRTHKLCQLPNGILLLLISDPTESVSACSLTVAAGSYNDS 60

Query: 61   KEILGLAHFCEHMILSAGSKSYPDPNAYHDVISKNGGSQNAFTTGEQTTFCFELPNLSNS 120
             ++ G+AH CEHM+L+ GSK YP P  YHD+I+KN GS NAFTTGEQTTF FELP+ + +
Sbjct: 61   DDVPGVAHLCEHMLLAGGSKKYPSPGCYHDMITKNNGSYNAFTTGEQTTFYFELPDFNQA 120

Query: 121  DELVFDKVLDIFSSSFKKPLFNELLVNKEIYAINSEHTANKSSRDKIFYHATRLLANGDH 180
             E  F+K +DIF+S F +PLF+  L+NKEIYAI +EH +N S+  KI YHATRLL +  H
Sbjct: 121  PEAGFEKAIDIFASFFSEPLFDHTLINKEIYAIQNEHDSNVSNVTKILYHATRLLGDKSH 180

Query: 181  PFSQFSTGDITTLSDILQLNKVDLRTEVIKYFKNNFYAENMCLCIKGPQSLNTLGKLVFS 240
            PFS+F+TG++++L + L+L    LR  +  +F+ N+    M +C++GP S+N L KL  S
Sbjct: 181  PFSRFATGNMSSLKNTLRLKGPTLRNLLSNHFRENYAPSRMTICLRGPSSVNGLAKLAIS 240

Query: 241  KFNDIKGLPISRPLRTKNQPWLKLKSRNFSNDGFGLGLESFKILSRNWLQKYGNVGIFTG 300
            KF ++      RP +       K+++    NDGF        IL   W         F  
Sbjct: 241  KFGEL------RPHKANE----KVQAALTPNDGFN-------ILQTRWGHTKAANNCFPS 283

Query: 301  CDNHNTVLVDSQKLPALRLIFPIHHRLTRLTKKEIDLLSQCWCELFGDESEGSLCHFMKK 360
            C   NT+ VDS KLP +R +FP+  + TR TKK+  +  + W ELFGDES GS CHF+ +
Sbjct: 284  CLERNTICVDSGKLPIMRFLFPVWQKFTRFTKKDFLIFERFWFELFGDESAGSFCHFLVE 343

Query: 361  NDYITELTAFMSHFAVNDNALILELYLTNTGWKNLQMIVAVFFNKYVPIVIECGTYELAE 420
              +IT   A++S F+ ++  LILEL LTN+GW N+++I        VP      T +LA 
Sbjct: 344  KGWITNCYAYISRFSTDNTGLILELSLTNSGWHNIELIAQTLIFYLVPKFSREHTVQLAR 403

Query: 421  FLSELNCIELLKFLYQDVTLSSMEECSNLSSLLLTDIESLGPSFILKGNPMNDCNEIDSE 480
            FLSE   I+L++FLY +   S M ECSNL  +L  DI  L  S I  G+PM   NE  S 
Sbjct: 404  FLSEQFSIDLIRFLYSNAENSPMTECSNLCEVLQEDINGLDNSCIFMGSPMV-LNE-QST 461

Query: 481  LGSFAESEESRMWWIGHAIKFQSFIKEFINFENVRLVLMGDLKECPLMKTDLTSLKLNIE 540
             G F+E+EES+ WWIG AIKFQSF+KEF+N  N+RL+L+G L++C L  T         +
Sbjct: 462  QGLFSENEESQKWWIGQAIKFQSFLKEFMNHSNMRLILLGCLEDCSLSTTATQGKIAGTD 521

Query: 541  PYYEFEYHKCRSDQSNFKLTVEEISYSFHIPYKNVFLPSVGFNLSLIKNALLASSNRSQT 600
            P+Y+F Y  C+         +    Y F IP KN F PS   N   +   L  SS +SQ 
Sbjct: 522  PFYDFAYFTCKLSLRKPHANILN-DYKFSIPPKNEFKPSWAENFPSLMRKLYYSSTKSQQ 580

Query: 601  AALSLGSQNANPHVLPKLLGKNCFYEMWVKEEDFELTFKSKSIVTFEIISTHLNPEPSYT 660
            A+L    ++      P+L+ +N  Y+MWV  +    + +SK+IV+FEI    + P P  T
Sbjct: 581  ASLGFAIKSDEGTRTPQLVSQNENYDMWVLSDCPASSHQSKAIVSFEISCWEIQPSPENT 640

Query: 661  MMLEILCELLGDMLSSQLYPSEKIGYTYEIAASSKGDVRIGFTVSGFSEGVYKIIEKIVG 720
            M LEIL +++   L+S LYPS K+G+T+EI  SS+GDVR+G  +SG+S+ + K+IE +  
Sbjct: 641  MNLEILAQVINLTLASDLYPSLKLGFTFEIYPSSRGDVRLGLVISGYSKRLGKVIESLSS 700

Query: 721  TLVQIVYSEVVIARDLFRKSRIAVRNKYEEAASVNSTTLVNIGLLIVLEKYMWRLESRLE 780
             + ++   +   +R+LFRK+RI+VR+ Y++A   +S  + +IGLL+V+EKYMW L+ R++
Sbjct: 701  IIRRLKSEKSFPSRELFRKARISVRSNYDKAEDNSSINVASIGLLVVMEKYMWSLQDRID 760

Query: 781  ALESTDMESFKQFLSDFFGNSTYMNLFIQGDQTYTDQINIFLDRNLTGHLSKKRDAVKIL 840
            A+E  D+++FK F + F     ++ LFIQGD ++ D IN  LDRNLT HL   +   +  
Sbjct: 761  AIECIDLQTFKAFAASFADYRKFLRLFIQGDLSHADDINACLDRNLTNHLHGTQTDFQRE 820

Query: 841  NEPTST-ILKPGSNLFITHKGFKDDPNNSIVYFIQTGDRTDNYSYTLTAFTAFLISLTLV 899
             E  ST +L P +N ++ + G KDDP NS VY+IQTG R D  +YTLTA +A+++S TL 
Sbjct: 821  PEYCSTKLLDPATNFYVEYPGRKDDPTNSTVYYIQTGPRDDCTAYTLTALSAYMMSFTLK 880

Query: 900  PDLRGRKQVGYIVLGGLRTLSSTVGLHITITSSSPPHFLEEKIGEYLSYLEKDLLDNLKP 959
            P+LR ++Q+GY+V+GGLR L + VGLHI+I S+  P  LEEKI EYL YLE+++L  +  
Sbjct: 881  PELRNKRQIGYVVMGGLRLLRNAVGLHISIMSTLEPLALEEKINEYLLYLEREVLTPMTE 940

Query: 960  QLFREKYVKEYLNVILSGKMEKTERELAPVNLMSRIKANVRSGNLDRVGRT-MKSHRRIR 1018
              FR KY+K++LN+   G ++K  ++  P +LM +I ANV+SG+ D +  + MK H+R+R
Sbjct: 941  DTFRNKYLKDFLNLQSKGNLDKLRKDSGPADLMDQIVANVQSGDSDILNSSFMKKHKRLR 1000

Query: 1019 AQISSKRYNFEDEDEPIDLQLIESLDFVHYMQFFKQKISIYSSLRSKISVMVSSPMSRSE 1078
             QI+  RY F D D  I+  L++ L   HY+ FF+++ISI+S  R+K+SVMV SPM+  E
Sbjct: 1001 NQIADGRYTFADRDSAINTTLLQELTIDHYLCFFRERISIHSKTRAKLSVMVKSPMTDEE 1060

Query: 1079 IYNRKVFLQLESFLKLKGFKISGEQLQKIVRKSDGKPTVLMKELFRYFASRGESLKICTV 1138
            I NR+++ Q+++FLKL G  I   +L+++V++S GKP +L KEL++ F SR E+ K+CTV
Sbjct: 1061 IVNRQIYSQVDAFLKLHGLTIETAKLRELVQRSKGKPMLLAKELYQSFHSRHETWKLCTV 1120

Query: 1139 MLKEITRQLSSSLKNLGARKSPNFERPNGS-PTVPLTEIVDPDAY 1182
            ML+E+ + L+ +LK    R++       GS P   LT I D + Y
Sbjct: 1121 MLRELLKMLTVNLKFRHQRQTNMAASEWGSTPATGLTLIKDINIY 1165

>Kpol_1050.88 s1050 (199457..203098) [3642 bp, 1213 aa] {ON}
            (199457..203098) [3642 nt, 1214 aa]
          Length = 1213

 Score = 1008 bits (2605), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 533/1182 (45%), Positives = 754/1182 (63%), Gaps = 28/1182 (2%)

Query: 1    MSSFGVRNFDVQFYTPISCSSRSHRVIQLDNGMLVLLISNPAEKATSCALSVATGSHNDP 60
            MS   V+N+D+ FYTPIS   R++++ +L NGMLVLLIS+P E +  C+LSVATGSHNDP
Sbjct: 1    MSWSEVKNYDIPFYTPISYRGRTNKLCRLPNGMLVLLISDPGESSFGCSLSVATGSHNDP 60

Query: 61   KEILGLAHFCEHMILSAGSKSYPDPNAYHDVISKNGGSQNAFTTGEQTTFCFELPNLSNS 120
            KEI GLAH CEHMIL+AGSK YP+P  YH++I+KN G QNA+TTGEQTTF FELPN++ +
Sbjct: 61   KEIPGLAHLCEHMILAAGSKKYPNPGLYHELIAKNKGLQNAYTTGEQTTFYFELPNVNQT 120

Query: 121  DELVFDKVLDIFSSSFKKPLFNELLVNKEIYAINSEHTANKSSRDKIFYHATRLLANGDH 180
               VF+ ++D+F+S FK PLFN+ L +KEIYAI SEHT N S+  KIFYHA RLLAN +H
Sbjct: 121  STPVFEDIIDVFASFFKDPLFNQTLTSKEIYAIESEHTGNTSNPTKIFYHAERLLANSNH 180

Query: 181  PFSQFSTGDITTLSDILQLNKVDLRTEVIKYFKNNFYAENMCLCIKGPQSLNTLGKLVFS 240
            PFS FSTG+I TLS   QL K++L++ +  YFK NF AENM LCIKGPQS+N L K+   
Sbjct: 181  PFSHFSTGNINTLSSGPQLRKINLKSLLDSYFKVNFKAENMTLCIKGPQSVNILTKIAIR 240

Query: 241  KFNDIKGL-PISRPLR-----------TKNQPW-----LKLKSRNFSNDGFGLGLESFKI 283
             F+DIKGL  I +P R            K+ P         KS +         L S KI
Sbjct: 241  YFSDIKGLNSIKKPKRFGTIRKSISTSEKSIPLSPSSPTSCKSISSVLSETNSSLLSTKI 300

Query: 284  LSRNWLQKYGNVGIFTGCDNHNTVLVDSQKLPALRLIFPIHHRLTRLTKKEIDLLSQCWC 343
            L   W  KY N+  F     +NT++V S K P LRL+FP+     + +K+E+      WC
Sbjct: 301  LENVWSPKYNNMVCFDPKPKYNTIIVKSNKKPVLRLVFPVVTNKGKFSKEELITFCNLWC 360

Query: 344  ELFGDESEGSLCHFMKKNDYITELTAFMSHFAVNDNALILELYLTNTGWKNLQMIVAVFF 403
            E  GDESE S+C+ +   +YIT++ AF S FA+N+  LILE  LT+ G  N+  I+    
Sbjct: 361  ETLGDESENSICNILMNEEYITDILAFTSDFALNNIGLILEFSLTDKGLNNVSHIINSIM 420

Query: 404  NKYVPIVIECGTYELAEFLSELNCIELLKFLYQDVTLSSMEECSNLSSLLLTDIESLGPS 463
               +P + +  T ELA FLSE + I+LL FL+++  LS MEECS+LS L+ TD++ L P 
Sbjct: 421  ESAIPKLSKEYTEELARFLSECDSIDLLNFLHKESELSPMEECSDLSGLMQTDLDILKPE 480

Query: 464  FILKGNPMNDCNEIDSELGSFAESEESRMWWIGHAIKFQSFIKEFINFENVRLVLMGDLK 523
             + K +PM   N+  + +G+F ES ESR WW+  A  +Q F++ ++N + +R+ L+ D  
Sbjct: 481  CLFKQSPMIVGNKYPT-IGNFGESSESRQWWLNKATMYQEFLEMYMNKDLLRIALLCDFS 539

Query: 524  ECPLMKTDLTSLKLNIEPYYEFEYHKCRSDQSNFKLTVEEISYSFHIPYKNVFLPSVGFN 583
            E      +++  KL  + +YEF+Y K             +I  +   P KN ++P +G +
Sbjct: 540  EKQYFGKNVSEQKLVTDTFYEFDYIKLSVLPEKVPEDQVDIFSNLKFPAKNEYIPELGRS 599

Query: 584  LSLIKNALLASSNRSQTAALSLGSQNANPHVLPKLLGKNCFYEMWVKEEDFELTFKSKSI 643
            L  ++  L   S  S++  LSL + +     +PKL  K   YEMWV E+ F  + + K+I
Sbjct: 600  LLYLREMLKKVSYESRSPILSLTTPSKATRPIPKLAEKGDMYEMWVMEDKFRPSTEKKTI 659

Query: 644  VTFEIISTHLNPEPSYTMMLEILCELLGDMLSSQLYPSEKIGYTYEIAASSKGDVRIGFT 703
            VTF+++S  + P P  TM LEIL ++L  +LS +LYPS K+GYTYEIA+SSKGDVR+ FT
Sbjct: 660  VTFDLLSLDVPPTPKNTMHLEILGQILYVLLSPKLYPSLKLGYTYEIASSSKGDVRLSFT 719

Query: 704  VSGFSEGVYKIIEKIVGTLVQIVYSEVVIARDLFRKSRIAVRNKYEEAASVNSTTLVNIG 763
            +SG+S+G+ ++++ ++ T   I   + + ++ L R++RI  R KYE AA+ N   L ++G
Sbjct: 720  LSGYSDGLTEVVKTVIKTCFTIAIDDEIPSKRLLRRARILTRRKYESAAAENCAKLASVG 779

Query: 764  LLIVLEKYMWRLESRLEALESTDMESFKQFLSDFFGNSTYMNLFIQGDQTYTDQINIFLD 823
            L+I+LEKY+W LE RL ALE +D+ SFK+F   F  +  Y+NL +QG+    ++IN +L+
Sbjct: 780  LIIMLEKYIWPLEDRLNALEESDIHSFKEFCIAFLRSKKYLNLIVQGNLKCANEINKYLN 839

Query: 824  RNLTGHLSKK--RDAVKILNEPTSTILKPGSNLFITHKGFKDDPNNSIVYFIQTGDRTDN 881
             + T HL +K  ++   +    T+ +L+PG+N    H G  DDPNN IVYFIQTG R D 
Sbjct: 840  DSFTNHLGEKSGKNTKSVDCSKTTKLLEPGTNCIFEHFGHPDDPNNCIVYFIQTGKRDDK 899

Query: 882  YSYTLTAFTAFLISLTLVPDLRGRKQVGYIVLGGLRTLSSTVGLHITITSSSPPHFLEEK 941
             +  LT+FT +L+SLTLVPDLR +KQ+GY+V GG+R LS TVG+HIT+ S S P  LEEK
Sbjct: 900  KALALTSFTEYLLSLTLVPDLRNKKQIGYVVFGGMRVLSDTVGIHITVMSGSNPLDLEEK 959

Query: 942  IGEYLSYLEKDLLDNLKPQLFREKYVKEYLNVILSGKMEKTERELAPVNLMSRIKANVRS 1001
            I EYL +LE ++L  L  + F +K+VK+YL+ +             P N++  I ANV++
Sbjct: 960  IDEYLYFLESEVLKKLSEEQFGKKFVKDYLSTMGGDSTGDMMSTAGPPNVLDGIAANVQA 1019

Query: 1002 GNLDRVGR-TMKSHRRIRAQISSKRYNFEDEDEPIDLQLIESLDFVHYMQFFKQKISIYS 1060
            G+   +    M +HRRI+ +I+SKRYNF ++D   DL  I+ L    Y++FF++ ISI S
Sbjct: 1020 GDFSVLNSLQMITHRRIKNEITSKRYNFSNDDIETDLNFIKHLTLKKYLKFFEENISISS 1079

Query: 1061 SLRSKISVMVSSPMSRSEIYNRKVFLQLESFLKLKGFKISGEQLQKIVRKSDGKPTVLMK 1120
              RSK+SV ++SPM+  EI NRK FLQLE FLKL GF I+ + L+ +V +S G+P  L K
Sbjct: 1080 VNRSKLSVAITSPMATQEIMNRKFFLQLEGFLKLNGFTINNDTLKSMVSESQGRPGKLFK 1139

Query: 1121 ELFRYFASRGESLKICTVMLKEITRQLSSSLKNLGARKSPNF 1162
             LF YF++RGE  K C ++  E+ + ++ S+K       PNF
Sbjct: 1140 LLFNYFSNRGEGWKFCKIVTSEVLKIIAISVK-------PNF 1174

>NDAI0A04650 Chr1 complement(1046461..1050060) [3600 bp, 1199 aa] {ON}
            Anc_3.455 YPR122W
          Length = 1199

 Score = 1006 bits (2601), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 534/1212 (44%), Positives = 770/1212 (63%), Gaps = 58/1212 (4%)

Query: 1    MSSFGVRNFDVQFYTPISCSSRSHRVIQLDNGMLVLLISNPAEKATSCALSVATGSHNDP 60
            MS   V N+D  FY P   S R H++ +L NG+L LLIS+P +  ++C+LSVATGSHNDP
Sbjct: 1    MSWQDVENYDTPFYIPRCYSDRVHKLCRLPNGILTLLISDPKDTISACSLSVATGSHNDP 60

Query: 61   KEILGLAHFCEHMILSAGSKSYPDPNAYHDVISKNGGSQNAFTTGEQTTFCFELPNLSNS 120
             ++ GLAH CEHM+L+AGSK YP+   YH +++KN G+QNAFTTGEQTTF FE+P   NS
Sbjct: 61   ADLPGLAHLCEHMVLAAGSKDYPNAGLYHSMLTKNNGTQNAFTTGEQTTFYFEVPTTQNS 120

Query: 121  DELVFDKVLDIFSSSFKKPLFNELLVNKEIYAINSEHTANKSSRDKIFYHATRLLANGDH 180
             EL+FDK++D+FSS FK+PLFN LL NKEIYAI SEH  N SS +KI YHATRL+AN DH
Sbjct: 121  GELIFDKLVDVFSSFFKEPLFNPLLTNKEIYAIQSEHEGNISSLNKILYHATRLMANKDH 180

Query: 181  PFSQFSTGDITTLSDILQLNKVDLRTEVIKYFKNNFYAENMCLCIKGPQSLNTLGKLVFS 240
            PFSQFSTG+I TLS I QL K++L+  ++ YF  NFY   M LC++GPQS+NTL KLV S
Sbjct: 181  PFSQFSTGNINTLSSIPQLKKINLKKALLDYFARNFYGSKMTLCVRGPQSVNTLTKLVVS 240

Query: 241  KFNDIK---GLPISR---PLRTKNQPWLKLKSRNFSNDGFGLGLESFKILSRNWLQKYGN 294
            KF DI+   GL  S+        +    + K R  ++      LE + IL   W  KY  
Sbjct: 241  KFGDIRANNGLKRSKFGSISSRLSISSFQSKERQPTD------LEQYNILKSTWKPKYRE 294

Query: 295  VGIFT-GCDNHNTVLVDSQKLPALRLIFPIHHRLTRLTKKEIDLLSQCWCELFGDESEGS 353
               FT   D+ N + + S K   LR +FP+  + ++ + K + L    WCELFGDE++GS
Sbjct: 295  APCFTHDSDSANMIFIRSNKQSTLRFLFPVEDKFSKFSSKTVSLFKNFWCELFGDETKGS 354

Query: 354  LCHFMKKNDYITELTAFMSHFAVNDNALILELYLTNTGWKNLQMIVAVFFNKYVPIVIEC 413
            LC+ +    +IT+  A+ S F+     LIL+  LTNTGW N+  I+ +  +  +   I+ 
Sbjct: 355  LCYLLVGKSWITDCFAYTSEFSSGSYGLILQFALTNTGWDNVDKIINIVLDNTIAAFIDK 414

Query: 414  GTYELAEFLSELNCIELLKFLYQDVTLSSMEECSNLSSLLLTDIESLGPSFILKGNP-MN 472
             T +L+ FL E N I+L++FLYQ    S MEECSN+S LL  D+E L  S++ KG P ++
Sbjct: 415  PTDQLSCFLKEQNTIDLIRFLYQPTEKSPMEECSNISCLLQEDLEDLDISYLFKGAPTIS 474

Query: 473  DCNEIDSELGSFAESEESRMWWIGHAIKFQSFIKEFINFENVRLVLMGDLKECPLMKTD- 531
            DC   D+      E E+    W+  A +FQ F+K F+N  NV L L+G+ K    +++  
Sbjct: 475  DCYSNDNNTVDMIEYEQE--CWLKQAREFQEFLKVFMNRSNVFLFLLGNEKIAHSLRSII 532

Query: 532  -------LTSLKLNIEPYYEFEYHKCRSDQSNFKLTVEEISYSFHIPYKNVFLPSVGFNL 584
                   +  + LNI       + K  S Q           Y+F +P  N F+P    ++
Sbjct: 533  RIRYFLLMQCMSLNILNVIYLRFPKLLSTQ-----------YTFQVPPPNAFIPPSCQDV 581

Query: 585  SLIKNALLASSNRSQTAALSLGSQNANPHVLPKLLGKNCFYEMWVKEEDFELTFKSKSIV 644
            ++++   L SS +S+ +   L   N N   +P L+ +N  YEMW  +   + +   KSI+
Sbjct: 582  TILQQLFLESSLKSRFSTFRLQLLNTNLGNVPHLISRNSSYEMWALDNPIDASIDKKSIM 641

Query: 645  TFEIISTHLNPEPSYTMMLEILCELLGDMLSSQLYPSEKIGYTYEIAASSKGDVRIGFTV 704
            +FEI +  + P P  ++ LEIL ++L  ++S QLYPS ++GY+YEI++S KGD+++  T+
Sbjct: 642  SFEIFNRSMIPSPENSINLEILSQILSTLISPQLYPSIRLGYSYEISSSPKGDIQLKVTI 701

Query: 705  SGFSEGVYKIIEKIVGTLVQIVYSEVVIARDLFRKSRIAVRNKYEEAASVNSTTLVNIGL 764
             GFSEG+  I++ IV TL+ I+ +    +++L R+SR+ VRN YE AAS N  TL ++GL
Sbjct: 702  GGFSEGIISILDTIVKTLLFIMKTPQFPSKELLRRSRVLVRNLYEAAASDNCVTLASMGL 761

Query: 765  LIVLEKYMWRLESRLEALESTDMESFKQFLSDFFGNSTYMNLFIQGDQTYTDQINIFLDR 824
            LI+LE+ MW L+ RLEALE  DM SFK+F   F     YMNL IQG+  Y ++IN +L+ 
Sbjct: 762  LIILERNMWTLQDRLEALEEIDMVSFKEFCVQFLEEPMYMNLLIQGNLDYGEEINNYLNT 821

Query: 825  NLTGHLSKKRDAVKILNEPTST-----ILKPGSNLFITHKGFKDDPNNSIVYFIQTGDRT 879
            NLT HL    +   + NE  S+     +L+PGSN +  + G  DDPNNSIVYFIQTG RT
Sbjct: 822  NLTHHL----ECSNVKNEKQSSTLSTILLEPGSNFYAKYNGHMDDPNNSIVYFIQTGLRT 877

Query: 880  DNYSYTLTAFTAFLISLTLVPDLRGRKQVGYIVLGGLRTLSSTVGLHITITSSSPPHFLE 939
            +  + TLT FT +++SLTLVPDLR ++Q+GY V GGLR L+ST+G+HIT+ S   P  LE
Sbjct: 878  NRRTVTLTYFTEYIMSLTLVPDLRNKRQIGYAVFGGLRELTSTIGIHITVMSGISPSDLE 937

Query: 940  EKIGEYLSYLEKDLLDNLKPQLFREKYVKEYLNVILSGKMEKTERELAPVNLMSRIKANV 999
             KI EY++YLE+ LL++L    F  +Y + YL+++ + K  + E+   P +L++ + ANV
Sbjct: 938  IKIDEYIAYLEETLLNSLTENQFTLQYKQGYLDLLSNHKFMELEKSGGPADLLNEVVANV 997

Query: 1000 RSGNLDRV-GRTMKSHRRIRAQISSKRYNFEDEDEPIDLQLIESLDFVHYMQFFKQKISI 1058
            +SGN D +    MKSH+    +IS+KRY F+ + E +D+++I++L    +++FF++K+SI
Sbjct: 998  QSGNADELNSHFMKSHKHFFNEISNKRYQFKGDSELVDIEVIKNLTKKEFLKFFREKVSI 1057

Query: 1059 YSSLRSKISVMVSSPMSRSEIYNRKVFLQLESFLKLKGFKISGEQLQKIVRKSDGKPTVL 1118
             S +RSKISVM+ SPM+  EI NRK FLQL++FLKL+GF I+ E L+ IV +++G+P+ L
Sbjct: 1058 KSKVRSKISVMIESPMAEMEIVNRKTFLQLQAFLKLEGFTINSEILRDIVERANGRPSAL 1117

Query: 1119 MKELFRYFASRGESLKICTVMLKEITRQLSSSLKNLGARK------------SPNFERPN 1166
            +K+LF+YF  R E+L++CTV+LKE+ +  +SSLK+    K            S N+++ +
Sbjct: 1118 IKDLFKYFRERNEALRLCTVILKEVVKVSASSLKHRYTPKVSSSKMKPKRQSSSNWDQ-D 1176

Query: 1167 GSPTVPLTEIVD 1178
              P +PL EI D
Sbjct: 1177 TEPAIPLKEIKD 1188

>Suva_16.451 Chr16 (784213..787869) [3657 bp, 1218 aa] {ON} YPR122W
            (REAL)
          Length = 1218

 Score = 1005 bits (2598), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 544/1216 (44%), Positives = 758/1216 (62%), Gaps = 37/1216 (3%)

Query: 1    MSSFGVRNFDVQFYTPISCSSRSHRVIQLDNGMLVLLISNPAEKATSCALSVATGSHNDP 60
            MS   V N+++ FY P+S  +R+H++ +L NG+L L+IS+P + ++SC+LSV TGSHNDP
Sbjct: 1    MSLREVSNYEIPFYIPLSYGNRTHKICKLPNGILALIISDPTDSSSSCSLSVCTGSHNDP 60

Query: 61   KEILGLAHFCEHMILSAGSKSYPDPNAYHDVISKNGGSQNAFTTGEQTTFCFELPNLSNS 120
            ++I GLAH CEHMIL+AGSK YPDP  +H +I+KN GSQNAFTTGEQTTF FELPN  ++
Sbjct: 61   EDIPGLAHLCEHMILAAGSKKYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQSN 120

Query: 121  DELVFDKVLDIFSSSFKKPLFNELLVNKEIYAINSEHTANKSSRDKIFYHATRLLANGDH 180
             EL F+  LD+F+S FK+PLFN LL+ KEIYAI SEH  N SS  KIFYHA R+LAN DH
Sbjct: 121  GELAFESTLDVFASFFKEPLFNPLLIGKEIYAIQSEHEGNMSSTTKIFYHAARMLANADH 180

Query: 181  PFSQFSTGDITTLSDILQLNKVDLRTEVIKYFKNNFYAENMCLCIKGPQSLNTLGKLVFS 240
            PFS FSTG+I +LS +  L K++++  +  YFKNNFY ENM LC++G QS+N L KL  S
Sbjct: 181  PFSHFSTGNIHSLSSVPHLEKINVKNSLNTYFKNNFYGENMTLCMRGSQSVNILTKLAIS 240

Query: 241  KF------NDIKGLPISRPLRTKNQPWLKLKSRNFSNDG---------FGLGLESFKILS 285
            KF      NDIKG   S    +  +     +S++ S  G             LE+ KI  
Sbjct: 241  KFGDISLKNDIKGSNFSIKAGSFRRSRSLRRSQDASKTGSPTSESSNTSSYNLENSKISD 300

Query: 286  RNWLQKYGNVGIFTGCDNHNTVLVDSQKLPALRLIFPIHHRLTRLTKKEIDLLSQCWCEL 345
              W +KYG+V  F     +N++ ++S K P +R +FP+  + TR TK++I + S  W EL
Sbjct: 301  TVWEEKYGSVSCFENPSKYNSIFINSSKAPIVRFLFPVSDKNTRFTKEDIKVYSHLWREL 360

Query: 346  FGDESEGSLCHFMKKNDYITELTAFMSHFAVNDNALILELYLTNTGWKNLQMIVAVFFNK 405
            FGDES GSL H++    + T   AF+S FA+ +  L+LEL LT TGW++++ I    F+K
Sbjct: 361  FGDESPGSLSHYLVSKGWATSSFAFISEFAIGNIGLVLELELTKTGWRSVESIATTIFSK 420

Query: 406  YVPIVIECGTYELAEFLSELNCIELLKFLYQDVTLSSMEECSNLSSLLLTDIESLGPSFI 465
             +P         L  FL E N I++ +FLYQ+     MEECS+LS +L  ++E L P  I
Sbjct: 421  LLPSFCTKNIDHLIGFLREQNLIDIARFLYQNSEDLPMEECSHLSGILQENLECLTPCNI 480

Query: 466  LKGNPMNDCNEI-DSELGSFAESEESRMWWIGHAIKFQSFIKEFINFENVRLVLMGDLKE 524
             KG       EI D  +  +  ++ +  WW G AIKFQ+F+K F+N EN R++L+GD+K 
Sbjct: 481  FKG--FKSLIEINDPNIEKYENNKLNVQWWTGQAIKFQNFLKSFMNHENTRILLLGDIKS 538

Query: 525  CPLMKTDLTSLKLNIEPYYEFEYHKCRSDQSNFKLTVEEISYSFHIPYKNVFLPSVGFNL 584
              L        +++ E +YEFEY+  R   S       +  Y F+ P KN FLP    + 
Sbjct: 539  HNLFDKIEDESEIHTEFFYEFEYYMGRVHLSEDHKYHSQSPYEFNFPTKNPFLPDFVNDP 598

Query: 585  SLIKNALLASSNRSQTAALSLGSQNANPHVLPKLLGKNCFYEMWVKEEDFELTFKSKSIV 644
              ++   L  S +S+ A L    Q+    +LP+L+ KN  YEMWV +ED   T  + S+V
Sbjct: 599  LKLQQLYLECSLKSKFATLRPQIQSEPIEILPQLVSKNLNYEMWVLKEDPNFTSDNVSVV 658

Query: 645  TFEIISTHLNPEPSYTMMLEILCELLGDMLSSQLYPSEKIGYTYEIAASSKGDVRIGFTV 704
            +FE+I   + P P  T+ LE+L ++L    SS LYP+ + GYTYEIA+SSKG+V + FT+
Sbjct: 659  SFEVIGLGIKPSPEATIHLEVLAQILFITTSSNLYPALRAGYTYEIASSSKGNVTLRFTI 718

Query: 705  SGFSEGVYKIIEKIVGTLVQIVYSEVVIARDLFRKSRIAVRNKYEEAASVNSTTLVNIGL 764
            SGFSEGV+KI +  V TL  I       ++D  RK+RI VR+KYE A+S N   L +IGL
Sbjct: 719  SGFSEGVFKITKAFVDTLKLIGTDPTFPSKDALRKARILVRSKYESASSDNGVKLASIGL 778

Query: 765  LIVLEKYMWRLESRLEALESTDMESFKQFLSDFFGNSTYMNLFIQGDQTYTDQINIFLDR 824
            LIVLE+YMW L+ R++ALE TDMES K F S F+ N   + L IQG+  Y D+IN +L+ 
Sbjct: 779  LIVLEEYMWTLQDRIDALELTDMESLKNFCSLFWKNPKQLALLIQGNLDYADEINHYLNN 838

Query: 825  NLTGHL----SKKRDAVKILNEPTSTILKPGSNLFITHKGFKDDPNNSIVYFIQTGDRTD 880
            N T HL       R  +++   P +  + PG+N FI+  G +DDPNNS+ YFIQT  R +
Sbjct: 839  NFTQHLKVCDEGNRPTIRLYPSPNTKNIDPGTNAFISCNGHQDDPNNSLAYFIQTAQRDN 898

Query: 881  NYSYTLTAFTAFLISLTLVPDLRGRKQVGYIVLGGLRTLSSTVGLHITITSSSPPHFLEE 940
              + TLT  T ++ S TLVPDLR +KQ+GYIVL GLR L+ T+G+HIT+ S S  H LE 
Sbjct: 899  IENLTLTFLTEYIFSQTLVPDLRNKKQIGYIVLSGLRILTDTIGIHITVMSGSSAHSLET 958

Query: 941  KIGEYLSYLEKDLLDNLKPQLFREKYVKEYLNVILSGKMEKTERELAPVNLMSRIKANVR 1000
            KI EYLSYLE  +L+N     FR   ++ +L ++      K +    P NL++ I ANV+
Sbjct: 959  KINEYLSYLEFQVLNNFTESTFRTMLLEPFLALLKKNNFNKLKTLSGPSNLLNEIVANVQ 1018

Query: 1001 SGNLDRV--GRTMKSHRRIRAQISSKRYNFEDEDEPIDLQLIESLDFVHYMQFFKQKISI 1058
            +G+ D +   R MK HRRIR  IS KR +F++E+E +D+  ++ L    Y++FF  +ISI
Sbjct: 1019 NGD-DYILNNRQMKHHRRIRNSISEKRLHFQEENEMVDILFLQKLTLKKYLEFFGSRISI 1077

Query: 1059 YSSLRSKISVMVSSPMSRSEIYNRKVFLQLESFLKLKGFKISGEQLQKIVRKSDGKPTVL 1118
            YS  RSK+S+M++SPM+  EI +RK+FLQLE+FLK+KGF I    L+KIV  S G P +L
Sbjct: 1078 YSRQRSKLSIMITSPMAEEEIASRKMFLQLEAFLKIKGFAIKSRDLEKIVEDSKGSPVLL 1137

Query: 1119 MKELFRYFASRGESLKICTVMLKEIT-------RQLSSSLKNLGARKSPN-----FERPN 1166
            +K LF +F  R E+ K+ TV+LKEI+       +Q   S+    ++ S       + + +
Sbjct: 1138 LKNLFTFFRKRSEAFKLGTVVLKEISKIIAINFKQTYGSVLGFSSKDSEQQTIDKYWKSD 1197

Query: 1167 GSPTVPLTEIVDPDAY 1182
              P VPL E+  PD +
Sbjct: 1198 VEPIVPLRELPGPDVF 1213

>ZYRO0C06336g Chr3 (479075..482644) [3570 bp, 1189 aa] {ON} similar to
            uniprot|P40851 Saccharomyces cerevisiae YPR122W AXL1
            Haploid specific endoprotease that performs one of two
            N-terminal cleavages during maturation of a- factor
            mating pheromone required for axial budding pattern of
            haploid cells
          Length = 1189

 Score = 1001 bits (2587), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 533/1157 (46%), Positives = 766/1157 (66%), Gaps = 14/1157 (1%)

Query: 1    MSSFGVRNFDVQFYTPISCSSRSHRVIQLDNGMLVLLISNPAEKATSCALSVATGSHNDP 60
            M S  ++ +D+ F TP S   R+H++ +L NG+L LLIS+P E +++C+LSVA+GSHNDP
Sbjct: 1    MVSKQLKYYDIPFLTPFSFEGRTHKLCKLPNGLLTLLISDPTENSSACSLSVASGSHNDP 60

Query: 61   KEILGLAHFCEHMILSAGSKSYPDPNAYHDVISKNGGSQNAFTTGEQTTFCFELPNLSNS 120
             EI GLAH CEHM+L+AGS+ YPDP  YH++I KNGGSQNAFTTGEQT+F FELPN+ +S
Sbjct: 61   SEIPGLAHLCEHMVLAAGSRKYPDPGYYHEMIMKNGGSQNAFTTGEQTSFYFELPNIYHS 120

Query: 121  DELVFDKVLDIFSSSFKKPLFNELLVNKEIYAINSEHTANKSSRDKIFYHATRLLANGDH 180
             +  FD+ LD+F+S F +PLFN  L+NKE YAI SEH  N SS+ KIFY ATRLLANG+H
Sbjct: 121  LQEGFDEALDVFASFFSEPLFNSTLINKETYAIESEHDVNLSSQGKIFYQATRLLANGNH 180

Query: 181  PFSQFSTGDITTLSDILQLNKVDLRTEVIKYFKNNFYAENMCLCIKGPQSLNTLGKLVFS 240
            PFS+FSTG+I+TL+ I  L  ++L+  + +YFK NF A  M LC++GPQS+++L KL  +
Sbjct: 181  PFSRFSTGNISTLNSIPHLKNLNLKNLLHEYFKENFCASKMTLCLRGPQSIHSLAKLALT 240

Query: 241  KFNDIKGLPISRPLRTKNQPWLKLKSRNFSNDGFGLGLESFKILSRNWLQKYGNVGIFTG 300
            KF+ IK  P  +  R           R+ SN+   +  +   I    WL KY     FT 
Sbjct: 241  KFSLIKNNP--QRYRPSPPVSPSKSKRS-SNEWVEVNPKEMNISKNTWLPKYRGQLCFTS 297

Query: 301  CDNHNTVLVDSQKLPALRLIFPIHHRLTRLTKKEIDLLSQCWCELFGDESEGSLCHFMKK 360
             +    + + S K PA+R IFP   R TR T K+I +L+  W ELFGDES GS  H+++ 
Sbjct: 298  DEQEKFIFIKSSKNPAVRFIFPAMERNTRFTSKDIKILTHLWPELFGDESPGSFSHWLQS 357

Query: 361  NDYITELTAFMSHFAVNDNALILELYLTNTGWKNLQMIVAVFFNKYVPIVIECGTYELAE 420
              ++T   AF+S  A+ ++ LILEL LT TG++NL  I  V F + +P + +  T ELA+
Sbjct: 358  KGWVTYSYAFVSEVAIGNSNLILELDLTRTGFQNLSHIAKVLFEQAIPALSQKNTLELAQ 417

Query: 421  FLSELNCIELLKFLYQDVTLSSMEECSNLSSLLLTDIESLGPSFILKGNPMNDCNEIDSE 480
            F+S+ NCI+L++FLYQ+  +S MEEC NLSSL+  D+E+L P++I KG+PM   +E    
Sbjct: 418  FMSKQNCIDLIRFLYQNAEISPMEECVNLSSLMQDDLEALDPAYIFKGSPMM-IDEQHHN 476

Query: 481  LGSFAESEESRMWWIGHAIKFQSFIKEFINFENVRLVLMGDLKECPLMKTDLTSLKLNIE 540
            +G++ E++ES  WWIG AIKFQSF+K+F+   N+R+V+ G+ +E  L   +L+S +  ++
Sbjct: 477  IGNYGENKESDRWWIGQAIKFQSFLKQFMVQSNMRVVVSGNSRESQL--EELSSQEFQVD 534

Query: 541  PYYEFEYHKCRSDQSNFKLTVE-EISYSFHIPYKNVFLPSVGFNLSLIKNALLASSNRSQ 599
             +YEFEY K   D   FK  +E    Y+F IP  +  +P +  + S +K  L  SS +SQ
Sbjct: 535  LFYEFEYFK--RDGIPFKDILEWNNDYNFKIPQLDCPMPDIAKSYSQLKKILNDSSQKSQ 592

Query: 600  TAALSLGSQNANPHVLPKLLGKNCFYEMWVKEEDFELTFKSKSIVTFEIISTHLNPEPSY 659
            +A LS    N     +P L+ +NC++EMWV  +D + +   KSIV+FEI    L   P  
Sbjct: 593  SAPLSFTIHNNLLKPVPHLVSQNCYHEMWVMPDDEDPSLHLKSIVSFEIFGLDLEACPRN 652

Query: 660  TMMLEILCELLGDMLSSQLYPSEKIGYTYEIAASSKGDVRIGFTVSGFSEGVYKIIEKIV 719
            TM LEIL +++  +LS ++YPS K+G+T EI  S+KGD+R+GFT+SGFS+ +   ++ I+
Sbjct: 653  TMNLEILGQIIFILLSPEIYPSLKLGFTCEI-TSNKGDIRLGFTISGFSKQLTSFVKSII 711

Query: 720  GTLVQIVYSEVVIARDLFRKSRIAVRNKYEEAASVNSTTLVNIGLLIVLEKYMWRLESRL 779
             T+ +I      ++++  R++RI VRNKYE AA+ N   + +IGL IVLEKYMW LE RL
Sbjct: 712  ETIKRISQDPDFLSKETLRRARILVRNKYENAANENCANIGSIGLYIVLEKYMWTLEDRL 771

Query: 780  EALESTDMESFKQFLSDFFGNSTYMNLFIQGDQTYTDQINIFLDRNLTGHLSKK--RDAV 837
            EALE  DM++FKQF   F G+  Y++LF+QGD +  D++N +L R+ T HL         
Sbjct: 772  EALEDIDMDNFKQFCQSFLGSKKYLSLFVQGDLSCADELNEYLHRSFTHHLGGGIYETQG 831

Query: 838  KILNEPTSTILKPGSNLFITHKGFKDDPNNSIVYFIQTGDRTDNYSYTLTAFTAFLISLT 897
            K     T+ +L+PG+N  + H G KDDPNNSI+YFIQTG R D   +TLT FT F++SL 
Sbjct: 832  KTFTVETTKMLEPGTNACVQHGGQKDDPNNSIIYFIQTGRRNDRMIFTLTNFTVFIMSLN 891

Query: 898  LVPDLRGRKQVGYIVLGGLRTLSSTVGLHITITSSSPPHFLEEKIGEYLSYLEKDLLDNL 957
            L  +LR ++QVGY+V+GGLR LS++VGLHITI S   P  LE KI EYL YLE   L  L
Sbjct: 892  LALELRNKRQVGYLVIGGLRLLSNSVGLHITIMSGGSPLDLETKIDEYLWYLESQ-LQKL 950

Query: 958  KPQLFREKYVKEYLNVILSGKMEKTERELAPVNLMSRIKANVRSGNLDRV-GRTMKSHRR 1016
              Q F ++YV+ YL ++  G          P +L+S + ANV+ G+ + +  +TMK H++
Sbjct: 951  DEQTFHQEYVRCYLQLLDGGCRGDANESSGPADLLSELVANVQIGDSEILSSQTMKRHKK 1010

Query: 1017 IRAQISSKRYNFEDEDEPIDLQLIESLDFVHYMQFFKQKISIYSSLRSKISVMVSSPMSR 1076
            ++ QI  ++Y+F  E E +D  LI  +    Y+ FFK  ISI+S LRSKIS+M+SS ++ 
Sbjct: 1011 LQTQIIQEQYDFVTESEALDDDLISQMSLEQYLSFFKHYISIHSKLRSKISIMISSSIAE 1070

Query: 1077 SEIYNRKVFLQLESFLKLKGFKISGEQLQKIVRKSDGKPTVLMKELFRYFASRGESLKIC 1136
             +I N+K+FLQLE+FLK+KGF I  ++L+ IV +S+GKP +L  EL+  F +R ++L++C
Sbjct: 1071 KDIINKKIFLQLETFLKIKGFAIPADELKDIVERSNGKPKILAMELYSCFRTRNDALRLC 1130

Query: 1137 TVMLKEITRQLSSSLKN 1153
            +V+L E+ + L+ SL++
Sbjct: 1131 SVILAELFKMLAKSLRH 1147

>KAFR0A05370 Chr1 (1059317..1062922) [3606 bp, 1201 aa] {ON} Anc_3.455
            YPR122W
          Length = 1201

 Score =  981 bits (2535), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 530/1211 (43%), Positives = 784/1211 (64%), Gaps = 51/1211 (4%)

Query: 1    MSSFGVRNFDVQFYTPISCSSRSHRVIQLDNGMLVLLISNPAEKATSCALSVATGSHNDP 60
            MS   VR+ DVQ  TP+S S+R+H++  L NG+  LLIS+PA+ +++C+L+VATGSHNDP
Sbjct: 1    MSWTEVRHHDVQLCTPLSYSNRTHKLCTLPNGIPTLLISDPADTSSACSLTVATGSHNDP 60

Query: 61   KEILGLAHFCEHMILSAGSKSYPDPNAYHDVISKNGGSQNAFTTGEQTTFCFELPNLSNS 120
              I GLAH  EHMIL+AGSK YPDP  YH++ISKN GSQNAFTTGEQTTF FELP+    
Sbjct: 61   PNIPGLAHLAEHMILAAGSKQYPDPGLYHELISKNNGSQNAFTTGEQTTFYFELPDTHKQ 120

Query: 121  DELVFDKVLDIFSSSFKKPLFNELLVNKEIYAINSEHTANKSSRDKIFYHATRLLANGDH 180
             EL FDKVLD+F+S FK PLFN  ++NKEIYAI +EHT N S + KI YH+TRLLAN  H
Sbjct: 121  GELEFDKVLDVFASFFKNPLFNSSIINKEIYAIENEHTNNMSRQTKILYHSTRLLANKFH 180

Query: 181  PFSQFSTGDITTLSDILQLNKVDLRTEVIKYFKNNFYAENMCLCIKGPQSLNTLGKLVFS 240
            PFSQF+TG+I +L +  QL  + +++ ++ YF  +F A  M LC++GP S+N L KL  +
Sbjct: 181  PFSQFTTGNIFSLDNNSQLRSISIKSLLVNYFAEHFKANKMTLCLRGPHSVNVLTKLAIA 240

Query: 241  KFNDIK-----------GLPISRPLRTKNQPWLKLKSRNFSNDGFGLGLESFKILSRNWL 289
            KF+DIK            +   R  R   Q + K++S N              IL   W 
Sbjct: 241  KFSDIKSQNDLQRNKFGSISSKRDSRQPRQGYSKIESSN--------------ILENIWS 286

Query: 290  QKYGNVGIFTG-CDNHNTVLVDSQKLPALRLIFPIHHRLTRLTKKEIDLLSQCWCELFGD 348
            ++Y N+  F       N++ + S+K P +R +FP+  + T  T++EI L S  WC LFGD
Sbjct: 287  KRYANLPCFVNESKKVNSIFIKSKKKPLVRFLFPLSSQSTIFTQREIILFSNFWCTLFGD 346

Query: 349  ESEGSLCHFMKKNDYITELTAFMSHFAVNDNALILELYLTNTGWKNLQMIVAVFFNKYVP 408
            ESEGSL HF+ +  + T   +++S FAV    L++EL LTN+G   +  I+ V F K V 
Sbjct: 347  ESEGSLMHFLVEKGWSTSGHSYVSTFAVGSIGLVIELALTNSGVGQITDIINVLFEKIVK 406

Query: 409  IVIECGTYELAEFLSELNCIELLKFLYQDVTLSSMEECSNLSSLLLTDIESLGPSFILKG 468
            I+    T  +A+FL+E N IE ++FLY+ V    MEECS+LS LL  +++ L   ++ KG
Sbjct: 407  ILTTKHTTLMADFLNEQNIIEQVRFLYRGVEKDPMEECSDLSGLLQENMQVLDIKYLFKG 466

Query: 469  NPMNDCNEIDSELGSFAES-EESRMWWIGHAIKFQSFIKEFINFENVRLVLMG-DLKECP 526
            +P     ++ S    ++ES  + ++ W  +AIKFQ+F+  F+N+EN+RL+ +G + KE  
Sbjct: 467  SP--SITQLYSGKNQYSESMTDGKIQWTAYAIKFQNFLLTFMNYENLRLLFLGSNAKETR 524

Query: 527  LMKTDLTSLKLNIEPYYEFEYHKCRSDQSNFKLTVEEISYSFHIPYKNVFLPSVGFNLSL 586
            L+  +   ++   + +YEF++++  +D       +E  +Y F +P  N+F+P    + + 
Sbjct: 525  LITKEKKRIEFETDFFYEFDFYRTFTDFRKCSSDIETENYIFTLPSSNLFIPKSCRSYTY 584

Query: 587  IKNALLASSNRSQTAALSLGSQNANPHVLPKLLGKNCFYEMWVK--EEDFELTFKSKSIV 644
            ++ A   SS +S+ A+L    Q    H  P L+  +  YEMW      +   + +SK+IV
Sbjct: 585  LQQAFQESSLKSKLASLRPQVQIEKIHFAPTLVSDSPNYEMWTLPCAINSSPSLRSKTIV 644

Query: 645  TFEIISTHLNPEPSYTMMLEILCELLGDMLSSQLYPSEKIGYTYEIAASSKGDVRIGFTV 704
            TFE+IST++ P    T+ LEIL +LL  ++SS+LYPS K+GY+Y+IA+SSKGDVR+ FT+
Sbjct: 645  TFELISTNMIPSAESTIHLEILAQLLFYLVSSKLYPSLKLGYSYDIASSSKGDVRLKFTI 704

Query: 705  SGFSEGVYKIIEKIVGTLVQIVYSE--VVIARDLFRKSRIAVRNKYEEAASVNSTTLVNI 762
            SGFSEG+  ++E+I+ +++ I   +  + +  +L RK+R+ VR KY+EA   N   L ++
Sbjct: 705  SGFSEGLLLVLEEIIQSVLHIAKDKENIYVTNELLRKARVLVRRKYDEACCENCAKLGSV 764

Query: 763  GLLIVLEKYMWRLESRLEALESTDMESFKQFLSDF-FGNSTYMNLFIQGDQTYTDQINIF 821
            GLLI+LE ++W LE R++ALE TDM SFK F+++F F +  Y  LFIQG+     +I+ +
Sbjct: 765  GLLILLESFLWTLEDRIDALEDTDMTSFKNFVNEFLFESFNYFTLFIQGNLDRAHEIHHY 824

Query: 822  LDRNLTGHLSKKRDAVKILNEPTSTILKPGSNLFITHKGFKDDPNNSIVYFIQTGDRTDN 881
            L+ NLT HL    + V ILN+P + IL+ GSN F+ + G ++DPNN+IVYFIQ+G R+D+
Sbjct: 825  LNDNLTHHLDILPEKV-ILNKPRTKILQEGSNFFVAYDGHEEDPNNAIVYFIQSGLRSDS 883

Query: 882  YSYTLTAFTAFLISLTLVPDLRGRKQVGYIVLGGLRTLSSTVGLHITITSSSPPHFLEEK 941
             +YTLTAFT +L+S+TL+PDLR +KQ+GYIV+GG+R L  ++GLHIT+ S +PP  LE+K
Sbjct: 884  IAYTLTAFTEYLMSMTLLPDLRHKKQIGYIVVGGMRVLVDSIGLHITVVSGTPPQDLEDK 943

Query: 942  IGEYLSYLEKDLLDNLKPQLFREKYVKEYLNVILSGKMEKTERELAPV-NLMSRIKANVR 1000
            I EY+++LE+ +L  L  + FR +YV+ YL+ +L+GK   T    A   NL++ I +NV 
Sbjct: 944  IDEYMNFLERIILGRLTEEEFRNQYVQNYLD-MLNGKNNGTLNGTAGAHNLLNDIVSNVA 1002

Query: 1001 SGNLDRVGRT-MKSHRRIRAQISSKRYNFEDEDEPIDLQLIESLDFVHYMQFFKQKISIY 1059
            +G  + +  + M+ H+R+  QIS   ++F D+ E I+ ++IE+L    YMQFFK+KISI+
Sbjct: 1003 NGEYEILNSSEMREHKRLWNQISDDDHSFLDDIELINREVIETLTLKGYMQFFKKKISIH 1062

Query: 1060 SSLRSKISVMVSSPMSRSEIYNRKVFLQLESFLKLKGFKISGEQLQKIVRKSDGKPTVLM 1119
            S+ RSK+SVMV+SPM  +EI NRK+FLQLE+FLK+KGF I   QL++IV K+DGKP+V++
Sbjct: 1063 SNKRSKLSVMVTSPMPENEIINRKLFLQLEAFLKIKGFAIKSNQLKEIVDKADGKPSVVL 1122

Query: 1120 KELFRYFASRGESLKICTVMLKEITRQLSSSLKNLGARKSPNFERPNGS----------- 1168
            K L   F  R E+ K+   +LKE+ +    +LK+   +  P+  + + S           
Sbjct: 1123 KLLLSEFRERNEAWKLLRAVLKEVLKTTGQTLKHRYGKVLPSPTKSDNSASLEKSSNYSV 1182

Query: 1169 -PTVPLTEIVD 1178
             P +PL  I D
Sbjct: 1183 KPVIPLKRIED 1193

>TBLA0C05450 Chr3 complement(1312984..1316592) [3609 bp, 1202 aa] {ON}
            Anc_3.455 YPR122W
          Length = 1202

 Score =  937 bits (2423), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 505/1167 (43%), Positives = 751/1167 (64%), Gaps = 23/1167 (1%)

Query: 1    MSSFGVRNFDVQFYTPISCSSRSHRVIQLDNGMLVLLISNPAEKATSCALSVATGSHNDP 60
            MS    + FD+ FY P S S+R+ ++ +L NG+L LLIS+ +   T+C++SVATGSH+DP
Sbjct: 1    MSWINTKTFDIDFYLPSSYSNRNQKLCRLPNGILALLISDNSVTTTACSISVATGSHSDP 60

Query: 61   KEILGLAHFCEHMILSAGSKSYPDPNAYHDVISKNGGSQNAFTTGEQTTFCFELPNLSNS 120
            ++I G+AH CEHMIL+AGSK YP P  +H+V++ N GSQNAFTTGEQTTF FELP  +  
Sbjct: 61   RDIPGIAHLCEHMILAAGSKKYPKPGLFHEVLAANNGSQNAFTTGEQTTFYFELPTSTAI 120

Query: 121  DELVFDKVLDIFSSSFKKPLFNELLVNKEIYAINSEHTANKSSRDKIFYHATRLLANGDH 180
            ++  F ++LDIFSS FKKPLFNE+L NKEIYAI SEH  N S+  KI YHA RLL+N  H
Sbjct: 121  EQNTFGEILDIFSSFFKKPLFNEVLTNKEIYAIESEHDGNMSNTSKILYHAERLLSNKSH 180

Query: 181  PFSQFSTGDITTLSDILQLNKVDLRTEVIKYFKNNFYAENMCLCIKGPQSLNTLGKLVFS 240
            PF  FSTG+I TLS ++ L K +L+  + +YFKNN+++ NM +CIKGPQSLN+L KL  +
Sbjct: 181  PFHNFSTGNIHTLSKVVNLKKYNLKEMLFEYFKNNYFSRNMTICIKGPQSLNSLTKLALA 240

Query: 241  KFNDIK-----------GLPISRPLRTKNQPWLKLKSRNFSNDGFGLGLESFKILSRNWL 289
             F DIK            +   + LR            +F  +   L LE+FK+L   WL
Sbjct: 241  NFGDIKDKDELTKFHINSIKPQKSLRISKSRSSISSCNSFKTNE-NLDLENFKLLDNAWL 299

Query: 290  QKYGNVGIFTGCDNHNTVLVDSQKLPALRLIFPIHHRLTRLTKKEIDLLSQCWCELFGDE 349
             KYG+   F    +HNT+ + S K P LRL+FPI  +LTR TK++I + S  WC +FGDE
Sbjct: 300  DKYGDNVCFPTSLSHNTIFLSSSKQPILRLLFPISEKLTRFTKRDIKIYSNIWCHIFGDE 359

Query: 350  SEGSLCHFMKKNDYITELTAFMSHFAVNDNALILELYLTNTGWKNLQMIVAVFFNKYVPI 409
            ++GS C ++ KN++ITE  AF S FA+ + +LILEL LTNTG K LQ I+ +   + V +
Sbjct: 360  TKGSFCDYLNKNNWITECYAFKSTFAIGNTSLILELKLTNTGVKKLQNIIDILLQQVVKL 419

Query: 410  VIECGTYELAEFLSELNCIELLKFLYQDVTLSSMEECSNLSSLLLTDIESLGPSFILKGN 469
            +++  T  LA FL+E N I +L+F+  DV ++ M+ECS LS LL  + +   P ++  G+
Sbjct: 420  LVDNFTENLAYFLAENNIISILRFINSDVEINPMDECSELSGLLQENFKLFNPKYLFYGS 479

Query: 470  PMNDC-NEIDSELGSFAESEESRMWWIGHAIKFQSFIKEFINFENVRLVLMGDLKECPLM 528
                  NE   +  +  +   S  +WIG AIKFQ+F+KEF+N+EN+++V +GD+ E   +
Sbjct: 480  EFLLLENESLPQKNNMFDG-NSTTFWIGQAIKFQTFLKEFMNWENIKIVGIGDIDEFKNV 538

Query: 529  KTDLTSLKLNIEPYYEFEYHKCRSDQSNFKLTVEEISYSFHIPYKNVFLPSVGFNLSLIK 588
               +  +    + YYEFEY K +  +   K  +    Y F  P KN +LP  G+NL L++
Sbjct: 539  LNIVKEMSKKTDLYYEFEYQKLKISK---KSRICPRDYPFTYPIKNEYLPKFGYNLGLLR 595

Query: 589  NALLASSNRSQTAALSLGSQNANPHVLPKLLGKNCFYEMWVKEEDFELTF-KSKSIVTFE 647
            N LL +   S+T +  +  Q +      KL+ +N  +++WV  ++ +    +S  IV+F+
Sbjct: 596  NILLNNLESSRTVSFYM-PQVSEEEDQNKLVSQNDMHKLWVNPKNSKDQLSESPCIVSFK 654

Query: 648  IISTHLNPEPSYTMMLEILCELLGDMLSSQLYPSEKIGYTYEIAASSKGDVRIGFTVSGF 707
            +++  +   P  TM LE++ +LL  +L ++LYP+  +GYT+EI+ S +GDV + FT+SGF
Sbjct: 655  LVNNSIQESPESTMHLELMGQLLHTLLINKLYPALNVGYTFEISPSVRGDVSLSFTLSGF 714

Query: 708  SEGVYKIIEKIVGTLVQIVYSEVVIARDLFRKSRIAVRNKYEEAASVNSTTLVNIGLLIV 767
            SEG++KII++ +    ++  S+++  ++ FR++RI VR+KYE+AAS +   L ++GLLI+
Sbjct: 715  SEGIFKIIKECINIFGELTSSDLITKKE-FRRARILVRDKYEDAASDSCVKLASVGLLIL 773

Query: 768  LEKYMWRLESRLEALESTDMESFKQFLSDFFGNSTYMNLFIQGDQTYTDQINIFLDRNLT 827
            LE+ MW LE R++ALE  D+E F +F   FF N  +++L+I+G+  Y D IN +    L 
Sbjct: 774  LERKMWTLEERIDALELIDLEMFLEFAQKFFQN-LFLSLYIEGNLEYADLINSYFSDKLV 832

Query: 828  GHLSKKRDAVK--ILNEPTSTILKPGSNLFITHKGFKDDPNNSIVYFIQTGDRTDNYSYT 885
             HL+K+ D  K   L    ST L  G+N++   +G  DDPNNSIVYFIQTGD ++    +
Sbjct: 833  HHLTKRLDYPKEDTLQSLPSTKLISGTNIYYELEGSVDDPNNSIVYFIQTGDLSNKKILS 892

Query: 886  LTAFTAFLISLTLVPDLRGRKQVGYIVLGGLRTLSSTVGLHITITSSSPPHFLEEKIGEY 945
            LT+ TAF+IS +LVP+LR +KQ+GY+V GGLRTLS TVGLHITI S   P  +E +I +Y
Sbjct: 893  LTSLTAFIISFSLVPELRNKKQIGYVVFGGLRTLSDTVGLHITIMSDGKPLDIEIEIEKY 952

Query: 946  LSYLEKDLLDNLKPQLFREKYVKEYLNVILSGKMEKTERELAPVNLMSRIKANVRSGNLD 1005
            +SYLE DLL NL  + F+  Y+ +Y+++I     + TE+   P+N+M+ I ANV  G+  
Sbjct: 953  ISYLEFDLLGNLDDETFQNNYLIKYIDLINGIYKKSTEQTSGPINIMNEIIANVHGGDSA 1012

Query: 1006 RVGRTMKSHRRIRAQISSKRYNFEDEDEPIDLQLIESLDFVHYMQFFKQKISIYSSLRSK 1065
             +      + +             +E + +D++ +++L+ + Y+QFFK  IS  S  RSK
Sbjct: 1013 ILNSEKIKNHKKNKNELFGDAQMTEELKYVDIEFLKNLNLIKYLQFFKGSISTNSKRRSK 1072

Query: 1066 ISVMVSSPMSRSEIYNRKVFLQLESFLKLKGFKISGEQLQKIVRKSDGKPTVLMKELFRY 1125
            +S+ + SPM   E++NRK+FLQL++FLK+KGF I   +LQ+IV +++G+PT+L KELF  
Sbjct: 1073 LSIHIKSPMEERELFNRKLFLQLQTFLKIKGFPIKSNELQQIVERTNGRPTLLFKELFAC 1132

Query: 1126 FASRGESLKICTVMLKEITRQLSSSLK 1152
            F +R ES K  +++LKEI + +S S+K
Sbjct: 1133 FKARDESWKFISIVLKEILKVISMSIK 1159

>KNAG0A07740 Chr1 complement(1226949..1230542) [3594 bp, 1197 aa] {ON}
            Anc_3.455 YPR122W
          Length = 1197

 Score =  889 bits (2298), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 500/1201 (41%), Positives = 727/1201 (60%), Gaps = 59/1201 (4%)

Query: 1    MSSFGVRNFDVQFYTPISCSSRSHRVIQLDNGMLVLLISNPAEKATSCALSVATGSHNDP 60
            M+   V+N+D+QF  P++ S R+H++ +L NG+L LLIS+P + A+ C+++VATGSHNDP
Sbjct: 1    MTWAAVQNYDIQFRIPLAFSHRTHKLCKLPNGVLALLISDPEDNASVCSVTVATGSHNDP 60

Query: 61   KEILGLAHFCEHMILSAGSKSYPDPNAYHDVISKNGGSQNAFTTGEQTTFCFELPNLSNS 120
            K + GLAH CEHM+ +AGSK YPD + YH  +SK GG+ NA+TTGEQTTF   +PN++  
Sbjct: 61   KGVPGLAHLCEHMLFAAGSKKYPDVDKYHQTLSKTGGTHNAYTTGEQTTFHISVPNMNRE 120

Query: 121  DELVFDKVLDIFSSSFKKPLFNELLVNKEIYAINSEHTANKSSRDKIFYHATRLLANGDH 180
             EL FD +LD+FSS  K+PLFN   +NKEIYAI SEH +N SS  KI Y A RL+ANG+H
Sbjct: 121  GELEFDCILDMFSSFLKEPLFNSTAMNKEIYAIQSEHDSNVSSLSKILYQAIRLMANGNH 180

Query: 181  PFSQFSTGDITTLSDILQLNKVDLRTEVIKYFKNNFYAENMCLCIKGPQSLNTLGKLVFS 240
            PFSQFSTG+I TL ++  +  ++LRT ++ YF+ NF   N+ +CIKG QS+N L KL  +
Sbjct: 181  PFSQFSTGNIHTLKNMPLVTGMNLRTLLVNYFETNFQPRNITVCIKGSQSVNILTKLALT 240

Query: 241  KFNDI------KGLPISRPLRTKNQPWLKLKSRNFSNDGFGL-GLESFKILSRNWLQKYG 293
             F  I      KG  I R +  ++         +  ++G  L  +ESF+IL + W  KY 
Sbjct: 241  NFGYIQSSRAAKGNVIRRSISKRD---------SIRSNGKKLKKIESFRILEKAWKAKYK 291

Query: 294  NVGIFTGCDNHNTVLVDSQKLPALRLIFPIHHRLTRLTKKEIDLLSQCWCELFGDESEGS 353
            ++  F   D +N +++ S K   +R +FP++      T KE+ + S  W ELFGDES+GS
Sbjct: 292  DIKCFD--DRNNFMIIKSNKQSTMRFLFPVNESGANFTPKELKIFSGIWRELFGDESKGS 349

Query: 354  LCHFMKKNDYITELTAFMSHFAVNDNALILELYLTNTGWKNLQMIVAVFFNKYVPIVIEC 413
            L  +  +  +ITE T ++S F      LIL+  LT +GW+NL+ I++  F   + +V   
Sbjct: 350  LHSYFIEKSWITETTTYISDFTYGVYGLILQFSLTASGWENLREIISKVFKGTLELVRWE 409

Query: 414  GTYELAEFLSELNCIELLKFLYQDVTLSSMEECSNLSSLLLTDIESLGPSFILKGNP-MN 472
                L+  L E   IE + +LYQ+  + S + CS L+ LL   + +    ++ K +P + 
Sbjct: 410  NLNSLSRILFEHTTIEYINYLYQEQEVLSSDFCSELTELLQHSLRTPELEYLFKESPNLI 469

Query: 473  DCNEIDSE-LGSFAESEESRMWWIGHAIKFQSFIKEFINFENVRLVLMG-DLKECPLMKT 530
            + N   SE L +         WW   A+KFQ+FI EF+   NV+L L+G +LK     + 
Sbjct: 470  ELNNDHSENLMTVTP------WWFDQAMKFQNFINEFMKVTNVKLFLLGSELKHNAFFEL 523

Query: 531  DLTSLKLNIEPYYEFEYHKCRSDQSNFKLTVEEI-----SYSFHIPYKNVFLPSVGFNLS 585
               +   + + YY F+Y K      NFK  ++E       YS  +P KN+F+P    NL+
Sbjct: 524  GSQNKDWSTDAYYGFDYIK---SHLNFKQIIDEPCTTVNDYSLALPSKNLFIPQFFQNLA 580

Query: 586  LIKNALLASSNRSQTAALSLGSQNAN-PHVLPKLLGKNCFYEMWVKEEDFEL-------T 637
             ++   +  S RS+ A L      +  P+  P+L+ ++  YEMW+   D E         
Sbjct: 581  NLQQIFMEYSLRSRFAVLQPQVPTSMLPNQKPRLVNRSSHYEMWILPIDKEPESVASPDR 640

Query: 638  FKSKSIVTFEIISTHLNPEPSYTMMLEILCELLGDMLSSQLYPSEKIGYTYEIAASSKGD 697
               +S VTF I S  + P    TM LEIL E+L  +L+S LYPS ++ Y YEIA S KGD
Sbjct: 641  IPKQSTVTFSIESLTMTPSSMNTMHLEILGEVLNFLLTSDLYPSLQLSYAYEIATSLKGD 700

Query: 698  VRIGFTVSGFSEGVYKIIEKIVGTLVQI--VYSEVVIARDLFRKSRIAVRNKYEEAASVN 755
            V++  T+ GFS+GV KI + I+ TL  I    +  ++   L RK+RI VR+KYE A+S  
Sbjct: 701  VQLCCTICGFSDGVVKITDYILSTLRLIGDPATANIVTNSLLRKARIQVRSKYEAASSEI 760

Query: 756  STTLVNIGLLIVLEKYMWRLESRLEALESTDMESFKQFLSDFFGNST--YMNLFIQGDQT 813
               L ++GLLIVLE+ MW LE RLEALE +DM SF+QF  +F  N +  Y+NLF+QGD  
Sbjct: 761  CVKLASMGLLIVLERGMWTLEDRLEALEDSDMSSFQQFCHEFVMNDSGNYLNLFVQGDMR 820

Query: 814  YTDQINIFLDRNLTGHLSKKRDAVKILN-EPTSTILKPGSNLFITHKGFKDDPNNSIVYF 872
            Y D++N  +   LT HL+  R +    +   ++T+LKPG N ++ + G  DDPNNSIV+F
Sbjct: 821  YADEVNCLIHSKLTHHLNSSRCSTPTTDYRRSTTVLKPGVNYYVEYPGQGDDPNNSIVHF 880

Query: 873  IQTGDRTDNYSYTLTAFTAFLISLTLVPDLRGRKQVGYIVLGGLRTLSSTVGLHITITSS 932
            +Q G R D  ++TL  FTA+L+ LTLVPDLR +KQ+GY+VLGGLR ++ TVGLHIT+ S+
Sbjct: 881  VQVGLRNDRAAFTLAHFTAYLMHLTLVPDLRYKKQIGYVVLGGLRIMTDTVGLHITVMSA 940

Query: 933  SPPHFLEEKIGEYLSYLEKDLLDNLKPQLFREKYVKEYLNVILSGKMEKTERELAPVNLM 992
                 LE+KI EY+ YLE  +L+ L    F E Y+K Y+ +I    + + +    P NL+
Sbjct: 941  GQCLDLEDKIDEYMMYLEDTVLNALTESQFEEIYLKPYIRLIGEHTVGEMDTSGGPTNLL 1000

Query: 993  SRIKANVRSGNLDRV-GRTMKSHRRIRAQISSKRYNFEDEDEPIDLQLIESLDFVHYMQF 1051
            S I  NV++G+   + G  MK H+++   I +K Y+F   ++ +D  +++ L    YM F
Sbjct: 1001 SEIYPNVQNGHSSVLEGIDMKRHKQLWNLIQAKEYDFLQGNDILDRTVVQGLTLHRYMTF 1060

Query: 1052 FKQKISIYSSLRSKISVMVSSPMSRSEIYNRKVFLQLESFLKLKGFKISGEQLQKIVRKS 1111
            FK+K+S  S+ RSKIS+M+ SPM R EI NR++FLQ+E+FLK+KGF I   +L+ IV KS
Sbjct: 1061 FKEKLSARSTTRSKISIMIDSPMKREEIMNRQMFLQMETFLKMKGFAIKDTELRDIVNKS 1120

Query: 1112 DGKPTVLMKELFRYFASRGESLKICTVMLKEITRQLSSSLKNLGARKSPNFERPNGSPTV 1171
             G PT L++ L  +F +RGE+ K+C V+ KE+ + L+     LG R+S         PTV
Sbjct: 1121 QGSPTQLLRHLLAHFKTRGENWKLCRVIAKEVGKLLA-----LGVRRSLTLR-----PTV 1170

Query: 1172 P 1172
            P
Sbjct: 1171 P 1171

>KLLA0D15631g Chr4 (1319185..1322697) [3513 bp, 1170 aa] {ON} similar
            to uniprot|P40851 Saccharomyces cerevisiae YPR122W AXL1
            Haploid specific endoprotease that performs one of two
            N-terminal cleavages during maturation of a- factor
            mating pheromone required for axial budding pattern of
            haploid cells
          Length = 1170

 Score =  875 bits (2262), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 471/1161 (40%), Positives = 729/1161 (62%), Gaps = 46/1161 (3%)

Query: 1    MSSFGVRNFDVQFYTPISCSSRSHRVIQLDNGMLVLLISNPAEKATSCALSVATGSHNDP 60
            M++  V+  DV  YTPIS S+R+H+ +QL NG+  LLIS+P E   S   SVATGSHNDP
Sbjct: 1    MTAATVQTIDVPIYTPISNSNRAHQFVQLSNGITALLISDPGESFASLCASVATGSHNDP 60

Query: 61   KEILGLAHFCEHMILSAGSKSYPDPNAYHDVISKNGGSQNAFTTGEQTTFCFELPNLSN- 119
             E+ GLAH CEHMI+S+ SK +P  + YHD++ +  G+QNAFTTGEQT+F FE+PN +N 
Sbjct: 61   DEVPGLAHLCEHMIISSESKKFPKRSHYHDLLIEYNGNQNAFTTGEQTSFYFEIPNSNNK 120

Query: 120  SDELVFDKVLDIFSSSFKKPLFNELLVNKEIYAINSEHTANKSSRDKIFYHATRLLANGD 179
            + + +FD+++ + +     P+F    +NKEI AI++EH  NK+   K  YH T+ LA   
Sbjct: 121  TGKPIFDELVGVIADKLGSPIFQSADINKEIQAIDNEHENNKNLVSKALYHGTKKLATQR 180

Query: 180  HPFSQFSTGDITTLSD--ILQLNKVDLRTEVIKYFKNNFYAENMCLCIKGPQSLNTLGKL 237
              FS+FSTG+I TL+   I+    ++L+  + K++ +NF AEN+ + I+G QSL+ L KL
Sbjct: 181  SKFSRFSTGNIYTLTQFPIVAGKIINLKNVLQKHYADNFVAENISIVIRGSQSLHYLKKL 240

Query: 238  VFSKFNDIKGLPISRPLRTKNQPWLKLKSRNFSNDGFGLGLESFKILSRNWLQKYGNVGI 297
            V + F D          RTK+     +KS++FS       +ESFK L + W  +Y    +
Sbjct: 241  VQTTFGD---------FRTKS----TIKSQSFS-------IESFKKLQKVWAARYTE-PL 279

Query: 298  FTG--CDNHNTVLVDSQKLPALRLIFPIHHRLTRLTKKEIDLLSQCWCELFGDESEGSLC 355
            F+    +  N++L+ S K P LRL+FP+ H+    ++ E+ + S+ W +LFGDES GS+ 
Sbjct: 280  FSKQEPETPNSILIQSSKAPILRLVFPVSHQEALFSRSELKIFSKVWSDLFGDESSGSIH 339

Query: 356  HFMKKNDYITELTAFMSHFAVNDNALILELYLTNTGWKN-LQMIVAVFFNKYVPIVIECG 414
                  + +T     +S F ++D  L+L+  LTN+GWK  ++ ++   F  ++P      
Sbjct: 340  SKFSARNILTRQVTQLSKFTIDDEGLVLQFELTNSGWKTGVESLLTDLFQGFLPFFQSID 399

Query: 415  TYELAEFLSELNCIELLKFLYQDVTLSSMEECSNLSSLLLTDIESLGPSFILKGNPMNDC 474
              E+A++L+E N I LL+F+YQD+  S+M++CS+L S LL   +   P FIL  +    C
Sbjct: 400  PDEIAQYLNEWNTINLLQFMYQDLDNSTMDKCSDLCSELL---QCEDPQFILNNSIAFSC 456

Query: 475  NEIDSELGSFAESEESRMWWIGHAIKFQSFIKEFINFENVRLVLMGDLKECPLMKTDLTS 534
            N   S++GS+ ES +S+ WW   A KF SF+K ++++ N +L+ +GDL+    +K+    
Sbjct: 457  NRKGSDIGSYYESPKSKEWWNSQAKKFLSFVKTYMSWNNCKLIFLGDLQSNDFLKSRQVP 516

Query: 535  LKLNIEPYYEFEYHKCRSDQSNFKLTVEEISYSFHIPYKNVFLPSVGFNLSLIKNALLAS 594
              +  + +Y F+Y       ++ K++ ++    F +P    FL  +  NLS +K +L A 
Sbjct: 517  TNVKFDEHYRFQYELSLIKLNHVKMSPKD----FRLPSSTAFLFGLEKNLSALKQSLTAV 572

Query: 595  SNRSQTAALSLGSQNANPHVLPKLLGKNCFYEMWVKEEDFELTFKSKSIVTFEIISTHLN 654
              +SQ +ALS+ +Q+      P+L+ KN  YE+WVKEE+  L + S+S++T E+I+  + 
Sbjct: 573  LRKSQGSALSIITQSKLLQTTPRLMSKNENYELWVKEEN-SLEYSSRSVITIELINMGME 631

Query: 655  PEPSYTMMLEILCELLGDMLSSQLYPSEKIGYTYEIAASSKGDVRIGFTVSGFSEGVYKI 714
            P    TM LEIL +LL   ++  LYPSE++GY Y+IAA+++GDVR+  T++GF +GV  I
Sbjct: 632  PSAKNTMNLEILTQLLYFYINESLYPSERVGYMYQIAANNRGDVRLAVTINGFPQGVAMI 691

Query: 715  IEKIVGTLVQIVYSEVVIARDLFRKSRIAVRNKYEEAASVNSTTLVNIGLLIVLEKYMWR 774
            ++ I+  +V I   +  I   +FR SRI VR KYEEAA  NS TL ++G+LI+LEK +  
Sbjct: 692  LQIIMDKMVDIGKPDFDITNSMFRHSRILVRTKYEEAARANSCTLASLGVLILLEKELTT 751

Query: 775  LESRLEALESTDMESFKQFLSDFF-GNSTYMNLFIQGDQTYTDQINIFLDRNLTGHLSK- 832
            LE RL+ALE  D+ESFK F  D +   S YMNL IQGD +  + +N ++D  +  HLS  
Sbjct: 752  LEERLDALEDIDIESFKMFCKDLWIPKSNYMNLVIQGDLSIAETVNQYMD-GIIHHLSGP 810

Query: 833  --KRDAVKILNEPTSTILKPGSNLFITHKGFKDDPNNSIVYFIQTGDRTDNYSYTLTAFT 890
               + +V  L EP +  L  GSN FI    FK+DP NS+VYFI+TGDRT+   YT+++  
Sbjct: 811  NVNQTSVFRLREPETIKLAQGSNFFIEMTSFKEDPTNSVVYFIETGDRTNPVDYTMSSLF 870

Query: 891  AFLISLTLVPDLRGRKQVGYIVLGGLRTLSSTVGLHITITSSSPPHFLEEKIGEYLSYLE 950
             + +S+TLVPDLR +KQ+GY+VLGGLR L+ T+G+HI++ S+ PPH +E++I EYL YLE
Sbjct: 871  EYFMSMTLVPDLRNKKQIGYVVLGGLRLLTDTLGIHISVMSNLPPHTIEDRIEEYLYYLE 930

Query: 951  KDLLDNLKPQLFREKYVKEYLNVILSGKMEKTERELAPVNLMSRIKANVRSG----NLDR 1006
             ++L  +    F++  +++Y+ +I S  +EK  +   P NLM++I+A+V SG    NL  
Sbjct: 931  TNVLGAMTEAEFQDNILQKYMQLIKSNSLEKLIKNAGPANLMAQIEASVHSGNYPSNLQS 990

Query: 1007 VGRTMKSHRRIRAQISSKRYNFEDEDEPIDLQLIESLDFVHYMQFFKQKISIYSSLRSKI 1066
             G T+  H++++ +IS + Y F +    +D+ L+  L    + + F +KISI S  R K+
Sbjct: 991  QGYTVGQHKKLKDEISFRTYAFSETK--VDVCLLSKLTLQEFKRLFMEKISILSLQRRKL 1048

Query: 1067 SVMVSSPMSRSEIYNRKVFLQLESFLKLKGFKISGEQLQKIVRKSDGKPTVLMKELFRYF 1126
            SV   +PM++ +I    + +QL+ FLK KGF I+ ++LQ+IV K+ GKPT L KELF +F
Sbjct: 1049 SVRFKTPMTKPDIGISMMTMQLDGFLKSKGFHITRDELQEIVTKTAGKPTSLFKELFHHF 1108

Query: 1127 ASRGESLKICTVMLKEITRQL 1147
             ++G+SL++CT++LKEI +Q+
Sbjct: 1109 RTQGQSLRLCTLVLKEIVKQI 1129

>TPHA0D04060 Chr4 (867294..870899) [3606 bp, 1201 aa] {ON} Anc_3.455
            YPR122W
          Length = 1201

 Score =  842 bits (2174), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 474/1164 (40%), Positives = 700/1164 (60%), Gaps = 46/1164 (3%)

Query: 1    MSSFGVRNFDVQFYTPISCSSRSHRVIQLDNGMLVLLISNPAEKATSCALSVATGSHNDP 60
            MS   V+N+D+  Y P S     +++ +L NG+L ++IS+P+ +  SC+LSVATGSHNDP
Sbjct: 1    MSWTQVKNYDIPIYIPASSRGMDYKLCRLPNGILTMVISDPSREMASCSLSVATGSHNDP 60

Query: 61   KEILGLAHFCEHMILSAGSKSYPDPNAYHDVISKNGGSQNAFTTGEQTTFCFELPNLSNS 120
              I GLAH CEHMILSAGSK YPDPN+YH +IS++ GS NA+TTGEQTTF FE+P L  S
Sbjct: 61   SVIPGLAHLCEHMILSAGSKKYPDPNSYHKLISESNGSHNAYTTGEQTTFYFEIPCLFTS 120

Query: 121  DELVFDKVLDIFSSSFKKPLFNELLVNKEIYAINSEHTANKSSRDKIFYHATRLLANGDH 180
             E  F+++LDIFSSSFK PLF E  VNKEIYAI SEH  N  +  KI YHATRLLAN  H
Sbjct: 121  SESNFERLLDIFSSSFKDPLFKETSVNKEIYAIESEHDGNTCNLTKILYHATRLLANSKH 180

Query: 181  PFSQFSTGDITTLSDILQLNKVDLRTEVIKYFKNNFYAENMCLCIKGPQSLNTLGKLVFS 240
            PFS+FSTG+ITTL    +L K   +  +  YFK N+ A NM LCIKGPQS+N L K   +
Sbjct: 181  PFSRFSTGNITTLGKGAKLLKTTSKKLLESYFKTNYNASNMTLCIKGPQSVNVLTKYALT 240

Query: 241  KFNDIKGLPISRPLRTKNQPWLKLKSRNFSNDGFGLG-----------------LESFKI 283
             FN I        +R  N     LKS  + +  F                    LE F I
Sbjct: 241  YFNGIDD-----SIRNDNTFIKSLKSPVYMHQRFSFSSLSQESAMSKGNEEDCRLEDFHI 295

Query: 284  LSRNWLQKYGNVGIFTGCDNHNTVLVDSQKLPALRLIFPIHHRLTRLTKKEIDLLSQCWC 343
            LS  +  KY ++  F    NHN + + S K P LRL+FPI        K ++      WC
Sbjct: 296  LSNAYNPKYKDIKCFKRNPNHNAIFIKSTKQPILRLLFPIDMDDDYFNKDDLLRFIMVWC 355

Query: 344  ELFGDESEGSLCHFMKKNDYITELTAFMSHFAVNDNALILELYLTNTGWKNLQMIVAVFF 403
            ELFGDE++ SLC+F+KK++ IT+  AF S+FA+N   L++EL LT TG KN ++I+    
Sbjct: 356  ELFGDENDNSLCYFLKKDNLITDCFAFHSNFALNSVGLVVELSLTGTGVKNQELIINSIC 415

Query: 404  NKYVPIVIECGTYELAEFLSELNCIELLKFLYQDVTLSSMEECSNLSSLLLTDIESLGPS 463
            N  +  + E    ELA FLSE N I++++F+ +    +SM+E S +SS L  ++    PS
Sbjct: 416  NSAIEKLSEANDTELARFLSECNTIDIIRFINKGKEDTSMDEISEISSRLQENLALNRPS 475

Query: 464  FILKGNP-MNDCNEIDSELGSFAESEESRMWWIGHAIKFQSFIKEFINFENVRLVLMGDL 522
            F+LK  P +ND +E  + + +F E+E S+ WW+  A  FQ F+K ++N +N+R++ +GD+
Sbjct: 476  FLLKEFPFINDYSE--TGISNFEENEWSKNWWLSKAYNFQQFLKRYVNRKNLRILFLGDI 533

Query: 523  KECPLMKTDLTSLKL-NIEPYYEFEY----HKCRSDQSNFKLTVEEISYSFHIPYKNVFL 577
             E P   T    LK+ + +P+Y+FEY    +K +++Q   +   ++I  +  IP +N F+
Sbjct: 534  -ETPKFTTLTEDLKVYSTDPFYDFEYITFKYKFKANQLRQE---DDIFRNIGIPKRNTFM 589

Query: 578  PSVGFNLSLIKNALLASSNRSQTAALSLGSQNANPHVLPKLLGKNCFYEMWVKEEDFELT 637
            P +G +L+++   L A   R+++    +   N+     P L+ KN   E WV     + +
Sbjct: 590  PEIGKSLAILSANLEAILKRNESIGYPIIYNNS-IESKPGLVLKNSNQETWVLNSPLQHS 648

Query: 638  FKSKSIVTFEIISTHLNPEPSYTMMLEILCELLGDMLSSQLYPSEKIGYTYEIAASSKGD 697
                SI +FEI +  + P P+ TM LE+L +LLG +++ +LYP+ ++GYTYEI AS  GD
Sbjct: 649  STESSIFSFEITNWSIKPSPASTMHLEVLGQLLGILMTRELYPALRLGYTYEIGASVNGD 708

Query: 698  VRIGFTVSGFSEGVYKIIEKIVGTLVQIVYSEVVIARDLFRKSRIAVRNKYEEAASVNST 757
            V++  T+SGF  G+  +++ I+     I      +      ++R+  R KYE+AAS NS 
Sbjct: 709  VKLMITISGFQSGIMSLLQNIIKICNSISIKNPTVTHSALHRARVMTRRKYEDAASGNSV 768

Query: 758  TLVNIGLLIVLEKYMWRLESRLEALESTDMESFKQFLSDFFGNSTYMNLFIQGDQTYTDQ 817
             L ++GLLI+LEK+MW LE R +ALE +D+ SF  F S FF ++ Y+  FI G    T++
Sbjct: 769  KLASVGLLIMLEKHMWTLEDRFDALEESDINSFYNFCSQFFKSAKYIKSFISG----TNE 824

Query: 818  INIFLDRNLTGHL----SKKRDAVKILNEPTSTILKPGSNLFITHKGFKDDPNNSIVYFI 873
            + + L   +  H     +   +  +  N  ++  LKPG N++  H G + D NN I YFI
Sbjct: 825  LAMKLSHLIYDHWILSDTISLNYFEKNNILSTCFLKPGENVYFQHPGDEGDINNCINYFI 884

Query: 874  QTGDRTDNYSYTLTAFTAFLISLTLVPDLRGRKQVGYIVLGGLRTLSSTVGLHITITSSS 933
            QTG+R + Y  TLT+ T +++   LV +LR RKQVGY+V GG+R+L++T+GLHITI S +
Sbjct: 885  QTGERNNEYIATLTSLTDYIMQSNLVSELRNRKQVGYVVFGGMRSLTNTIGLHITIMSLA 944

Query: 934  PPHFLEEKIGEYLSYLEKDLLDNLKPQLFREKYVKEYLNVILSGKMEKTERELAPVNLMS 993
             P  LE  I EY+  LE D + +L    F+  ++  ++N  +          +  VNL+ 
Sbjct: 945  DPEDLERSIDEYMWRLENDTIGSLNESTFKLTFLLPFINT-MQKDTNNPFNNVTNVNLVD 1003

Query: 994  RIKANVRSGN-LDRVGRTMKSHRRIRAQISSKRYNFE-DEDEPIDLQLIESLDFVHYMQF 1051
             + ANV++G+ ++   + MK H  ++ +I + R       +E IDL +I+ L    Y++F
Sbjct: 1004 DVVANVQAGDSVNFETQQMKLHNNLKKRIFNNRIQLNLKYNEAIDLNIIKKLTLKEYLEF 1063

Query: 1052 FKQKISIYSSLRSKISVMVSSPMSRSEIYNRKVFLQLESFLKLKGFKISGEQLQKIVRKS 1111
            F+  ISI S  RSKIS+ + S M++ EI NRK+FLQL +FLK+KG  I  ++L++IV  S
Sbjct: 1064 FRATISINSKNRSKISIHIISLMAKEEIANRKLFLQLVTFLKVKGLTIKRDELKEIVEIS 1123

Query: 1112 DGKPTVLMKELFRYFASRGESLKI 1135
            +GKP+ L+KE+ +YF  + E+ K+
Sbjct: 1124 EGKPSKLLKEIVKYFKKKDEAKKL 1147

>CAGL0D04686g Chr4 (457938..461483) [3546 bp, 1181 aa] {ON} similar to
            uniprot|P40851 Saccharomyces cerevisiae YPR122w AXL1
            protease
          Length = 1181

 Score =  596 bits (1537), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/1184 (32%), Positives = 627/1184 (52%), Gaps = 95/1184 (8%)

Query: 6    VRNFDVQFYTPISCSSRSHRVIQLDNGMLVLLISNPAEKATSCALSVATGSHNDPKEILG 65
            V+ F V FY P+   +R++++IQL NG+ V++IS+  E   SC+L+VA GSHNDP  + G
Sbjct: 5    VKKFWVPFYVPLLHMNRAYKLIQLPNGINVVIISDAEENYNSCSLTVAAGSHNDPATVPG 64

Query: 66   LAHFCEHMILSAGSKSYPDPNAYHDVISKNGGSQNAFTTGEQTTFCFELPNLSNSD-ELV 124
            LAH CEHMIL+AGS ++P P  +H +I+K  G  NA+TTGEQT+F F++P ++NS+  L 
Sbjct: 65   LAHLCEHMILAAGSSNHPTPGLFHSLIAKYNGDMNAYTTGEQTSFYFQVPQVANSEGTLA 124

Query: 125  FDKVLDIFSSSFKKPLFNELLVNKEIYAINSEHTANKSSRDKIFYHATRLLANGDHPFSQ 184
            F+++L +FSS+FK PLF   ++NKEIYAI SEH  NK++  K+ Y ATRLLAN +HPFS+
Sbjct: 125  FEELLSVFSSAFKFPLFTSSVLNKEIYAIQSEHENNKTNPGKVLYQATRLLANKNHPFSR 184

Query: 185  FSTGDITTLSDILQLNKVDLRTEVIKYFKNNFYAENMCLCIKGPQSLNTLGKLVFSKFND 244
            F TGD+ TL        +++R E+I YF +NFY EN+ LC++GPQSLN L KL    FND
Sbjct: 185  FCTGDMNTLKTFPSTENINIRKELISYFNDNFYGENITLCVRGPQSLNHLVKLCMQNFND 244

Query: 245  IKGLPISRPLRTKNQPWLKLKSRNFSNDGFGLGLESFKILSRNWLQKYGNVGIFTGCDNH 304
            IK LP+  P    N       +R+   + F   L+   IL   W  +Y ++  F     +
Sbjct: 245  IKPLPV-LPTAIGN-------NRDSDTELFEETLKRLNILYDVWAPRYTSLPCFHIGYKN 296

Query: 305  NTVLVDSQKLPALRLIFPIHHRLTRLTKKEIDLLSQCWCELFGDESEGSLCHFMKKNDYI 364
            N +LV+S    + R++ P+    TR      ++ +    EL G+E  GS CHF+K+  ++
Sbjct: 297  NVILVNSDMEQSFRIVIPLITNDTREDAIFTEVFTNICVELLGNEEVGSFCHFLKEISWV 356

Query: 365  TELTAFMSHFAVNDNALILELYLTNTGWKNLQMIVAVFFNKYVPIVIECGTYELAEFLSE 424
             E   + S FAV    ++LE    +TG+  ++ IV V F   +P+ +   + +LA F+ E
Sbjct: 357  RECYVYRSEFAVGAAGIVLEFKCFDTGFSQIENIVNVLFQTLIPMYLNMPSDDLARFIKE 416

Query: 425  LNCIELLKFLYQDVTLSSMEECSNLSSLLLTDIESLGPSFILKGNPMNDCNEIDSELGSF 484
               IE + F+Y    LS MEE S+LS  L  D+ + G  ++L  +P        S L ++
Sbjct: 417  QTIIETIDFMYTWKHLSPMEESSDLSMQLQKDLHNRGIKYLLMKSP--------SFLHNY 468

Query: 485  AE--SEESRMWWIGHAIKFQSFIKEFINFENVRLVLMGDLKECPLMKT-----------D 531
             E    E   +W     KF+ F++  +   N ++++       P  KT           +
Sbjct: 469  EEMSKTEKLHYWPLIVEKFKVFLRRHMILPNAKVIIP---TSEPFTKTVRNLFKNAQQME 525

Query: 532  LTSLKLNIEPYYEFEYHKCRSDQSNFKLTVEE----ISYSFHIPYKNVFLPSVGFNLSLI 587
            +TS     +PYYEF Y       S + ++  E      Y F  P  N F+P    NL  +
Sbjct: 526  VTS---ETDPYYEFNY-------SVYSVSFPESRVIFPYQFSFPGPNEFIPPKYRNLDTL 575

Query: 588  KNALLASSNRSQTAALS--LGSQNANPHVLPKLLGKNCFYEMW---VKEEDFELTFKS-- 640
               L   S R+  + L   +  +N+     PKL+ +    E+W   + +  F     +  
Sbjct: 576  LEMLFGISERANFSPLRPIVRLKNSRARSAPKLVHQTEDVEIWTANIVDGIFSKVVNADI 635

Query: 641  KSIVTFEIISTHLNPEPSYTMMLEILCELLGDMLSSQLYPSEKIGYTYEIAASSKGDVRI 700
            KS VT +I++  + P P  ++ L ++ E++   L  +LY   K+G+++ + A+  G +  
Sbjct: 636  KSYVTIKIVNQCIRPTPISSLHLGMMVEIMNMFLLPRLYSCTKLGFSFHLQAALDGSMSF 695

Query: 701  GFTVSGFSEGVYKIIEKIVGTLVQIVYSE--VVIARDLFRKSRIAVRNKYEEAASVNSTT 758
               V+G   G+ KI+EK+   L++I+ ++   ++     RK+R+A+R++YE A   +S  
Sbjct: 696  DIVVTGIMAGIIKILEKVTD-LIEIIVTKPGYILTNAFIRKARVAIRSRYEAATKGSSVK 754

Query: 759  LVNIGLLIVLEKYMWRLESRLEALESTDMESFKQFLSDFFGNSTYMNLFIQGDQTYT-DQ 817
            +   GLL+ LE ++W  E R++ALE +D+E F QF++ FF    +  +F Q   T   D+
Sbjct: 755  IGTTGLLVDLEPHVWSFEERVDALEESDIEVFFQFINTFFRTHKHTKVFAQSSSTSNIDK 814

Query: 818  INIF-LDRNLTGHLSKKRDAVK--ILNEPTSTILKPGSNLFITHKGFKDDPNNSIVYFIQ 874
            I  + + R +T  + +  DA+   + ++  + +LKPG    I   G  +DPNN +  +++
Sbjct: 815  IARYVVQRIVTPGIPEGNDALVECVRDDGHTRMLKPGEERHIKLIGRDNDPNNCVFSYLE 874

Query: 875  TG--DRTDNYSYTLTAFTAFLISLTLVPDLRGRKQVGYIVLGGLRTLSSTVGLHITITSS 932
                +      Y +  FT +L  LTLVP+LR ++QVGY V GGL  L++ VG+++ + SS
Sbjct: 875  MAPLEGISLKQYRMIEFTDYLFQLTLVPELRNKRQVGYAVDGGLVILNNVVGVNVVVVSS 934

Query: 933  SPPHFLEEKIGEYLSYLEKDLLDNLKPQLFREKYVKEYLNVILSGKMEKTERELAPVNLM 992
            + P  +E++I  Y +++ + L DN+  Q++R     +Y  +I        +R+     LM
Sbjct: 935  TSPEHIEQEIESYYAHVRQYLSDNVD-QIWR-----DYSKII-------NDRD----PLM 977

Query: 993  SRIKANVRSGNLDRVGRTMKSHRRIRAQISSKRYNFED------EDEPIDLQ---LIESL 1043
              +  +V   N++R    +  + R       + + ++D       D PI  +        
Sbjct: 978  YLLDHDVWY-NIERENSDIPEYSRDHVANCQRVFKYKDLIELLVVDTPISGRHPDYTPPF 1036

Query: 1044 DFVHYMQFFKQKISIYSSLRS-----KISVMVSSPMSRSEIYNRKVFLQLESFLKLKGFK 1098
                Y+QF    I  Y   R       +SV V SPM + +++ R+V  QLESFLKLKG  
Sbjct: 1037 SMQEYLQFLDSSIGTYKHKRHHNGTRSVSVWVYSPMDKRDVFQRQVKYQLESFLKLKGLV 1096

Query: 1099 ISGEQLQKIVRKSDGKPTVLMKELFRYFASRGESLKICTVMLKE 1142
            I    L  I+R++ GK T + K L+R F  + E+ K    +  E
Sbjct: 1097 IPERDLADIIREAGGKQTTMFKLLYRRFKRQNEAGKFVNSVATE 1140

>NCAS0J01470 Chr10 complement(261880..264867) [2988 bp, 995 aa] {ON}
           Anc_4.246
          Length = 995

 Score =  196 bits (497), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 231/970 (23%), Positives = 395/970 (40%), Gaps = 153/970 (15%)

Query: 1   MSSFGVRNFDVQFYTPISCSSRSHRVIQLDNGMLVLLISNPAEKATSCALSVATGSHNDP 60
           M++   +N ++ F  P     RS+R I+L N +  LLI++P     + +L V  GS NDP
Sbjct: 25  MTAASYKNHNLSFQKP-DLDERSYRFIELPNKLKALLITDPKTDKAAASLDVNIGSFNDP 83

Query: 61  KEILGLAHFCEHMILSAGSKSYPDPNAYHDVISKNGGSQNAFTTGEQTTFCFELPNLSNS 120
           + + GLAHFCEH++   GS+ +PD N Y   +SK+GG  NA+T    T + FE+    N+
Sbjct: 84  EPLPGLAHFCEHLLF-MGSRKFPDENDYSSFLSKHGGHSNAYTGSSNTNYFFEI----NA 138

Query: 121 DELVFDKVLDIFSSSFKKPLFNELLVNKEIYAINSEHTANKSSRDKIFYHATRLLANGDH 180
           + L     LD FS  F  PLFN+   +KEI A++SE+  N  +     Y   + L+N  H
Sbjct: 139 EHLF--GALDRFSGFFTGPLFNKNATDKEINAVDSENKKNLQNDLWRIYQLDKSLSNLKH 196

Query: 181 PFSQFSTGDITTLSDILQLNKVDLRTEVIKYFKNNFYAENMCLCIKGPQSLNTLGKLVFS 240
           P+ +FSTG+I TL  + +   +++R E++K++ +++ A  M LCI G + L+TL +    
Sbjct: 197 PYHKFSTGNIQTLKQLPESQGLNIRDELLKFYDDSYSANLMKLCIIGREDLDTLAQWTAD 256

Query: 241 KFNDIKGLPISRPLRTKNQPWLKLKSRNFSNDGFGLGLESFKILSRNWLQKYGNVGIFTG 300
            FND+K     +PL     P L                     L    LQ+   V     
Sbjct: 257 LFNDVKN--KDKPLPVFQDPIL---------------------LKEQHLQRIIQVEPV-- 291

Query: 301 CDNHNTVLVDSQKLPALRLIFPIHHRLTRLTKKEIDLLSQCWCELFGDESEGSLCHFMKK 360
                      ++L  L + F +         K   +LS     L G E  GSL   +K 
Sbjct: 292 -----------KELRKLDIEFCVPDYEKHWQSKIPHILSH----LIGHEGNGSLLSHLKT 336

Query: 361 NDYITELTAFMSHFAVNDNALILELYLTNTGWKNLQMIVAVFFNKYVPIVIECGTYELAE 420
             +  EL+A     + N+    + + LT  G  + + +  + F       IE   + L +
Sbjct: 337 LGWANELSAGGHTVSENNAFFSIAIELTQKGLAHYKDVTHLIFQ-----YIEMLRHSLPQ 391

Query: 421 FLSELNCIELLKFLYQDVTLSSMEECSNLSSLLLTDIESLGPSFILKGNPMNDCNEIDSE 480
                      +++Y                L L +I      F   GNP N        
Sbjct: 392 -----------EWIY----------------LELQNINKANFKFKQNGNPSN-------T 417

Query: 481 LGSFAESEESRMWWIGHAIKFQSFIK----------EFINFENVRLVLMGDLKECPLMKT 530
           + S ++  E     +G  +    F K          E + F+N R+ L+        ++T
Sbjct: 418 VSSLSKMLEKEYIPVGDILATNLFTKYEPELITKYLEMMTFDNSRITLISK-----DLET 472

Query: 531 DLTSLKLNIEPYYEFEYHKCRSDQSNF-KLTVEEISYSFHIPYKNVFLPSVGFNLSLIKN 589
           D      + E +Y  +Y           K+T   ++ +FH+P  N F+            
Sbjct: 473 D------SFEKWYGTKYKVIEYPADLIAKITSPGLNPNFHLPRPNEFI------------ 514

Query: 590 ALLASSNRSQTAALSLGSQNANPHVLPKLLGKNCFYEMWVKEEDFELTFKSKSIVTFEII 649
                +N  Q   L    +N  P   P LL +    ++W K++D     +    ++F++ 
Sbjct: 515 -----ANNFQVTKL----ENVTPLEEPHLLKETELGKLWYKKDDRFWQPRGHIYISFKLP 565

Query: 650 STHLNPEPSYTMMLEILCELLGDMLSSQLYPSEKIGYTYEIAASSKGDVRIGFTVSGFSE 709
            THL+   S  M+  +  +L+ D L    Y +        +  +++G   +  TVSGF++
Sbjct: 566 HTHLSLLNS--MLTTLYVQLINDSLKDLQYDASCANLHASLTKTNQG---LDITVSGFND 620

Query: 710 GVYKIIEKIVGTLVQIVYSEVVIARDLFRKSRIA-VRNKYEEAASVNSTTLVNIGLLIVL 768
            +  ++ + +  +    +        +F+   I  ++N   E      +TL N     ++
Sbjct: 621 KLIILLTRFLQGIKS--FKPNSDRFQIFKDKTIQHLQNSLYEVPYSQMSTLYN----SLI 674

Query: 769 EKYMWRLESRLEALESTDMESFKQFLSDFFGNSTYMNLFIQGDQTYTDQINIFLDRNLTG 828
            +  W    +L AL+    +    F+   F    Y    I G+  Y + + I    +L  
Sbjct: 675 NERTWTTTEKLSALDKISYDQLLTFIPTIF-EELYFESLIHGNLKYDEAMEI---DSLVK 730

Query: 829 HLSKKRDA--VKILNEPTSTILKPGSNLFITHKGFKDDPNNSIVYFIQTGDRTDNYSYTL 886
            L  + +   ++I N+   + + P    F      KD  N  +   IQ   + D YS  L
Sbjct: 731 LLLTENNILNLQIQNDKLRSYILPKGKTFRYETDLKDPKN--VNSCIQHVTQIDIYSEEL 788

Query: 887 TAFTAFLISLTLVP---DLRGRKQVGYIVLGGLRTLSSTVGLHITITSSSPPHFLEEKIG 943
           +A  A    +   P    LR ++Q+GY+V         T  + I + S     +LE +I 
Sbjct: 789 SAKCALFAQMIHEPCFDTLRTKEQLGYVVFSSTLNNHGTANIRILVQSEKSTPYLEWRID 848

Query: 944 EYLSYLEKDL 953
            +     K L
Sbjct: 849 NFYKIFGKSL 858

>KLLA0E05105g Chr5 (447645..450659) [3015 bp, 1004 aa] {ON} similar
           to uniprot|Q06010 Saccharomyces cerevisiae YLR389C STE23
           Metalloprotease involved with homolog Axl1p in
           N-terminal processing of pro-a-factor to the mature form
           member of the insulin-degrading enzyme family
          Length = 1004

 Score =  196 bits (497), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 237/960 (24%), Positives = 394/960 (41%), Gaps = 165/960 (17%)

Query: 10  DVQFYTPISCSSRSHRVIQLDNGMLVLLISNPAEKATSCALSVATGSHNDPKEILGLAHF 69
           D +F  P     R +R IQL N +  LLIS+      + AL V  GS  DP+ + GLAHF
Sbjct: 49  DSEFLKP-DLDDRKYRYIQLPNNLKALLISDAEADKAAAALDVNIGSFQDPEHLPGLAHF 107

Query: 70  CEHMILSAGSKSYPDPNAYHDVISKNGGSQNAFTTGEQTTFCFELPNLSNSDELVFDKVL 129
           CEH++   G++ YPD N Y   +SK+GGS NA+T  + T + F L    N + L     L
Sbjct: 108 CEHLLF-MGNEKYPDENDYSSFLSKHGGSSNAYTGSQNTNYYFHL----NHENLY--PAL 160

Query: 130 DIFSSSFKKPLFNELLVNKEIYAINSEHTANKSSRDKIFYHATRLLANGDHPFSQFSTGD 189
           D FS  F  PLFN+   +KEI A++SE+  N  +     Y   + L N +HP+ +FSTG+
Sbjct: 161 DRFSGFFSCPLFNKASTDKEINAVDSENKKNLQNDIWRMYQLDKSLTNWEHPYHKFSTGN 220

Query: 190 ITTLSDILQLNKVDLRTEVIKYFKNNFYAENMCLCIKGPQSLNTLGKLVFSKFNDIKGLP 249
           I TL DI +L  +D+R E++ + KNN+ A  M LC+ G + L+TL   V+  F D+  L 
Sbjct: 221 IKTLGDIPKLKGIDIRNELLDFHKNNYSANLMKLCVLGREDLDTLADWVYELFKDVPNLN 280

Query: 250 ISRPLRTKNQPWLKLKSRNFSNDGFGLGLESFKILSRNWLQKYGNVGIFTGCDNHNTVLV 309
              P                                      Y    ++T       V  
Sbjct: 281 KQVP--------------------------------------YYPARLYTESQLKKMVYC 302

Query: 310 DSQK-LPALRLIFPIHHRLTRLTKKEIDLLSQCWCELFGDESEGSLCHFMKKNDYITELT 368
              K L  +   FP          K    LS     L G E  GSL  F+K+  +  EL+
Sbjct: 303 KPVKDLKKIEFTFPTPDMDPYWESKPNHYLSH----LIGHEGNGSLLAFLKEKGWAVELS 358

Query: 369 AFMSHFAVNDNALI-LELYLTNTGWKNLQMIVAVFFNKYVPIVIECGTYELAEFLSELNC 427
           A  SH    DNA+  +E+ LT+ G  ++  I+   F +Y+ ++      E      +   
Sbjct: 359 A-GSHTISKDNAVFGIEIDLTDDGMNHVNEIIISTF-QYLEMLKVTLPEEWIHNELKSTS 416

Query: 428 IELLKFLYQD---VTLSSMEECSNLSSLLLTDIESLGPSFILKGNPMNDCNEIDSELGSF 484
           +   KF  +D    T+S+M  C     + + DI  L  S I + NP              
Sbjct: 417 VSSFKFKQKDPPSSTVSNMARCLEKEYIPVVDI--LSTSLIREYNP-------------- 460

Query: 485 AESEESRMWWIGHAIKFQSFIKEFI---NFENVRLVLMGDLKECPLMKTDLTSLKLNI-E 540
                             S IK+++   N+EN R++L G             +L ++  E
Sbjct: 461 ------------------SMIKKYVQSLNWENSRIMLTGQ------------NLPVDCKE 490

Query: 541 PYYEFEYHKCRSDQSNF-KLTVEEISYSFHIPYKNVFLPSVGFNLSLIKNALLASSNRSQ 599
            +Y  EY      +S   KL    ++  FH+P  N F+    F ++ +            
Sbjct: 491 QWYGTEYKVTDYPESLLKKLPNVGLNPKFHLPRPNEFI-CTKFEVNKL------------ 537

Query: 600 TAALSLGSQNANPHVLPKLLGKNCFYEMWVKEEDFELTFKSKSIVTFEIISTHLNPEPSY 659
                    N  P   P LL  + + ++W K++D     K    V+ ++   H       
Sbjct: 538 --------DNVKPLDEPFLLKDDHYSKLWYKKDDRFWVPKGHIYVSMKL--PHTFSSVVN 587

Query: 660 TMMLEILCELLGDMLSSQLYPSEKIGYTYEIAASSKGDVRIGFTVSGFSEGVYKIIEKIV 719
           +M+  +  +++ D L    Y +        +  +++G   I    SG++E +  ++ + +
Sbjct: 588 SMLTSLYVDMIKDALVDLQYDASCADLRITLGKTNQG---IDIQASGYNEKLTILLTRFL 644

Query: 720 GTLVQIVYSE----VVIARDLFRKSRIAVRNKYEEAASVNSTTLVNIGLLIVLEKYMWRL 775
             +      E    V+  R L + S       Y + ++V   +LVN        +  W  
Sbjct: 645 EGIKSFQPKESRFNVIKNRLLQKLSNQQYDVPYNQISNV-FNSLVN--------ERSWTT 695

Query: 776 ESRLEALESTDMESFKQFLSDFFGNSTYMNLFIQG---DQTYTDQINIFLDRNLTGHLSK 832
           +++L+  +    E  K F+   +    + +L +     +  Y  +IN  +D  +   +  
Sbjct: 696 KAKLDVTKDLTFEHLKSFVPTIYEQLFHESLVLGNFSVEMAY--EINQLVDILVVDRIPN 753

Query: 833 KRDAVKILNEPTSTILKPGSNLFITHKGFKD--DPNNSIVYFIQTGDRTDNYSYTLTAFT 890
               +++ N    + + P  + F      +D  + N+ I Y IQ G     YS  L A  
Sbjct: 754 ----LEVKNNKLRSYILPEESAFRYEYMLEDKANVNSCIQYLIQLG----AYSEELAAKA 805

Query: 891 AFLISLTLVP---DLRGRKQVGYIVLGGLRTLSSTVGLHITITSSSPPHFLEEKIGEYLS 947
           + +  L   P    LR ++Q+GYIV   +     T  L + + S     ++E +I ++L+
Sbjct: 806 SLVSQLIHEPCFDTLRTKEQLGYIVFSAVANTHGTTNLRVLVQSERDSAYVESRIVKFLN 865

>TDEL0E01250 Chr5 (243919..246906) [2988 bp, 995 aa] {ON} Anc_4.246
           YLR389C
          Length = 995

 Score =  195 bits (496), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 236/969 (24%), Positives = 404/969 (41%), Gaps = 157/969 (16%)

Query: 3   SFGVRNFDVQFYTPISCSSRSHRVIQLDNGMLVLLISNPAEKATSCALSVATGSHNDPKE 62
           S G +  +  F  P     RS+R IQL N +  L+I +P    ++ AL V  G+ +DP+E
Sbjct: 30  SNGYKQLESDFIKP-DLDDRSYRFIQLPNDLKALIIQDPTTDKSAAALDVNIGAFSDPEE 88

Query: 63  ILGLAHFCEHMILSAGSKSYPDPNAYHDVISKNGGSQNAFTTGEQTTFCFELPNLSNSDE 122
           + GLAHFCEH++   GS+ +PD N Y   +SK+GGS NA+T  + T + F++    N + 
Sbjct: 89  LPGLAHFCEHLLF-MGSRKFPDENEYSSFLSKHGGSSNAYTGAQNTNYYFQV----NHEH 143

Query: 123 LVFDKVLDIFSSSFKKPLFNELLVNKEIYAINSEHTANKSSRDKIFYHATRLLANGDHPF 182
           L     LD FS  F  PLF++   +KEI A++SE+  N  +     Y   + L+N  HP+
Sbjct: 144 L--KGALDRFSGFFTGPLFSKDSTDKEINAVDSENKKNLQNDIWRLYQLDKSLSNPSHPY 201

Query: 183 SQFSTGDITTLSDILQLNKVDLRTEVIKYFKNNFYAENMCLCIKGPQSLNTLGKLVFSKF 242
            +FSTG++ TL++I +   VD+R E++ ++   + A  M LC+ G + L+TL    +  F
Sbjct: 202 HKFSTGNLKTLNEIPKSKGVDVRNELLNFYSKYYSANLMKLCVLGREDLDTLSDWAYELF 261

Query: 243 NDIKGLPISRPLRTKNQPWLKLKSRNFSNDGFGLGLESFKILSRNWLQKYGNVGIFTGCD 302
           +D+  LP   P                         E+  IL   +L+K+ +V       
Sbjct: 262 SDVPNLPRPAP-----------------------EFEA-SILDGAYLKKFIHVKPV---- 293

Query: 303 NHNTVLVDSQKLPALRLIFPIHHRLTRLTKKEIDLLSQCWCELFGDESEGSLCHFMKKND 362
                    + L  L + F +         K   +LS     L G E  GSL   +K   
Sbjct: 294 ---------KDLTKLEVTFVVPDVEDHWESKPNHILSH----LIGHEGSGSLLAHLKSLG 340

Query: 363 YITELTAFMSHFAVNDNALI-LELYLTNTGWKNLQMIVAVFFNKYVPIVIECGTYELAEF 421
           +  EL+A   H     NA   +++ LT+ G K+ + +    F       IE     L E 
Sbjct: 341 WANELSA-GGHTVSKSNAFFCIDIDLTDEGLKHHEDVTHTIFQ-----YIEMLKNSLPE- 393

Query: 422 LSELNCIELLKFLYQDVTLSS--MEECSNLSSLLLTDIESLGPSFILKGNPMNDCNEIDS 479
                  E +    +D++ +S   E+  N S  + +  ++L   +I    P+     + +
Sbjct: 394 -------EWIYLELEDISKASFKFEQKKNSSGTVSSLAKALEKDYI----PVKSI--LAT 440

Query: 480 ELGSFAESEESRMWWIGHAIKFQSFIKEFI---NFENVRLVLMGDLKECPLMKTDLTSLK 536
            L S  E +                I +++   N EN R+VL+     C   KTD     
Sbjct: 441 SLLSKYEPD---------------LITKYVQSLNVENCRIVLI-----CKTFKTD----- 475

Query: 537 LNIEPYYEFEYHKCRSDQSNFK-LTVEEISYSFHIPYKNVFLPSVGFNLSLIKNALLASS 595
            ++E +Y  EY          K L    ++   H+P  N F+ +  FN+  +        
Sbjct: 476 -SVEKWYGTEYSTVDFSADLLKRLQHPGLNSHLHLPRPNEFI-ATNFNVDKL-------- 525

Query: 596 NRSQTAALSLGSQNANPHVLPKLLGKNCFYEMWVKEEDFELTFKSKSIVTFEIISTHLNP 655
                       +N  P   P LL  +   ++W K++D     +     TF++  TH + 
Sbjct: 526 ------------ENVEPLEEPLLLKDDKISKLWYKKDDRFWQPRGYIYTTFKLPHTHASI 573

Query: 656 EPSYTMMLEILCELLGDMLSSQLYPSEKIGYTYEIAASSKGDVRIGFTVSGFSEGVYKII 715
             S  M+  +  +L+ D L    Y +           +++G   +  T++GF++ +  ++
Sbjct: 574 VNS--MLSTLYVQLINDYLKDLQYDASCADLHLSFIKTNEG---LDITITGFNDKLIILL 628

Query: 716 EKIVGTLVQIVYSEVVIARDLFR-KSRIAVRNKYEEAASVNSTTLVNIGLLIVLEKYMWR 774
            + +  L    +       ++F+ KS+  + N+  E      ++L N     ++ +  W 
Sbjct: 629 TRFLEGLK--AFKPDRKRFEIFKEKSKQHLNNQLYEIPYSQVSSLYN----SLVNERSWT 682

Query: 775 LESRLEALESTDMESFKQFLSDFFGNSTYMNLFIQGDQTY--TDQINIFLDRNLTGHLSK 832
            E +LE +E    E  + F+   F    +    + G+  Y   DQI+  +    +  +S 
Sbjct: 683 AEEKLEVVEQLTFEQLEAFIPTIF-EEMFFETLVHGNIKYEEADQIDSLIQMLRSNSVSN 741

Query: 833 KRDAVKILNEPTSTILKPGSNLFITHK-----GFKDDPNNSIVYFIQTGDRTDNYSYTLT 887
            +    I N    + + P   L  TH+         + N+ I Y IQ G     Y   L+
Sbjct: 742 SQ----IKNARIRSYVLP---LGKTHRYEAKLADTQNVNSCIQYVIQLG----VYDEALS 790

Query: 888 AFTAFLISLTLVP---DLRGRKQVGYIVLGGLRTLSSTVGLHITITSSSPPHFLEEKIGE 944
           A       +   P    LR ++Q+GY+V         T  + I I S     +LE +I  
Sbjct: 791 AIGRLFAQMLHEPCFDTLRTKEQLGYVVFSSSLNNHGTANIRILIQSEHTTPYLEWRIES 850

Query: 945 YLSYLEKDL 953
           +L    K L
Sbjct: 851 FLEQFGKTL 859

>KNAG0B06080 Chr2 complement(1197765..1200755) [2991 bp, 996 aa]
           {ON} Anc_4.246 YLR389C
          Length = 996

 Score =  187 bits (476), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 230/964 (23%), Positives = 392/964 (40%), Gaps = 174/964 (18%)

Query: 22  RSHRVIQLDNGMLVLLISNPAEKATSCALSVATGSHNDPKEILGLAHFCEHMILSAGSKS 81
           RS+R +QL N +  LLIS+P     + AL V  G+  DP+E+ GLAHFCEH++   GS  
Sbjct: 45  RSYRYVQLPNNLKALLISDPTTDKAAAALDVNIGAFEDPEELPGLAHFCEHLLF-MGSSK 103

Query: 82  YPDPNAYHDVISKNGGSQNAFTTGEQTTFCFELPNLSNSDELVFDKVLDIFSSSFKKPLF 141
           +P+ N Y   +SK+GGS NA+T  + T + F++    N + L     LD FS  F  PLF
Sbjct: 104 FPNENEYSSYLSKHGGSSNAYTGAQNTNYYFQV----NYEHLY--GALDRFSGFFTGPLF 157

Query: 142 NELLVNKEIYAINSEHTANKSSRDKIFYHATRLLANGDHPFSQFSTGDITTLSDILQLNK 201
           N+   +KEI A++SE+  N  +     Y   + L NG HP+ +FSTG++ TL    +   
Sbjct: 158 NKESTDKEINAVDSENKKNLQNDLWRLYQLDKSLTNGGHPYHKFSTGNLETLGTTPKELG 217

Query: 202 VDLRTEVIKYFKNNFYAENMCLCIKGPQSLNTLGKLVFSKFNDIKGLPISRPLRTKNQPW 261
           +D+R E++K++  ++ A  M LCI G + L+T+ K V   F D+K L  + P        
Sbjct: 218 LDIRDELLKFYNKSYSANLMKLCILGREDLDTMTKWVEELFQDVKTLDRALP-------- 269

Query: 262 LKLKSRNFSNDGFGLGLESFKILSRNWLQKYGNVGIFTGCDNHNTVLVDSQKLPALRLIF 321
                                                     +NT ++D+  L  +  + 
Sbjct: 270 -----------------------------------------EYNTRILDADHLQEIIKVH 288

Query: 322 PIHHRLTRLTKKEIDL----LSQCW--------CELFGDESEGSLCHFMKKNDYITELTA 369
           P+      L K E+      + + W          L G E  GSL  ++K   +  EL+A
Sbjct: 289 PV----KELKKVEVSFVVPDVDEHWESKPPHILSHLIGHEGTGSLLAYLKTKGWANELSA 344

Query: 370 FMSHFAVNDNALI-LELYLTNTGWKNLQMIVAVFFNKYVPIVIECGTYELAEFLSELNCI 428
              H     NA   +++ LT+ G  + + +V   F +Y+ ++  C               
Sbjct: 345 -GGHTVSKGNAFFSVDIDLTDDGLAHYEEVVHNVF-QYIKMLQNC--------------- 387

Query: 429 ELLKFLYQDVTLSSMEECSNLSSLLLTDIESLGPSFILKGNPMNDCNEIDSELGSFAESE 488
                L Q+     ++E           I      F  KG+P N      S L    E E
Sbjct: 388 -----LPQNWVFHELQE-----------IAQANFKFEQKGSPSNTV----STLAKALEKE 427

Query: 489 E---SRMWWIGHAIKFQ-SFIKEF---INFENVRLVLMG-DLKECPLMKTDLTSLKLNIE 540
               +R+   G   K++   + ++   +  EN R+ L+G DLK         TS +   E
Sbjct: 428 YIPVNRILSNGLLTKYEPELVAQYCRDLKPENSRITLIGKDLK---------TSKR---E 475

Query: 541 PYY--EFEYHKCRSDQSNFKLTVEEISYSFHIPYKNVFLPSVGFNLSLIKNALLASSNRS 598
            +Y  E+E  K   D    K++   ++   H+P+ N F          I N         
Sbjct: 476 KWYGTEYEVEKYSPDLLA-KISTPLLNSHLHLPHPNEF----------IANNFKVDKPEG 524

Query: 599 QTAALSLGSQNANPHVLPKLLGKNCFYEMWVKEEDFELTFKSKSIVTFEIISTHLNPEPS 658
            +A          P   P L+ +N   ++W K++D     +    +TF++  TH +   S
Sbjct: 525 SSA------DEIVPLEEPLLISENETGKVWFKKDDRFWQPRGYIYLTFKLPHTHASALNS 578

Query: 659 YTMMLEILCELLGDMLSSQLYPSEKIGYTYEIAASSKGDVRIGFTVSGFSEGVYKIIEKI 718
             M+  +  +L+ D L    Y +           +++G   +  T+ GF++ +  ++ ++
Sbjct: 579 --MLSTLYVQLINDSLKDLQYNANCANLRASFVKTNQG---LDLTLYGFNDKLIILLTRL 633

Query: 719 VGTL--VQIVYSEVVIARDLFRKSRIAVRNKYEEAASVNSTTLVNIGLLIVLEKYMWRLE 776
           +  +   ++   +  I +D   KS   ++N   E      +T+ N     ++ +  W +E
Sbjct: 634 LEGIKSFKLEQPQFKIFKD---KSVQHLKNLMYEVPYSQISTVYN----YLINERSWSVE 686

Query: 777 SRLEALESTDMESFKQFLSDFFGNSTYMNLFIQGDQTYTDQINIFLDRNLTGHLSKKRDA 836
            +L+ +E    E    F+   F    Y    I G+  Y + + I     +       R  
Sbjct: 687 EKLDVMEKITYEELINFIPTIF-EELYFEALIHGNLKYEEAMEIASLVKILQPSDVTRLQ 745

Query: 837 VKILNEPTSTILKPGSNLFITHKGFKDDPN-NSIVYFIQTGDRTDNYSYTLTAFTAFLIS 895
            K  N    + L P    +      KD  N NS + ++   D  D      +   A +I 
Sbjct: 746 TK--NSRMRSYLIPRGETYRYETKLKDAKNVNSCIQYVTQLDVYDEKLSAKSGLFAQMIH 803

Query: 896 LTLVPDLRGRKQVGYIVLGGLRTLSSTVGLHITITSSSPPHFLE-------EKIGEYLSY 948
                 LR ++Q+GY+V         T  + I I S     +LE       +K GE L+ 
Sbjct: 804 EPCFDTLRTKEQLGYVVFSSSLNNHGTANMRILIQSEHTTPYLEFRIDTFYQKFGELLNA 863

Query: 949 LEKD 952
           + ++
Sbjct: 864 MSEE 867

>TPHA0B02260 Chr2 (517138..520263) [3126 bp, 1041 aa] {ON} Anc_4.246
           YLR389C
          Length = 1041

 Score =  184 bits (467), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 227/938 (24%), Positives = 392/938 (41%), Gaps = 147/938 (15%)

Query: 22  RSHRVIQLDNGMLVLLISNPAEKATSCALSVATGSHNDPKEILGLAHFCEHMILSAGSKS 81
           RS+R IQL N +  LLIS+P     + ++ V  G+  DP+ + GLAHFCEH++   GS+ 
Sbjct: 91  RSYRYIQLPNSLKALLISDPQTDKAAASIDVNVGAFEDPENLPGLAHFCEHLLF-MGSEK 149

Query: 82  YPDPNAYHDVISKNGGSQNAFTTGEQTTFCFELPNLSNSDELVFDKVLDIFSSSFKKPLF 141
           +PD N Y   +SK+GG  NA+T    T + FE+    N + L     LD FS  F  PL 
Sbjct: 150 FPDQNEYSSYLSKHGGHSNAYTAALNTNYFFEV----NHEHL--HGALDRFSGFFTGPLM 203

Query: 142 NELLVNKEIYAINSEHTANKSSRDKIFYHATRLLANGDHPFSQFSTGDITTLSDILQLNK 201
           N     KEI A++SE+  N  + D   Y   + ++N +HP+ +FSTG+I TL +      
Sbjct: 204 NADSTEKEINAVDSENKKNLQNDDWRRYQMDKTISNYNHPYHKFSTGNIKTLMEEPTKLG 263

Query: 202 VDLRTEVIKYFKNNFYAENMCLCIKGPQSLNTLGKLVFSKFNDIKGLPISRPLRTKNQPW 261
           ++ R E++K++ +++ A  M LCI G Q L+TL       F D+K L  + P   +N   
Sbjct: 264 LNTRNELLKFYNSSYSANIMKLCILGRQDLDTLSNWATEFFKDVKNLNKALPQYNEN--- 320

Query: 262 LKLKSRNFSNDGFGLGLESFKILSRNWLQKYGNVGIFTGCDNHNTVLVDSQKLPALRLIF 321
             L+  +       + ++  K L  N++                        +P + L +
Sbjct: 321 -ILEEEHLKKIIKIIPVKDLKKLEINFV------------------------VPDMDLHW 355

Query: 322 PI--HHRLTRLTKKEIDLLSQCWCELFGDESEGSLCHFMKKNDYITELTAFMSHFAVNDN 379
               HH L+                L G E  GS+  ++KK  +  +L+A  +H    DN
Sbjct: 356 ESRPHHVLSH---------------LIGHEGSGSILSYLKKLGWANDLSA-GAHTVSKDN 399

Query: 380 ALI-LELYLTNTGWKNLQMIVAVFFNKYVPIVIECGTYELAEFLSELNCIELLKFLYQDV 438
           A   + + LT+ G +N Q I  + F +Y+ ++      E     SEL  +    F ++  
Sbjct: 400 AFFGINVDLTDKGLENYQEIALLIF-QYIEMLKHSLPQEW--IFSELQDVSKSSFKFKQK 456

Query: 439 TLSSMEECSNLSSLLLTDIESLGPSFILKGNPMNDCNEIDSELGSFAESEESRMWWIGHA 498
           + S     S LS LL  + E + P  IL                +     E  M      
Sbjct: 457 S-SPSGTVSELSKLL--EKEYINPDLILS--------------TTLLRKYEPEM------ 493

Query: 499 IKFQSFIKEFIN---FENVRLVLMGDLKECPLMKTDLTSLKLNIEPYYEFEYHKCRSDQS 555
                 IK++++    +N R+ L+    E     TD        E Y   +Y K   DQ 
Sbjct: 494 ------IKQYVDSLTVDNSRITLISKTVE-----TDSKEKWYGTE-YQVVDYPKSFIDQ- 540

Query: 556 NFKLTVEEISYSFHIPYKNVFLPSVGFNLSLIKNALLASSNRSQTAALSLGSQNANPHVL 615
              L    ++  F +P +N F+ +  F +    + L+                   P   
Sbjct: 541 ---LNQPGLNSEFKLPRRNEFV-ATNFEVKKPTDELV-------------------PLDE 577

Query: 616 PKLLGKNCFYEMWVKEEDFELTFKSKSIVTFEIISTHLNPEPSYTMMLEILCELLGDMLS 675
           P L+  N   ++W K++D     +    V+ ++ S       S  ++  +  + + D + 
Sbjct: 578 PHLILDNDISKVWYKKDDRFWQPRGYIYVSMKLPSCQSGIVNS--LLNGLYVDQINDYMK 635

Query: 676 SQLYPSEKIGYTYEIAASSKGDVRIGFTVSGFSEGVYKIIEKIVGTLVQIVYSEVVIARD 735
              Y +         +++++G   +  T+SGF++ +  ++ + +  +     SE     +
Sbjct: 636 DLQYDASCANLNLSFSSTNQG---LDITISGFNDKLLVLLSRFIEGVKLYQPSEERF--N 690

Query: 736 LFRKSRIA-VRNKYEEAASVNSTTLVNIGLLIVLEKYMWRLESRLEALESTDMESFKQFL 794
           +F+   I  ++N   E       TL N     ++ +  W ++ +L+ LE+   + F  F+
Sbjct: 691 IFKNKAIQNLKNSLFEVPYSQMGTLYN----TIMNESTWPIKEKLDVLEALTFDQFVSFV 746

Query: 795 SDFFGNSTYMNLFIQGDQTYTDQINIFLDRNLTGHLSKKRDAVKILN------EPTSTIL 848
              + N  Y +  + G+  Y + +           L K   + KILN         S IL
Sbjct: 747 PSIY-NEFYFDALVHGNIRYEEAME-------ANDLLKSLASFKILNLHVRNSRLRSYIL 798

Query: 849 KPG-SNLFITHKGFKDDPNNSIVYFIQTGDRTDNYSYTLTAFTAFLISLTLVPDLRGRKQ 907
             G S  +      KD+ N+ I + +Q G  T+  S  L+   A +I       LR ++Q
Sbjct: 799 PEGESYRYEIDMEDKDNLNSCIQHVVQLGLYTEELS-ALSGLFAQMIREPCFDTLRTKEQ 857

Query: 908 VGYIVLGGLRTLSSTVGLHITITSSSPPHFLEEKIGEY 945
           +GY+V         T  + I + S     +LE +I E+
Sbjct: 858 LGYVVFSSNLNNHGTANMRILVQSEHSTSYLEWRIDEF 895

>Kwal_23.4237 s23 (630432..633437) [3006 bp, 1001 aa] {ON} YLR389C
           (STE23) - involved in a-factor processing [contig 1]
           FULL
          Length = 1001

 Score =  184 bits (466), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 236/985 (23%), Positives = 405/985 (41%), Gaps = 195/985 (19%)

Query: 8   NFDVQFYTPISCSSRSHRVIQLDNGMLVLLISNPAEKATSCALSVATGSHNDPKEILGLA 67
           N +++F  P+    R +R I+L N + VLLI +      + AL V  GS  DP+ + GLA
Sbjct: 43  NHNIEFKKPL-LDDREYRFIELPNKLKVLLIQDVNTDKAAAALDVNVGSFEDPENLPGLA 101

Query: 68  HFCEHMILSAGSKSYPDPNAYHDVISKNGGSQNAFTTGEQTTFCFELPNLSNSDELVFDK 127
           HFCEH++   GS  YP+ N Y   +SK+GG  NA+T+ + T + F++ N  N        
Sbjct: 102 HFCEHLLF-MGSSKYPNENEYSSYLSKHGGGSNAYTSSQNTNYFFQV-NQGN-----LHG 154

Query: 128 VLDIFSSSFKKPLFNELLVNKEIYAINSEHTANKSSRDKIFYHATRLLANGDHPFSQFST 187
            LD FS  F  PLFN+   +KEI A++SE+  N  S     Y   +  ++ +HP+ +FST
Sbjct: 155 ALDRFSGFFSCPLFNKDSTDKEINAVDSENKKNLQSDLWRLYQLDKSQSSPEHPYHKFST 214

Query: 188 GDITTLSDILQLNKVDLRTEVIKYFKNNFYAENMCLCIKGPQSLNTLGKLVFSKFNDIKG 247
           G++ TL ++ +   +D+R E++K++  ++ A  M LC+ G + L+ L + V+  F   K 
Sbjct: 215 GNLKTLGELPKSQNLDVRDELLKFYNRSYSANLMKLCVLGREDLDVLSQWVYDLF---KD 271

Query: 248 LPISRPLRTKNQPWLKLKSRNFSNDGFGLGLESFKILSRNWLQKYGNVGI-FTGCDNHNT 306
           +P +R +   + P   L  +N             +I+S   ++    V + F   D    
Sbjct: 272 VP-NRDVPVPSYPTRLLLPQNLE-----------QIISAKPVKDIKRVEVNFVAPDM--D 317

Query: 307 VLVDSQKLPALRLIFPIHHRLTRLTKKEIDLLSQCWCELFGDESEGSLCHFMKKNDYITE 366
              DS+         P H+                   L G E  GSL  ++K   +  E
Sbjct: 318 PYWDSK---------PGHY----------------LSHLIGHEGSGSLLAYLKSKGWANE 352

Query: 367 LTAFMSHFAVNDNALI-LELYLTNTGWKNLQMIVAVFFNKYVPIVIECGTYELAE--FLS 423
           L+A  SH    DN    + + LT+ G  N + +V   F       IE    EL +     
Sbjct: 353 LSA-GSHTVSKDNGFFSISIDLTDEGIANYEDVVISVFQ-----YIEMLKKELPQEWVFQ 406

Query: 424 ELNCIELLKFLYQD-----VTLSSMEECSNLSSLLLTDIESLGPSFILKGNPMNDCNEID 478
           EL       F +Q       T+S++ +      + + DI  L  S + K +P     E+ 
Sbjct: 407 ELRDTAEASFKFQQKGHPASTVSALSKALEKEYIPVGDI--LSASLLRKYDP-----ELI 459

Query: 479 SELGSFAESEESRMWWIGHAIKFQSFIKEFINFENVRLVLMGDLKECPLMKTDLTSLKLN 538
           SE                       ++ E +  EN R+ L        + K   T    +
Sbjct: 460 SE-----------------------YVAE-LKPENSRVTL--------IHKNATTD---S 484

Query: 539 IEPYYEFEYHKCR-SDQSNFKLTVEEISYSFHIPYKNVFLPSVGFNLSLIKNALLASSNR 597
           +E +Y  EY   R +D    ++     +   H+P  N F+ S  F++  +          
Sbjct: 485 VEKWYGTEYAITRYTDSLVERMKSPGRNAQLHLPRPNEFISS-NFDVEKL---------- 533

Query: 598 SQTAALSLGSQNANPHVLPKLLGKNCFYEMWVKEEDFELTFKSKSIVTFEIISTHLNPEP 657
                     +N  P   P LL ++    +W K++D     K    V+ +++ T+ +   
Sbjct: 534 ----------ENVEPRQEPLLLLQDGQSRLWYKKDDRFWVPKGHIYVSMKLVHTYSSIVN 583

Query: 658 SYTMMLEILCELLGDMLSSQLYPSEKIGYTYEIAASSKG--------DVRIGFTVSGFSE 709
           S  M+  +  +L+ D L    Y S+    T     +++G        + ++   ++ + E
Sbjct: 584 S--MLTSLYVDLVNDFLKDIQYDSQVASLTVSFRKTNQGLDLALSGYNEKMPILLTSYLE 641

Query: 710 GV--------------YKIIEKIVGTLVQIVYSEVVIARDLFRKSRIAVRNKYEEAASVN 755
           G+               K+I+K+   L +I YS+   A D++                  
Sbjct: 642 GISRFKPNQERFKIFQAKLIQKLNNHLYEIPYSQ---ASDVY------------------ 680

Query: 756 STTLVNIGLLIVLEKYMWRLESRLEALESTDMESFKQFLSDFFGNSTYMNLFIQGDQTYT 815
             +L+N        +  W ++ +LE +E    +  + FL   F    +    + G+ +Y 
Sbjct: 681 -NSLIN--------ERSWTIKDKLEVVEQLTFQHLENFLPTIF-EQFFFEALVHGNFSYE 730

Query: 816 DQINIFLDRNLTGHLSKK--RDAVKILNEPTSTILKPGSNLFITHKGFKDDPNNSIVYFI 873
             + I     L   L+    ++ +   ++P S  + PG   +   +   D+ N  I   I
Sbjct: 731 TAVEI---HKLVKALAPNDIKNCLLKSSKPRSLHIPPGRAYYYEQR-LADEKN--INSCI 784

Query: 874 QTGDRTDNYSYTLTAFTAFLISLTLVP---DLRGRKQVGYIVLGGLRTLSSTVGLHITIT 930
           Q  ++   YS  L A  A    L   P    LR ++Q+GY+V         TV L I I 
Sbjct: 785 QHVNQFGTYSEELAAKAALFAQLIDEPAFDTLRTKEQLGYVVFSSALNTHGTVNLRILIQ 844

Query: 931 SSSPPHFLEEKIGEYLSYLEKDLLD 955
           S     FLE +I  +L+ + + L D
Sbjct: 845 SERDTAFLESRIDAFLAKMGQILQD 869

>NDAI0J02240 Chr10 complement(547488..550487) [3000 bp, 999 aa] {ON}
           Anc_4.246
          Length = 999

 Score =  183 bits (464), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 241/999 (24%), Positives = 402/999 (40%), Gaps = 157/999 (15%)

Query: 22  RSHRVIQLDNGMLVLLISNPAEKATSCALSVATGSHNDPKEILGLAHFCEHMILSAGSKS 81
           RS+R I+L N +  LLIS+P     + +L V  G+  DP+ + GLAHFCEH++   GS+ 
Sbjct: 50  RSYRFIELPNKLKALLISDPTTDKAAASLDVNIGAFEDPESLPGLAHFCEHLLF-MGSEK 108

Query: 82  YPDPNAYHDVISKNGGSQNAFTTGEQTTFCFELPNLSNSDELVFDKVLDIFSSSFKKPLF 141
           +PD N Y   +SK+GG  NA+T  + T + FE+    N + L     LD FS  F  PLF
Sbjct: 109 FPDENDYSSFLSKHGGHSNAYTGSQNTNYFFEI----NYEHL--KGALDRFSGFFSCPLF 162

Query: 142 NELLVNKEIYAINSEHTANKSSRDKIFYHATRLLANGDHPFSQFSTGDITTLSDILQLNK 201
           N    +KEI A++SE+  N  S     Y   + L+  DHP+ +FSTG++ TL  I +   
Sbjct: 163 NIGSTDKEINAVDSENKKNLQSDMWRIYQLDKSLSLLDHPYHKFSTGNLETLKIIPESKN 222

Query: 202 VDLRTEVIKYFKNNFYAENMCLCIKGPQSLNTLGKLVFSKFNDIKGLPISRPLRTKNQPW 261
           V++R E++K++  N+ A  M LCI G + L+TL   V S F D+K +    P        
Sbjct: 223 VNVRDELLKFYNANYSANLMKLCIIGREDLDTLSDYVQSFFKDVKNIDKELPFYDS---- 278

Query: 262 LKLKSRNFSNDGFGLGLESFKILSRNWLQKYGNVGIFTGCDNHNTVLVDSQKLPALRLIF 321
                               KIL+ + L K  +V                ++L  L + F
Sbjct: 279 --------------------KILNDDQLTKIVSVEPV-------------KELRKLEVSF 305

Query: 322 PIHHRLTRLTKKEIDLLSQCWCELFGDESEGSLCHFMKKNDYITELTAFMSHFAVNDNAL 381
            +    T    K   +LS     L G E  GSL   +K   +  EL+A   H     NA 
Sbjct: 306 VVPDYETHWESKIPHILSH----LIGHEGNGSLLSHLKTLGWANELSA-GGHTVSRGNAF 360

Query: 382 I-LELYLTNTGWKNLQMIVAVFFNKYVPIVIECGTYELAEFLSELNCIELLKFLYQDVTL 440
             +++ LT  G KN + ++ + F       IE     L +           K++Y     
Sbjct: 361 FSIDIDLTENGLKNYEQVILLAFQ-----YIEMLKNSLPQ-----------KWIY----- 399

Query: 441 SSMEECSNLSSLLLTDIESLGPSFILKGNPMNDCNEIDSELGSFAESEESRMWWIGHAIK 500
                      L L +I +    F  KGNP +      S L    E E   +  I     
Sbjct: 400 -----------LELQNIANANFKFKQKGNPSSTV----SSLSKLLEKEYIPVGNILSTGL 444

Query: 501 FQSFIKEFIN-------FENVRLVLMGDLKECPLMKTDLTSLKLNIEPYYEFEYHKCRSD 553
           F  +  E +        + N R+ L+    E    K      K  +E Y          D
Sbjct: 445 FNKYEPELVEKYLSEMIYSNSRITLISKNLETD-SKEKWYGTKYKLEDY--------SVD 495

Query: 554 QSNFKLTVEEISYSFHIPYKNVFLPSVGFNLSLIKNALLASSNRSQTAALSLGSQNANPH 613
             N K+    ++ +FH+P  N F+    F++   KN                   +  P 
Sbjct: 496 LIN-KIKTPGLNPNFHLPRPNEFIAD-NFHVDKPKN-----------------ESDIIPL 536

Query: 614 VLPKLLGKNCFYEMWVKEEDFELTFKSKSIVTFEIISTH---LNPEPSYTMMLEILCELL 670
             P LL      ++W K++D     +    ++F++  TH   LN     +M+  +  +++
Sbjct: 537 EEPLLLKDTSMGKLWYKKDDRFWQPRGYIKISFKLPHTHSTLLN-----SMLTTLYVQMV 591

Query: 671 GDMLSSQLYPSEKIGYTYEIAASSKGDVRIGFTVSGFSEGVYKIIEKIVGTLVQIVYSEV 730
            D L    Y +        ++ +++G   +  ++SGF++ +  ++ + +  +    +   
Sbjct: 592 NDSLKDLQYDASCANLHVSLSKTNQG---LDISLSGFNDKLIILLTRFLQGIKD--FKPT 646

Query: 731 VIARDLFRKSRIA-VRNKYEEAASVNSTTLVNIGLLIVLEKYMWRLESRLEALESTDMES 789
                +F+   I  ++N   E      ++L N     ++ +  W  E +L  +    ++ 
Sbjct: 647 SERFQIFKDKTIQHLKNSMYEVPYSQMSSLYN----ALINEKTWLPEEKLNMMNKLTLDQ 702

Query: 790 FKQFLSDFFGNSTYMNLFIQGDQTYTDQINIFLDRNLTGHLSKKRDAVKILNEPTSTILK 849
              F+  F  +  +   F+ G+  Y + I I    +L     +     +  NE   + L 
Sbjct: 703 LNSFIP-FIFDELFFECFVHGNLKYDEAIEIESLIDLLMSSKENLTNSQYENEKLRSYLL 761

Query: 850 PGSNLFITHKGFKDDPNNSIVYFIQTGDRTDNYSYTLTAFTAFLISLTLVP---DLRGRK 906
           P +  +      KD  N  +   IQ   + D YS  L+A       +   P    LR ++
Sbjct: 762 PKNKTYRYETLLKDRKN--VNSCIQHVIQVDIYSEELSAICGLFAQMLHEPCFDTLRTKE 819

Query: 907 QVGYIVLGGLRTLSSTVGLHITITSSSPPHFLEEKIGEYLSYLEKDLLDNLKPQLFREKY 966
           Q+GY+V         T  + I + S     +LE +I E+      DLL+ +  + F +  
Sbjct: 820 QLGYVVFSSTLNNHGTANIRILVQSEKSTPYLEWRIDEFYKKF-GDLLNGMSDEDFTKH- 877

Query: 967 VKEYLNVILSGKMEKTERE---------LAPVNLMSRIK 996
            K+ L   L+ K +    E         L   N M R+K
Sbjct: 878 -KDALCKSLTQKFKNMNEESIRYSSAIYLGDYNFMHRVK 915

>KLTH0D14278g Chr4 complement(1172523..1175528) [3006 bp, 1001 aa]
           {ON} similar to uniprot|Q06010 Saccharomyces cerevisiae
           YLR389C STE23 Metalloprotease involved with homolog
           Axl1p in N-terminal processing of pro-a-factor to the
           mature form member of the insulin-degrading enzyme
           family
          Length = 1001

 Score =  182 bits (462), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 223/950 (23%), Positives = 393/950 (41%), Gaps = 149/950 (15%)

Query: 11  VQFYTPISCSSRSHRVIQLDNGMLVLLISNPAEKATSCALSVATGSHNDPKEILGLAHFC 70
           V+F  P+    R++R I+L N +  LLI +P     + AL V  GS  DP+++ GLAHFC
Sbjct: 46  VKFTKPL-LDDRNYRFIELPNKLKALLIQDPTTDKAAAALDVNVGSFEDPEDLPGLAHFC 104

Query: 71  EHMILSAGSKSYPDPNAYHDVISKNGGSQNAFTTGEQTTFCFELPNLSNSDELVFDKVLD 130
           EH++   GS  +P+ N Y   +SK+GG  NA+T+   T + F++    N + L     L 
Sbjct: 105 EHLLF-MGSSKFPNENEYSSYLSKHGGGSNAYTSARNTNYFFQV----NQESL--HGALL 157

Query: 131 IFSSSFKKPLFNELLVNKEIYAINSEHTANKSSRDKIFYHATRLLANGDHPFSQFSTGDI 190
            FS  F  PLFN+   +KEI A++SE+  N  S     Y   +  +N +HPF +FSTG++
Sbjct: 158 RFSGFFSCPLFNKESTDKEINAVDSENKKNLQSDLWRLYQLDKSQSNPEHPFHKFSTGNL 217

Query: 191 TTLSDILQLNKVDLRTEVIKYFKNNFYAENMCLCIKGPQSLNTLGKLVFSKFNDIKGLPI 250
            TL DI +   VD+R E++K++ +++ A  M LC+ G + L+T+ + V+  F D+     
Sbjct: 218 KTLGDIPKSKDVDIRDELLKFYDSSYSANLMKLCVLGREDLDTMSQWVYDLFKDVPN--S 275

Query: 251 SRPLRTKNQPWLKLKSRNFSNDGFGLGLESFKILSRNWLQKYGNVGI-FTGCDNHNTVLV 309
            RP+ T     L  +                +I++   ++    V I F   D      V
Sbjct: 276 DRPVPTYEAKMLPPQYLT-------------QIINAKPVKDLKKVEITFVAPD------V 316

Query: 310 DSQ--KLPALRLIFPIHHRLTRLTKKEIDLLSQCWCELFGDESEGSLCHFMKKNDYITEL 367
           D Q    P         H L+ L   E                 GSL  ++K   +  EL
Sbjct: 317 DEQWDSKPG--------HYLSHLIGHE---------------GSGSLLAYLKLKGWANEL 353

Query: 368 TAFMSHFAVNDNALI-LELYLTNTGWKNLQMIVAVFFNKYVPIVIECGTYELAEFLSELN 426
           +A  SH    DNA   +++ LT+ G KN + ++   F       IE    EL +      
Sbjct: 354 SA-GSHTVSEDNAFFSVDIDLTDEGVKNYESVIQSVFQ-----YIELLKKELPQ------ 401

Query: 427 CIELLKFLYQDVTLSSMEECSNLSSLLLTDIESLGPSFILKGNPMNDCNEIDSEL----- 481
                +++Y++                L D       F  KGNP +  + +   L     
Sbjct: 402 -----EWIYEE----------------LRDTAEASFKFKQKGNPASTVSSLSKALEKDYI 440

Query: 482 --GSFAESEESRMWWIGHAIKFQSFIKEFINFENVRLVLMGDLKECPLMKTDLTSLKLNI 539
             G    +   R +     +K   +I   I  EN R+  +          TD T      
Sbjct: 441 PVGDVLSTSLLRKYEPELVVK---YIAHLIP-ENSRVTFIHK-----NASTDST------ 485

Query: 540 EPYYEFEYHKCRSDQSNF-KLTVEEISYSFHIPYKNVFLPSVGFNLSLIKNALLASSNRS 598
           E +Y  EY   +  +    KL     +   H+P +N F+ S  F +  +           
Sbjct: 486 EKWYGTEYGVVKYSEGLMDKLKSPGTNSLLHLPRRNEFISS-NFQVDKL----------- 533

Query: 599 QTAALSLGSQNANPHVLPKLLGKNCFYEMWVKEEDFELTFKSKSIVTFEIISTHLNPEPS 658
                    ++  P   P LL ++   ++W K++D     K    V+ ++  T+ +   S
Sbjct: 534 ---------EDVEPLQEPLLLKQDRQSKVWYKKDDRFWVPKGHIYVSMKLAHTYSSVVNS 584

Query: 659 YTMMLEILCELLGDMLSSQLYPSEKIGYTYEIAASSKGDVRIGFTVSGFSEGVYKIIEKI 718
             M+  +  EL+ D L    Y ++          +++G   +  ++SG++E +  ++++ 
Sbjct: 585 --MLTTLYVELINDYLKDLEYDAQVASLHISFRKTNQG---LDLSLSGYNEKMAILLKRY 639

Query: 719 VGTLVQIVYSEVVIARDLFRKSRIAVRNKYEEAASVNSTTLVNIGLLIVLEKYMWRLESR 778
           +  +     +E     D F+  +  +  K          + V+     V+ +  W + ++
Sbjct: 640 LEGIANFQPAE-----DRFKIYQDKLLQKLNNHLYEVPYSQVSDVFNSVINERAWTIANK 694

Query: 779 LEALESTDMESFKQFLSDFFGNSTYMNLFIQGDQTYTDQINIFLDRNLTGHLSKKRDAVK 838
           LE ++    E  K F+   F   ++  + + G+  ++ +  +  D  +     +     +
Sbjct: 695 LEVVKQLKFEHLKLFIPAIFEQFSF-EILVHGN--FSCEAALEADNLVRALAPRDVQNFQ 751

Query: 839 ILNEPTSTILKPGSNLFITHKGFKDDP--NNSIVYFIQTGDRTDNYSYTLTAFTAFLISL 896
           + +    ++L P    F   +   DD   N+ I +  Q G  ++  S   + F A LI  
Sbjct: 752 LKSSKPRSVLLPQGKTFCYQQMLADDKNINSCIQHVTQFGSYSEELSAKASLF-AQLIDE 810

Query: 897 TLVPDLRGRKQVGYIVLGGLRTLSSTVGLHITITSSSPPHFLEEKIGEYL 946
                LR ++Q+GY+V         TV L + I S     +LE +I  +L
Sbjct: 811 PAFDTLRTKEQLGYVVFSSALNTHGTVNLRLLIQSERDTAYLESRIDAFL 860

>TBLA0I02940 Chr9 complement(699857..702754) [2898 bp, 965 aa] {ON}
           Anc_4.246 YLR389C
          Length = 965

 Score =  171 bits (434), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 152/517 (29%), Positives = 239/517 (46%), Gaps = 69/517 (13%)

Query: 7   RNFDVQFYTPISCSSRSHRVIQLDNGMLVLLISNPAEKATSCALSVATGSHNDPKEILGL 66
           + +++ F  P     R++R I+L N + VLLI +      + +L V  G+  DP+ + GL
Sbjct: 6   KTYNLNFAKP-DLDDRNYRFIELPNSLKVLLIQDATTDKAAASLDVNIGAFEDPEGLPGL 64

Query: 67  AHFCEHMILSAGSKSYPDPNAYHDVISKNGGSQNAFTTGEQTTFCFELPNLSNSDELVFD 126
           AHFCEH++   GS+ YPD N Y   +S NGGS NA+T    T + FE+    N + L  +
Sbjct: 65  AHFCEHLLF-MGSEKYPDENEYSSFLSTNGGSYNAYTGALNTNYFFEI----NYEHL--E 117

Query: 127 KVLDIFSSSFKKPLFNELLVNKEIYAINSEHTANKSSRDKIFYHATRLLANGDHPFSQFS 186
             LD FS  F +PLF++   +KEI A++SE+  N  S     Y   + L+N  HP+ +FS
Sbjct: 118 GALDRFSGFFSRPLFSKDSTDKEINAVDSENKKNLQSDVWRMYQLDKSLSNRKHPYHKFS 177

Query: 187 TGDITTLSDILQLNKVDLRTEVIKYFKNNFYAENMCLCIKGPQSLNTLGKLVFSKFNDIK 246
           TG+I TL  I     +D+R E++K++ N++ A  M L I G + L+ LG   +S F D+K
Sbjct: 178 TGNIQTLGTIPNEQGLDIRDELLKFYNNSYSANLMKLTILGREDLDILGDWAYSMFKDVK 237

Query: 247 GLPISRPLRTKNQPWLKLKSRNFSNDGFGLGLESFKILSRNWLQKYGNVGIFTGCDNHNT 306
            L    P+  +                        K+L+  +L +  N+           
Sbjct: 238 NLNRELPVYEE------------------------KMLTEEYLMQIINIKPV-------- 265

Query: 307 VLVDSQKLPALRLIFPIHHRLTRLTKKEIDLLSQCWCELFGDESEGSLCHFMKKNDYITE 366
                Q +  L L F +         K   +LS     L G E  GSL   +K   + TE
Sbjct: 266 -----QDMRKLELSFTVPDLDKEWESKTPRILSH----LLGHEGSGSLLAHLKCLGWATE 316

Query: 367 LTAFMSHFAVNDNALI-LELYLTNTGWKNLQMIVAVFFNKYVPIVIECGTYELAEFLSEL 425
           L A   H   +DNA+  +++ LT  G+ + + +    F +Y+ ++ +    E      EL
Sbjct: 317 LAA-GGHTISDDNAVFSVDIDLTEEGFNHYEDVTVAIF-QYINMLKDTLPQEW--IYDEL 372

Query: 426 NCIELLKFLYQDVTLSSMEECSNLSSLLLTD---IES-LGPSFILKGNP---MNDCNEID 478
             I   +F ++  T S     S+LS  L  +   +E  L  S   K  P   MN  NE+ 
Sbjct: 373 QAIANAEFKFKQKT-SPSGTVSSLSKALEKEYIPVEKILATSLFSKYEPELLMNYINELT 431

Query: 479 ------SELGSFAESEESRMWWIGHAIKFQSFIKEFI 509
                 S +    E++E   W+ G   K  ++ K+FI
Sbjct: 432 PYNSRLSLISKDVETDEVEEWY-GTEYKSITYPKKFI 467

 Score = 53.1 bits (126), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 96/476 (20%), Positives = 190/476 (39%), Gaps = 58/476 (12%)

Query: 559  LTVEEISYSFHIPYKNVFLPS--------VGFNLSLIKNALLASSNRSQTAALSLGS-QN 609
            +  +E+   +   YK++  P          GFN    KN  L + N        +    N
Sbjct: 444  VETDEVEEWYGTEYKSITYPKKFIKRLERAGFN----KNLYLPNPNDFVATNFDVKKIDN 499

Query: 610  ANPHVLPKLLGKNCFYEMWVKEEDFELTFKSKSIVTFEIISTHLNPEPSYTMMLEILCEL 669
              P   P LL  +   ++W K++D    ++ +  +       H +   + +M+  +  +L
Sbjct: 500  ITPIDEPYLLKDDQVSKLWFKKDD--RFWQPRGYIHIFTKLPHSHASITNSMLTSLYVQL 557

Query: 670  LGDMLSSQLYPSEKIGYTYEIAASSKGDVRIGFTVSGFSEGVYKIIEKIVGTLVQIVYSE 729
            + D L    Y +         + + +G   +  TVSGF+  +  ++E  +  +       
Sbjct: 558  VNDQLKDLQYDASCASLDISFSKTGQG---LDITVSGFNHKILILLESFLKGIKNFK--- 611

Query: 730  VVIARDLFRKSRIAV-RNKYEEAASVNSTTLVNIGLL-----IVLEKYMWRLESRLEALE 783
                     KSR  + + KY +    N    V  G +      V++   W ++ +L  ++
Sbjct: 612  -------LEKSRFLIFQEKYIQQLK-NMLFQVPYGQVSHYYNYVIDDRAWSIKEKLSTMQ 663

Query: 784  STDMESFKQFLSDFFGNSTYMNLFIQGDQTYTD--QINIFLDRNLTGHLSKKRDAVKILN 841
                E  + FL   F N  Y    + G+   +D  ++N  +++ ++G +   +    I N
Sbjct: 664  KLTFEDLENFLPTIF-NEVYFESLVHGNFEKSDAAEVNQLVEKYISGSIHNPQ----IRN 718

Query: 842  EP-TSTILKPGSNLFITHKGFKDDP---NNSIVYFIQTGDRTDNYSYTLTAFTAFLISLT 897
            +   S +L+ G      ++   +DP   N+ I +  Q G   D  +  L++  A +I+  
Sbjct: 719  DRLRSYVLQKGETY--RYETLLEDPENVNSCIQHVTQIGLYNDRLA-ALSSLFAQIINEP 775

Query: 898  LVPDLRGRKQVGYIVLGGLRTLSSTVGLHITITSSSPPHFLEEKIGEYLSYLEKDLLDNL 957
                LR ++Q+GY+V         T  + I + S     +LE +I E+   + K +L  +
Sbjct: 776  CFNILRTKEQLGYVVFSSSLNNYGTTNIRILVQSEHTTEYLEWRIDEFYKSV-KTILTQM 834

Query: 958  KPQLFREKYVKEYLNVILSGKMEKTERELAPVNLMSRIKANVRSGNLDRVGRTMKS 1013
             P+ F     K+ L   L  K +  + E       SR   ++ +G+ D + R  K+
Sbjct: 835  APETFENH--KDALCKTLLQKYKNMKEE------SSRYSNSIFNGDYDYLLRQNKA 882

>CAGL0H06457g Chr8 (633721..636747) [3027 bp, 1008 aa] {ON} highly
           similar to uniprot|Q06010 Saccharomyces cerevisiae
           YLR389c STE23
          Length = 1008

 Score =  169 bits (429), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 128/403 (31%), Positives = 192/403 (47%), Gaps = 51/403 (12%)

Query: 2   SSFGVRNFDVQFYTPISCSSRSHRVIQLDNGMLVLLISNPAEKATSCALSVATGSHNDPK 61
           S+   ++  VQF  P     R +R IQL N +  L+I +      + AL V  G+  DP+
Sbjct: 42  STMPYKDLKVQFLKP-DLDDRQYRYIQLPNNLKALIIQDATTDKAAAALDVNIGAFQDPE 100

Query: 62  EILGLAHFCEHMILSAGSKSYPDPNAYHDVISKNGGSQNAFTTGEQTTFCFELPNLSNSD 121
            + GLAHFCEH++   GS+ +PD N Y   +SK+GGS NA+T  + T + FE+    N+D
Sbjct: 101 NLPGLAHFCEHLLF-MGSEKFPDENEYSSYLSKHGGSSNAYTGSQNTNYFFEV----NAD 155

Query: 122 ELVFDKVLDIFSSSFKKPLFNELLVNKEIYAINSEHTANKSSRDKIFYHATRLLANGDHP 181
            L     LD FS  F  PLFN+   +KEI A++SE+  N  +     Y   + L+N DHP
Sbjct: 156 HL--HGALDRFSGFFSCPLFNQNSTDKEINAVDSENKKNLQNDIWRMYQLDKSLSNQDHP 213

Query: 182 FSQFSTGDITTLSDILQLNKVDLRTEVIKYFKNNFYAENMCLCIKGPQSLNTLGKLVFSK 241
           + +FSTG++ TL D  +   +D+R E++K++  N+ A  M LCI G + L+TL +  +  
Sbjct: 214 YHKFSTGNLETLGDKPKAAGLDIREELLKFYNENYSANLMKLCILGKEDLDTLSEWAWEL 273

Query: 242 FNDIKGLPISRPLRTKNQPWLKLKSRNFSNDGFGLGLESFKILSRNWLQKYGNVGIFTGC 301
           F D+K     R L   + P LK       ND                             
Sbjct: 274 FKDVKN--SDRALPVYDAPILK------END--------------------------LKK 299

Query: 302 DNHNTVLVDSQKLPALRLIFPIHHRLTRLTKKEIDLLSQCWCELFGDESEGSLCHFMKKN 361
                 + D +KL  +  + P +       KK    +S  +  L G E  GSL   +K  
Sbjct: 300 IIKVKPVKDLRKLD-ISFVVPDYE------KKWEAKISHIFSHLIGHEGSGSLLAHLKSL 352

Query: 362 DYITELTAFMSHFAVNDNALI-LELYLTNTGWKNLQMIVAVFF 403
            +  EL A   H   + NA   +++ LTN G K+ + IV + F
Sbjct: 353 GWANELGA-GGHTVSDGNAFFNVDIELTNEGLKHYKDIVVLIF 394

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 70/338 (20%), Positives = 137/338 (40%), Gaps = 27/338 (7%)

Query: 616 PKLLGKNCFYEMWVKEEDFELTFKSKSIVTFEIISTHLNPEPSYTMMLEILCELLGDMLS 675
           P LL  +   ++W K++D     +    VT ++ +TH +   S  M+  +  +++ D L 
Sbjct: 548 PLLLKDDDVSKLWYKKDDRFWQPRGYIYVTLKLPNTHSSIISS--MLTTLYVQMVNDALK 605

Query: 676 SQLYPSEKIGYTYEIAASSKGDVRIGFTVSGFSEGVYKIIEKIVGTLVQIVYSEVVIAR- 734
              Y +           +++G   +  T+SGF+E +  ++++ V  +      E    R 
Sbjct: 606 DLQYDAACANINLSFVKTNQG---LDITISGFNEKLLILLKRFVEGVQGF---EPKKERF 659

Query: 735 DLFRKSRIA-VRNKYEEAASVNSTTLVNIGLLIVLEKYMWRLESRLEALESTDMESFKQF 793
           ++F+   +  ++N+  E      + L N     V+ +  W  + +LE  E    E    F
Sbjct: 660 EVFKDKTVHHLKNQMMEVPYSQISGLYNS----VVNERTWPTKEKLEVAEKLKFEQLDNF 715

Query: 794 LSDFFGNSTYMNLFIQGDQTYTDQINIFLDRNLTGHLSKKRDAVKI---LNEPTSTILKP 850
           +   + +  Y   F+ G+    +   +    +L     KK D   I    N   S I+  
Sbjct: 716 VRAIY-DGMYYESFVHGNLESKEAREV---DSLVSTFLKKDDIKNIDVQSNRLRSYIIPK 771

Query: 851 GSNLFITHKGFKDDPNNSIVYFIQTGDRTDNYSYTLTAFTAFLISLTLVP---DLRGRKQ 907
           G +       + ++  NS    IQ   + D Y+  L+A +     +   P    LR ++Q
Sbjct: 772 GKSYAYETDLYDENNVNSC---IQHVVQLDVYNEKLSALSGLFAQMLHEPCFDILRTKEQ 828

Query: 908 VGYIVLGGLRTLSSTVGLHITITSSSPPHFLEEKIGEY 945
           +GY+V         T  + I + S     +LE +I E+
Sbjct: 829 LGYVVFSSSLNNHGTANIRILVQSEHTTPYLEWRIDEF 866

>YLR389C Chr12 complement(899577..902660) [3084 bp, 1027 aa] {ON}
           STE23Metalloprotease involved, with homolog Axl1p, in
           N-terminal processing of pro-a-factor to the mature
           form; expressed in both haploids and diploids; member of
           the insulin-degrading enzyme family
          Length = 1027

 Score =  168 bits (426), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 135/461 (29%), Positives = 215/461 (46%), Gaps = 59/461 (12%)

Query: 7   RNFDVQFYTPISCSSRSHRVIQLDNGMLVLLISNPAEKATSCALSVATGSHNDPKEILGL 66
           + F++ F  P     RS+R I+L N +  LLI +P     + +L V  G+  DPK + GL
Sbjct: 58  KTFNLDFLKP-DLDERSYRFIELPNKLKALLIQDPKADKAAASLDVNIGAFEDPKNLPGL 116

Query: 67  AHFCEHMILSAGSKSYPDPNAYHDVISKNGGSQNAFTTGEQTTFCFELPNLSNSDELVFD 126
           AHFCEH++   GS+ +PD N Y   +SK+GGS NA+T  + T + FE+    N   L   
Sbjct: 117 AHFCEHLLF-MGSEKFPDENEYSSYLSKHGGSSNAYTASQNTNYFFEV----NHQHLF-- 169

Query: 127 KVLDIFSSSFKKPLFNELLVNKEIYAINSEHTANKSSRDKIFYHATRLLANGDHPFSQFS 186
             LD FS  F  PLFN+   +KEI A+NSE+  N  +     Y   + L N  HP+ +FS
Sbjct: 170 GALDRFSGFFSCPLFNKDSTDKEINAVNSENKKNLQNDIWRIYQLDKSLTNTKHPYHKFS 229

Query: 187 TGDITTLSDILQLNKVDLRTEVIKYFKNNFYAENMCLCIKGPQSLNTLGKLVFSKFNDIK 246
           TG+I TL  + + N +++R E++K+ KN + A  M LCI G + L+TL    +  F D+ 
Sbjct: 230 TGNIETLGTLPKENGLNVRDELLKFHKNFYSANLMKLCILGREDLDTLSDWTYDLFKDV- 288

Query: 247 GLPISRPLRTKNQPWLKLKSRNFSNDGFGLGLESFKILSRNWLQKYGNVGIFTGCDNHNT 306
                                  +N+G  + L +  I+    LQK   V           
Sbjct: 289 -----------------------ANNGREVPLYAEPIMQPEHLQKIIQVRPV-------- 317

Query: 307 VLVDSQKLPALRLIFPIHHRLTRLTKKEIDLLSQCWCELFGDESEGSLCHFMKKNDYITE 366
                + L  L + F +         K   +LS     L G E  GSL   +KK  +  E
Sbjct: 318 -----KDLKKLEISFTVPDMEEHWESKPPRILSH----LIGHEGSGSLLAHLKKLGWANE 368

Query: 367 LTAFMSHFAVNDNALI-LELYLTNTGWKNLQMIVAVFFNKYVPIVIECGTYELAEFLSEL 425
           L+A   H     NA   +++ LT+ G  + + ++ + F +Y+ ++    +       +EL
Sbjct: 369 LSA-GGHTVSKGNAFFAVDIDLTDNGLTHYRDVIVLIF-QYIEML--KNSLPQKWIFNEL 424

Query: 426 NCIELLKFLYQDV-----TLSSMEECSNLSSLLLTDIESLG 461
             I    F ++       T+SS+ +C     + ++ I ++G
Sbjct: 425 QDISNATFKFKQAGSPSSTVSSLAKCLEKDYIPVSRILAMG 465

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 87/413 (21%), Positives = 159/413 (38%), Gaps = 29/413 (7%)

Query: 616  PKLLGKNCFYEMWVKEEDFELTFKSKSIVTFEIISTHLNPEPSYTMMLEILCELLGDMLS 675
            P LL  +   ++W K++D     +    ++F++  TH +   S  M+  +  +L  D L 
Sbjct: 558  PVLLLSDDVSKLWYKKDDRFWQPRGYIYLSFKLPHTHASIINS--MLSTLYTQLANDALK 615

Query: 676  SQLYPSEKIGYTYEIAASSKGDVRIGFTVSGFSEGVYKIIEKIVGTLVQIVYSEVVIARD 735
               Y +           +++G   +  T SGF+E   K+I  +   L  +   E    R 
Sbjct: 616  DVQYDAACADLRISFNKTNQG---LAITASGFNE---KLIILLTRFLQGVNSFEPKKDRF 669

Query: 736  LFRKSRIAVRNKYEEAASVNSTTLVNIGLLIVLEKYMWRLESRLEALESTDMESFKQFLS 795
               K +  +R+       V  + + N    I+ E+  W    +L+  E    E    F+ 
Sbjct: 670  EILKDK-TIRHLKNLLYEVPYSQMSNYYNAIINER-SWSTAEKLQVFEKLTFEQLINFIP 727

Query: 796  DFFGNSTYMNLFIQGDQTYTDQINIFLDRNLTGHLSKKRDAVKILNEPTSTILKPGSNLF 855
              +    Y    I G+  + + + +  D  +   +      +++ N    + L P    F
Sbjct: 728  TIY-EGVYFETLIHGNIKHEEALEV--DSLIKSLIPNNIHNLQVSNNRLRSYLLPKGKTF 784

Query: 856  ITHKGFKDDPNNSIVYFIQTGDRTDNYSYTLTAFTAFLISLTLVP---DLRGRKQVGYIV 912
                  KD  N  +   IQ   + D YS  L+A +     L   P    LR ++Q+GY+V
Sbjct: 785  RYETALKDSQN--VNSCIQHVTQLDVYSEDLSALSGLFAQLIHEPCFDTLRTKEQLGYVV 842

Query: 913  LGGLRTLSSTVGLHITITSSSPPHFLEEKIGEYLSYLEKDLLDNLKPQLFREKYVKEYLN 972
                     T  + I I S     +LE +I  +     + L D   P+   EK+ +   N
Sbjct: 843  FSSSLNNHGTANIRILIQSEHTTPYLEWRINNFYETFGQVLRD--MPEEDFEKHKEALCN 900

Query: 973  VILSGKMEKTERELAPVNLMSRIKANVRSGNLDRVGRTMKSHRRIRAQISSKR 1025
             +L  K +    E A      R  A +  G+ +   R  K+  ++ A I+ ++
Sbjct: 901  SLLQ-KFKNMAEESA------RYTAAIYLGDYNFTHRQKKA--KLVANITKQQ 944

>SAKL0H03124g Chr8 (291984..295004) [3021 bp, 1006 aa] {ON} similar
           to uniprot|Q06010 Saccharomyces cerevisiae YLR389C STE23
           Metalloprotease involved with homolog Axl1p in
           N-terminal processing of pro-a-factor to the mature form
           member of the insulin-degrading enzyme family
          Length = 1006

 Score =  166 bits (421), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 120/397 (30%), Positives = 192/397 (48%), Gaps = 51/397 (12%)

Query: 8   NFDVQFYTPISCSSRSHRVIQLDNGMLVLLISNPAEKATSCALSVATGSHNDPKEILGLA 67
           N  + F  P     R++R IQL N +  LLI +PA    + AL +  G+  DP+ I GLA
Sbjct: 47  NHKISFKKP-DLDDRNYRFIQLPNNLKALLIQDPATDKAAAALDINVGAFEDPENIPGLA 105

Query: 68  HFCEHMILSAGSKSYPDPNAYHDVISKNGGSQNAFTTGEQTTFCFELPNLSNSDELVFDK 127
           HFCEH++   GS  +PD N Y   +SK+GG+ NA+T  + T + F++    N ++L    
Sbjct: 106 HFCEHLLF-MGSSKFPDENEYSSFLSKHGGASNAYTGSQNTNYYFQV----NHEDL--RG 158

Query: 128 VLDIFSSSFKKPLFNELLVNKEIYAINSEHTANKSSRDKIFYHATRLLANGDHPFSQFST 187
            LD FS  F  PLFN+   +KEI A++SE+  N  +     Y   +   +  HP+ +FST
Sbjct: 159 ALDRFSGFFTSPLFNKNSTDKEINAVDSENKKNLQNDLWRMYQLDKSFTSPMHPYHKFST 218

Query: 188 GDITTLSDILQLNKVDLRTEVIKYFKNNFYAEN-MCLCIKGPQSLNTLGKLVFSKFNDIK 246
           G++ TL +  +   +D+R E++K++ N FY+ N M LC+ G + L+T+ + V+  F D++
Sbjct: 219 GNLKTLGETPKNQGLDIRDELLKFY-NKFYSANIMKLCVLGREDLDTMSEWVYELFKDVR 277

Query: 247 GLPISRPLRTKNQPWLKLKSRNFSNDGFGLGLESFKILSRNWLQKYGNVGIFTGCDNHNT 306
               S P    + P L  + +              KI+    ++    V I     +   
Sbjct: 278 NNNCSVP--EYSIPLLPAEYKT-------------KIIRAKPVKDLKKVEITFAVPD--- 319

Query: 307 VLVDSQKLPALRLIFPIHHRLTRLTKKEIDLLSQCWCELFGDESEGSLCHFMKKNDYITE 366
           V V  +  P        HH L+                L G E  GSL  ++K   +  E
Sbjct: 320 VDVHWESKP--------HHYLSH---------------LIGHEGSGSLLAYLKGQGWANE 356

Query: 367 LTAFMSHFAVNDNALILELYLTNTGWKNLQMIVAVFF 403
           L+A     +VN+    +++ LTN G  + Q +V+  F
Sbjct: 357 LSAGAHTVSVNNAFFSVDIELTNNGLDHYQDVVSSVF 393

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 69/329 (20%), Positives = 135/329 (41%), Gaps = 28/329 (8%)

Query: 626 EMWVKEEDFELTFKSKSIVTFEIISTHLNPEPSYTMMLEILCELLGDMLSSQLYPSEKIG 685
           ++W K++D     +    V+ ++  TH +   S  M+  +  EL+ D L    Y +E   
Sbjct: 556 KLWYKKDDTFWAPRGYIYVSMKLAHTHSSIVNS--MLTSLYVELINDHLKDLQYDAEVAN 613

Query: 686 YTYEIAASSKGDVRIGFTVSGFSEGVYKIIEKIVGTLVQIVYSEVVIARDLFR--KSRIA 743
                + +++G   +  ++ G++E +  ++ + +  +      E     D F+  + ++ 
Sbjct: 614 LHVSFSKTNQG---LDISLCGYNEKLTILLTRFLEGI-----KEFTPKLDRFKIFQDKL- 664

Query: 744 VRNKYEEAASVNSTTLVNIGLLIVLEKYMWRLESRLEALESTDMESFKQFLSDFFGNSTY 803
           VR        V  + L  I   ++ E+  W  + +L+  +    E  K F+   +    Y
Sbjct: 665 VRKLNNHLYEVPYSQLSGIFNSLINER-SWSTKEKLDLTKQLTFEHLKNFIPTIY-EQLY 722

Query: 804 MNLFIQGD--QTYTDQINIFLDRNLTGHLSKKRDAVKILNEPTSTILKPGSNLFITHKGF 861
             + + G+  Q    +IN  +   +   +      +++ N    + + P    F      
Sbjct: 723 YEILVHGNFSQEAATEINDLVKMMVPNDIKN----LQVKNGKLRSYIIPQEKTFRMELPL 778

Query: 862 KDDPN-NSIVYFIQTGDRTDNYSYTLTAFTAFLISLTLVP---DLRGRKQVGYIVLGGLR 917
            D+ N NS    IQ   +   YS  L+A TA L  L   P    LR ++Q+GY+V     
Sbjct: 779 ADEKNVNSC---IQHVTQFGIYSEDLSAKTALLAQLIDEPCFDTLRTKEQLGYVVFSSAL 835

Query: 918 TLSSTVGLHITITSSSPPHFLEEKIGEYL 946
           +   TV L + I S     +LE +I  +L
Sbjct: 836 STHGTVNLRLLIQSERDSSYLESRIDSFL 864

>Skud_12.474 Chr12 complement(839782..842850) [3069 bp, 1022 aa]
           {ON} YLR389C (REAL)
          Length = 1022

 Score =  165 bits (417), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 124/399 (31%), Positives = 190/399 (47%), Gaps = 53/399 (13%)

Query: 7   RNFDVQFYTPISCSSRSHRVIQLDNGMLVLLISNPAEKATSCALSVATGSHNDPKEILGL 66
           + FD+ F  P     RS+R I+L N +  LLI +P     + +L V  G+  DP+ + GL
Sbjct: 58  KTFDLDFLKP-DLDERSYRFIELPNKLKALLIQDPKADKAAASLDVNIGAFEDPESLPGL 116

Query: 67  AHFCEHMILSAGSKSYPDPNAYHDVISKNGGSQNAFTTGEQTTFCFELPNLSNSDELVFD 126
           AHFCEH++   GS+ +PD N Y   +SK+GGS NA+T  + T + FE+    N   L   
Sbjct: 117 AHFCEHLLF-MGSEKFPDENEYSSYLSKHGGSSNAYTASQNTNYFFEI----NHQHLF-- 169

Query: 127 KVLDIFSSSFKKPLFNELLVNKEIYAINSEHTANKSSRDKIFYHATRLLANGDHPFSQFS 186
             LD F+  F  PLFN+   +KEI A+NSE+  N  +     Y   + L N +HP+ +FS
Sbjct: 170 GALDRFAGFFSCPLFNKDSTDKEINAVNSENKKNLQNDIWRIYQLDKSLTNPNHPYHKFS 229

Query: 187 TGDITTLSDILQLNKVDLRTEVIKYFKNNFYAEN-MCLCIKGPQSLNTLGKLVFSKFNDI 245
           TG+I TL  + + N  ++R E+++ F NNFY+ N M LCI G + L+TL    ++ F DI
Sbjct: 230 TGNIETLGTLPKENGQNVRDELLQ-FHNNFYSANLMKLCILGREDLDTLSDWTYNLFKDI 288

Query: 246 KGLPISRPLRTKNQPWLKLKSRNFSNDGFGLGLESFKILSRNWLQKYGNVGIFTGCDNHN 305
                                   SN+   +   +  I+   +LQK   V          
Sbjct: 289 ------------------------SNNDREVPHYAEPIMQSEYLQKIIQVHPV------- 317

Query: 306 TVLVDSQKLPALRLIFPIHHRLTRLTKKEIDLLSQCWCELFGDESEGSLCHFMKKNDYIT 365
                 + L  L + F +     +   K   +LS     L G E  GSL   +K   +  
Sbjct: 318 ------KDLKKLEISFTVPDMDEKWESKPPRILSH----LIGHEGSGSLLAHLKNVGWAN 367

Query: 366 ELTAFMSHFAVNDNALI-LELYLTNTGWKNLQMIVAVFF 403
           EL+A   H     NA   +++ LT+ G  + + ++ + F
Sbjct: 368 ELSA-GGHTVSKGNAFFAVDIDLTDNGLTHYRDVIVLVF 405

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 76/363 (20%), Positives = 147/363 (40%), Gaps = 20/363 (5%)

Query: 616 PKLLGKNCFYEMWVKEEDFELTFKSKSIVTFEIISTHLNPEPSYTMMLEILCELLGDMLS 675
           P LL  +    +W K++D     +    ++F++  TH +   S  M+  +  +++ D L 
Sbjct: 558 PMLLLSDGVSRLWYKKDDRFWQPRGYIYLSFKLPHTHASIINS--MLSTLYIQMVNDALK 615

Query: 676 SQLYPSEKIGYTYEIAASSKGDVRIGFTVSGFSEGVYKIIEKIVGTLVQIVYSEVVIARD 735
              Y ++  G       +++G   +  T SG++E   K+I  +   L  ++  E    R 
Sbjct: 616 DLQYDADCAGLRISFNKTNQG---LDITASGYNE---KLIILLTRFLQGVISFEPKKNRF 669

Query: 736 LFRKSRIAVRNKYEEAASVNSTTLVNIGLLIVLEKYMWRLESRLEALESTDMESFKQFLS 795
              K +  +R+       V  + + N    ++ E+  W    +L+  E    E    F+ 
Sbjct: 670 EILKDK-TIRHLKNLLYEVPYSQMSNYYNSLINER-SWSTAEKLQVFEKLSYEQLINFIP 727

Query: 796 DFFGNSTYMNLFIQGDQTYTDQINIFLDRNLTGHLSKKRDAVKILNEPTSTILKPGSNLF 855
             +  + +  L I G+    + + +  D  +   ++   + +++ N    + L P    F
Sbjct: 728 TIYEGAFFETL-IHGNIKREEAMEV--DSLIKSMITVNINNLQVSNNRLRSYLLPKGKSF 784

Query: 856 ITHKGFKDDPNNSIVYFIQTGDRTDNYSYTLTAFTAFLISLTLVP---DLRGRKQVGYIV 912
                 KD  N  +   IQ   + D YS  L+A +     L   P    LR ++Q+GY+V
Sbjct: 785 RYETALKDSLN--VNSCIQHVTQLDVYSEELSALSGLFTQLIHEPCFDTLRTKEQLGYVV 842

Query: 913 LGGLRTLSSTVGLHITITSSSPPHFLEEKIGEYLSYLEKDLLDNLKPQLFREKYVKEYLN 972
                    T  + I I S     +LE +I  +     + L D +K + F EK+ +   N
Sbjct: 843 FSSSLNNHGTANIRILIQSEHTTPYLEWRITNFYETFGQTLKD-MKQEDF-EKHKEALCN 900

Query: 973 VIL 975
            +L
Sbjct: 901 SLL 903

>ZYRO0B12320g Chr2 complement(996046..999030) [2985 bp, 994 aa] {ON}
           similar to uniprot|Q06010 Saccharomyces cerevisiae
           YLR389C STE23 Metalloprotease involved with homolog
           Axl1p in N-terminal processing of pro-a-factor to the
           mature form member of the insulin-degrading enzyme
           family
          Length = 994

 Score =  165 bits (417), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 130/412 (31%), Positives = 192/412 (46%), Gaps = 59/412 (14%)

Query: 1   MSSFGVRN--------FDVQFYTPISCSSRSHRVIQLDNGMLVLLISNPAEKATSCALSV 52
           +S  GVRN         + QF  P     RS+R IQL N +  LLI +      + AL V
Sbjct: 19  LSRIGVRNMSNNNYKKLEGQFVKP-DLDDRSYRYIQLPNDLKALLIHDSKADKAAAALDV 77

Query: 53  ATGSHNDPKEILGLAHFCEHMILSAGSKSYPDPNAYHDVISKNGGSQNAFTTGEQTTFCF 112
             G+  DP+ + GLAHFCEH++   GS+ YPD N Y   +SK+GG+ NA+T  + T + F
Sbjct: 78  NVGAFEDPEGLPGLAHFCEHLLF-MGSEKYPDENEYSSYLSKHGGASNAYTGSQNTNYYF 136

Query: 113 ELPNLSNSDELVFDKVLDIFSSSFKKPLFNELLVNKEIYAINSEHTANKSSRDKIFYHAT 172
           E+    N + L     LD F+  F  PLFN    +KEI A++SE+  N  S     Y   
Sbjct: 137 EV----NHEHLF--GALDRFAGFFTCPLFNRDSTDKEIKAVDSENKKNLQSDLWRLYQLD 190

Query: 173 RLLANGDHPFSQFSTGDITTLSDILQLNKVDLRTEVIKYFKNNFYAENMCLCIKGPQSLN 232
           + L N +HP+ +FSTG+  TL +I   N +D+R E++K++K ++ A  M LC+ G + L+
Sbjct: 191 KSLTNEEHPYHKFSTGNFITLHEIPTSNGIDVREELLKFYKKSYSANLMKLCVLGREDLD 250

Query: 233 TLGKLVFSKFNDIKGLPISRPLRTKNQPWLKLKSRNFSNDGFGLGLESFKILSRNWLQKY 292
           TL     S F D+    I+RP+                           K+L    LQK 
Sbjct: 251 TLSNWACSLFQDVPN--IARPVPEYGS----------------------KMLDERSLQKV 286

Query: 293 GNVGIFTGCDNHNTVLVDSQKLPALRLIFPIHHRLTRLTKKEIDLLSQCWCELFGDESEG 352
                      H   + D +K   L + F           K   +LS     L G E  G
Sbjct: 287 I----------HAKSVKDLKK---LEVTFSAPDMDLEWESKPQHILSH----LVGHEGSG 329

Query: 353 SLCHFMKKNDYITELTAFMSHFAVNDNALI-LELYLTNTGWKNLQMIVAVFF 403
           SL   +K   +  EL+A   H    +NA   +++ LT+ G K+ + +  + F
Sbjct: 330 SLLAHLKDKGWANELSA-GGHSVSKENAFFSIDIDLTDLGLKHYEDVTHIIF 380

 Score = 36.2 bits (82), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 65/353 (18%), Positives = 131/353 (37%), Gaps = 38/353 (10%)

Query: 616 PKLLGKNCFYEMWVKEEDFELTFKSKSIVTFEIISTHLNPEPSYTMMLEILCELLGDMLS 675
           P LL  +   ++W K++D     +    ++F++   H       +M+  +  +L+ D + 
Sbjct: 533 PLLLKDDKISKLWYKKDDRFWQPRGYIYISFKL--PHTQASIVNSMLSTLYVQLINDYIK 590

Query: 676 SQLYPSEKIGYTYEIAASSKGDVRIGFTVSGFSEGVYKIIEKIVGTLVQIVYSEVVIARD 735
              Y +         + +++G   +  TV GF++ +  ++ + +  L             
Sbjct: 591 DLQYDAACADLHLSFSKTNQG---LDITVVGFNDKLTILLTRFLEGL------------- 634

Query: 736 LFRKSRIAVRNKYEEAASVNSTTLVN----IGLLIVLEKY-------MWRLESRLEALES 784
              KS    +N+++      +  L N    +  L V   Y        W ++ +LE L+ 
Sbjct: 635 ---KSFKPEKNRFQIFKDKCTRQLTNQLYEVPYLQVFPVYSSLINERTWSVKEKLEVLKR 691

Query: 785 TDMESFKQFLSDFFGNSTYMNLFIQGDQTYTDQINIFLDRNLTGHLSKKRDAVKILNEPT 844
              E    +L   +    +   F+ G+  Y + I +  D  +   +       +  N   
Sbjct: 692 LTFEQLVTYLPTIY-EEMFFEAFVHGNMKYEEAIEV--DSLVQMLVPNDIRNFQTKNGKL 748

Query: 845 STILKPGSNLFITHKGFKDDPN--NSIVYFIQTGDRTDNYSYTLTAFTAFLISLTLVPDL 902
            +   P    +      +D  N  + I +  Q G  ++  S   + F A +I       L
Sbjct: 749 RSYFLPQGETYRYETKLQDSQNLNSCIQHVTQLGVYSEEISAKASLF-AQMIHEPCFDTL 807

Query: 903 RGRKQVGYIVLGGLRTLSSTVGLHITITSSSPPHFLEEKIGEYLSYLEKDLLD 955
           R ++Q+GY+V         T  + I + S     FLE +I  +L    K L D
Sbjct: 808 RTKEQLGYVVFSSSLNNHGTANIRILVQSEHTTPFLEWRIESFLQGFGKILQD 860

>KAFR0A05970 Chr1 (1206007..1209042) [3036 bp, 1011 aa] {ON}
           Anc_4.246 YLR389C
          Length = 1011

 Score =  164 bits (416), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 123/405 (30%), Positives = 195/405 (48%), Gaps = 52/405 (12%)

Query: 7   RNFDVQFYTPISCSSRSHRVIQLDNGMLVLLISNPAEKATSCALSVATGSHNDPKEILGL 66
           ++F + F  P     RS+R I+L N +  L+I +P     + AL V  G+  DP+ + GL
Sbjct: 48  KDFKLNFIKP-DLDDRSYRFIKLPNNLKALVIQDPTADKAAAALDVNIGAFEDPEHLPGL 106

Query: 67  AHFCEHMILSAGSKSYPDPNAYHDVISKNGGSQNAFTTGEQTTFCFELPNLSNSDELVFD 126
           AHFCEH++   GS+ +PD N Y   +SK+GGS NA+T+   T + FE+    N + L   
Sbjct: 107 AHFCEHLLF-MGSEKFPDENEYSSFLSKHGGSSNAYTSSLNTNYYFEV----NHEHLY-- 159

Query: 127 KVLDIFSSSFKKPLFNELLVNKEIYAINSEHTANKSSRDKIFYHATRLLANGDHPFSQFS 186
             LD FS  F  PLFN+   +KEI A++SE+  N  +     Y   + L+N  HP+ +FS
Sbjct: 160 NALDRFSGFFTCPLFNKGSTDKEISAVDSENKKNLQNDVWRIYQLDKSLSNLQHPYHKFS 219

Query: 187 TGDITTLSDILQLNKVDLRTEVIKYFKNNFYAENMCLCIKGPQSLNTLGKLVFSKFNDIK 246
           TG++ TL +  +   +++R E++K++ +++ A  M LCI G + L+TL    +  F D++
Sbjct: 220 TGNLITLGENPKSLNLNIRDELLKFYYHSYSANLMKLCIIGREDLDTLSNWAYKLFKDVR 279

Query: 247 GLPISRPLRTKNQPWLKLKSRNFSNDGFGLGLESFKILSRNWLQKYGNVGIFTGCDNHNT 306
                                   N    L   S KIL+   LQK   V           
Sbjct: 280 ------------------------NTNRALPEYSSKILNETHLQKIIQVKPV-------- 307

Query: 307 VLVDSQKLPALRLIFPIHHRLTRLTKKEIDLLSQCWCELFGDESEGSLCHFMKKNDYITE 366
                ++L  L + F +         K   LLS     L G E  GSL  ++K   +  E
Sbjct: 308 -----KELRKLEISFMVPDMDRHWQSKPPHLLSH----LIGHEGSGSLLAYLKAKGWANE 358

Query: 367 LTAFMSHFAVNDNALI-LELYLTNTGWKNLQMIVAVFFNKYVPIV 410
           L+A   H    DNA   +++ LT  G ++ + +V   F +Y+ ++
Sbjct: 359 LSA-GGHTVSKDNAFFSIDVELTKDGLESYKEVVHSIF-QYIEML 401

 Score = 48.9 bits (115), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 70/346 (20%), Positives = 137/346 (39%), Gaps = 22/346 (6%)

Query: 608 QNANPHVLPKLLGKNCFYEMWVKEEDFELTFKSKSIVTFEIISTHLNPEPSYTMMLEILC 667
           ++  P   P LL      ++W K++D     +    V+ ++  TH +   S  M+  I  
Sbjct: 540 ESVTPSEEPLLLKDTKLSKLWFKKDDRFWQPRGYIYVSLKLPHTHASVLNS--MLSTIYV 597

Query: 668 ELLGDMLSSQLYPSEKIGYTYEIAASSKGDVRIGFTVSGFSEGVYKIIEKIVGTLVQIVY 727
           +L  D L    Y +           +++G   +  T+SGF++ +  ++ + +  +     
Sbjct: 598 QLANDFLKDLQYDASCANLNLSFVKTNQG---LDITLSGFNDKLVTLMTRFLQGVKDFKP 654

Query: 728 SE--VVIARDLFRKSRIAVRNKYEEAASVNSTTLVNIGLLIVLEKYMWRLESRLEALEST 785
           +E    I +D   K+   ++N   E      + + N     ++ +  W +E +L  +E  
Sbjct: 655 TEERFKIFKD---KTTQHLKNLLYEVPYSQISGVYNS----LINERSWSVEEKLNVVEHI 707

Query: 786 DMESFKQFLSDFFGNSTYMNLFIQGDQTYTDQINIFLDRNLTGHLSKKRDAVKILNEPTS 845
             E    F+   F    Y    + G+  + + I I    N     ++  + +++ N    
Sbjct: 708 TFEQLLAFIPTVF-EELYYETLVHGNLKFEEAIEIESLINDILITNENHNNLQVKNNRLR 766

Query: 846 TILKPGSNLFITHKGFKDDPN-NSIVYFIQTGDRTDNYSYTLTAFTAFLISLTLVP---D 901
           +   P    +   K  KD  N NS    IQ   + D Y+  L+A +     +   P    
Sbjct: 767 SYFIPKGKTYRFEKELKDSKNVNSC---IQHVTQLDVYNEELSALSGLFAQMIHEPCFDT 823

Query: 902 LRGRKQVGYIVLGGLRTLSSTVGLHITITSSSPPHFLEEKIGEYLS 947
           LR ++Q+GY+V         T  + I + S     +LE +I E+ S
Sbjct: 824 LRTKEQLGYVVFSSSLNNHGTANIRILVQSEHTTPYLEWRIEEFYS 869

>Smik_12.476 Chr12 complement(838321..841398) [3078 bp, 1025 aa]
           {ON} YLR389C (REAL)
          Length = 1025

 Score =  163 bits (412), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 129/431 (29%), Positives = 206/431 (47%), Gaps = 58/431 (13%)

Query: 22  RSHRVIQLDNGMLVLLISNPAEKATSCALSVATGSHNDPKEILGLAHFCEHMILSAGSKS 81
           RS+R I+L N +  LLI +P     + +L V  G+  DP+++ GLAHFCEH++   GS+ 
Sbjct: 72  RSYRYIELPNKLKALLIQDPKADKAAASLDVNIGAFEDPEKLPGLAHFCEHLLF-MGSEK 130

Query: 82  YPDPNAYHDVISKNGGSQNAFTTGEQTTFCFELPNLSNSDELVFDKVLDIFSSSFKKPLF 141
           +PD N Y   +SK+GGS NA+T  + T + FE+     + + +FD  LD FS  F  PLF
Sbjct: 131 FPDENEYSSFLSKHGGSSNAYTASQNTNYFFEV-----NHQHLFD-ALDRFSGFFSCPLF 184

Query: 142 NELLVNKEIYAINSEHTANKSSRDKIFYHATRLLANGDHPFSQFSTGDITTLSDILQLNK 201
           N+   +KEI A+NSE+  N  +     Y   + L N  HP+ +FSTG+I TL    + N 
Sbjct: 185 NKDSTDKEINAVNSENKKNLQNDIWRIYQLDKSLTNTKHPYHKFSTGNIETLGTSPKENG 244

Query: 202 VDLRTEVIKYFKNNFYAENMCLCIKGPQSLNTLGKLVFSKFNDIKGLPISRPLRTKNQPW 261
           +++R E++K+ K+ + A  M LCI G + L+TL   V+  F                   
Sbjct: 245 LNIRDELLKFHKDFYSANLMKLCILGREDLDTLSDWVYDLF------------------- 285

Query: 262 LKLKSRNFSNDGFGLGLESFKILSRNWLQKYGNVGIFTGCDNHNTVLVDSQKLPALRLIF 321
                +N SN+G  +   +  I+    LQK   V                + L  L + F
Sbjct: 286 -----KNVSNNGREVPYYAEPIMQPEHLQKIIQVR-------------PVKDLKKLEISF 327

Query: 322 PIHHRLTRLTKKEIDLLSQCWCELFGDESEGSLCHFMKKNDYITELTAFMSHFAVNDNAL 381
            +         +   +LS     L G E  GSL   +KK  +  EL+A   H     NA 
Sbjct: 328 AVPDMEEHWESRPPRILSH----LIGHEGSGSLLAHLKKLGWANELSA-GGHTVSKGNAF 382

Query: 382 I-LELYLTNTGWKNLQMIVAVFFNKYVPIVIECGTYELAEFLSELNCIELLKFLYQDV-- 438
             +++ LT+ G  + + ++ + F +Y+ ++    +       +EL  I    F ++ V  
Sbjct: 383 FAVDIDLTDNGLIHYRDVIILIF-QYIEML--KNSLPQKWIFNELQDISNATFKFKQVGR 439

Query: 439 ---TLSSMEEC 446
              T+SS+ +C
Sbjct: 440 PSSTVSSLAKC 450

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 71/356 (19%), Positives = 137/356 (38%), Gaps = 24/356 (6%)

Query: 616 PKLLGKNCFYEMWVKEEDFELTFKSKSIVTFEIISTHLNPEPSYTMMLEILCELLGDMLS 675
           P LL  +    +W K++D     +    ++F++  TH +   S  M+  +  +L+ D L 
Sbjct: 558 PILLLSDGGSRLWYKKDDRFWQPRGYIYLSFKLPHTHASIVNS--MLSTLYIQLVNDALK 615

Query: 676 SQLYPSEKIGYTYEIAASSKGDVRIGFTVSGFSEGVYKIIEKIVG--TLVQIVYSEVVIA 733
              Y +         + +++G   +  T SGF+E +  ++ + +   T  +       I 
Sbjct: 616 DLQYDAACADLRISFSKTNQG---LDITASGFNEKLIILLTRFLQGVTSFEPKKDRFEIL 672

Query: 734 RDLFRKSRIAVRNKYEEAASVNSTTLVNIGLLIVLEKYMWRLESRLEALESTDMESFKQF 793
           +D   K+   ++N   E      +   N     ++ +  W    +L+  E    E    F
Sbjct: 673 KD---KTIRHLKNLLYEVPYSQMSNYYNA----LINERSWSTVEKLQVFEKLTFEQLINF 725

Query: 794 LSDFFGNSTYMNLFIQGDQTYTDQINIFLDRNLTGHLSKKRDAVKILNEPTSTILKPGSN 853
           +   +    +    I G+  + + + +  D  +   ++   + +++ N    + L P   
Sbjct: 726 IPTIY-EGVFFETLIHGNIKHEEAVEV--DSLIKSLITNNINNLQVANNRLRSYLLPKGK 782

Query: 854 LFITHKGFKDDPN-NSIVYFIQTGDRTDNYSYTLTAFTAFLISLTLVP---DLRGRKQVG 909
            F      KD  N NS    IQ   + D YS  L+A +     L   P    LR ++Q+G
Sbjct: 783 SFRYETALKDSQNVNSC---IQHVTQLDVYSEELSALSGLFAQLIHEPCFDTLRTKEQLG 839

Query: 910 YIVLGGLRTLSSTVGLHITITSSSPPHFLEEKIGEYLSYLEKDLLDNLKPQLFREK 965
           Y+V         T  + I I S     +LE +I  +     + L D  K    + K
Sbjct: 840 YVVFSSSLNNHGTANIRILIQSEHTTPYLEWRINNFYETFGQILRDMTKEDFEKHK 895

>Suva_10.506 Chr10 complement(865239..868310) [3072 bp, 1023 aa]
           {ON} YLR389C (REAL)
          Length = 1023

 Score =  162 bits (411), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 90/239 (37%), Positives = 136/239 (56%), Gaps = 8/239 (3%)

Query: 7   RNFDVQFYTPISCSSRSHRVIQLDNGMLVLLISNPAEKATSCALSVATGSHNDPKEILGL 66
           + FD+ F  P     RS+R I+L N +  LLI +P     + +L V  G+  DP+ + GL
Sbjct: 59  KTFDLDFLKP-DLDERSYRFIELPNKLKALLIQDPKADKAAASLDVNVGAFEDPENLPGL 117

Query: 67  AHFCEHMILSAGSKSYPDPNAYHDVISKNGGSQNAFTTGEQTTFCFELPNLSNSDELVFD 126
           AHFCEH++   GS+ +PD N Y   +SK+GGS NA+T  + T + FE+    N   L+  
Sbjct: 118 AHFCEHLLF-MGSEKFPDENEYSSYLSKHGGSSNAYTASQNTNYFFEV----NHQHLL-- 170

Query: 127 KVLDIFSSSFKKPLFNELLVNKEIYAINSEHTANKSSRDKIFYHATRLLANGDHPFSQFS 186
             LD FS  F  PLF +   +KEI A+NSE+  N  +     Y   + L N  HP+ +FS
Sbjct: 171 GALDRFSGFFSCPLFQKDSTDKEINAVNSENKKNLQNDIWRIYQLDKSLTNSKHPYHKFS 230

Query: 187 TGDITTLSDILQLNKVDLRTEVIKYFKNNFYAENMCLCIKGPQSLNTLGKLVFSKFNDI 245
           TG+I TL +  + N +++R E++K+ K+ + A  M LCI G + L+TL +  +  F D+
Sbjct: 231 TGNIETLGESPKENGLNIRDELLKFHKHFYSANIMKLCILGREDLDTLSEWTYDLFKDV 289

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 71/343 (20%), Positives = 133/343 (38%), Gaps = 18/343 (5%)

Query: 616 PKLLGKNCFYEMWVKEEDFELTFKSKSIVTFEIISTHLNPEPSYTMMLEILCELLGDMLS 675
           P LL  +    +W K++D     +    ++F++  TH +   S  M+  +  +++ D L 
Sbjct: 559 PMLLLSSGMSRLWYKKDDRFWQPRGYIYLSFKLPHTHASVINS--MLSTLYIQMINDALK 616

Query: 676 SQLYPSEKIGYTYEIAASSKGDVRIGFTVSGFSEGVYKIIEKIVGTLVQIVYSEVVIARD 735
              Y +           +++G   +  T SGF+E   K+I  +   L  +V  E    R 
Sbjct: 617 DLQYDAACADLRISFVKTNQG---LDITASGFNE---KLIVLLTRFLQGVVSFEPKKDRF 670

Query: 736 LFRKSRIAVRNKYEEAASVNSTTLVNIGLLIVLEKYMWRLESRLEALESTDMESFKQFLS 795
              K +  +R+       V  + + N    ++ E+  W    +L+  E    E    F+ 
Sbjct: 671 EILKDK-TIRHLKNLLYEVPYSQMSNYYNSLINER-SWSTAEKLQVFEKLTFEQLNSFIP 728

Query: 796 DFFGNSTYMNLFIQGDQTYTDQINIFLDRNLTGHLSKKRDAVKILNEPTSTILKPGSNLF 855
             +    +    + G+  + + I +  D  +   ++   D +++ N    + L P    F
Sbjct: 729 TIY-EGVFFETLVHGNIKHEEAIEV--DSLIKSLIANNIDNLQVSNNRLRSYLLPKGKSF 785

Query: 856 ITHKGFKDDPNNSIVYFIQTGDRTDNYSYTLTAFTAFLISLTLVP---DLRGRKQVGYIV 912
                 KD  N  +   IQ   + D YS  L+A +     L   P    LR ++Q+GY+V
Sbjct: 786 RYETDLKDPKN--VNSCIQHVTQLDVYSEELSALSGLFAQLIHEPCFDTLRTKEQLGYVV 843

Query: 913 LGGLRTLSSTVGLHITITSSSPPHFLEEKIGEYLSYLEKDLLD 955
                    T  + I I S     +LE +I  +     + L D
Sbjct: 844 FSSSLNNHGTANIRILIQSEHTTPYLEWRINNFYETFGQHLKD 886

>Kpol_1055.83 s1055 (216511..219573) [3063 bp, 1020 aa] {ON}
           (216511..219573) [3063 nt, 1021 aa]
          Length = 1020

 Score =  159 bits (402), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 119/395 (30%), Positives = 190/395 (48%), Gaps = 51/395 (12%)

Query: 10  DVQFYTPISCSSRSHRVIQLDNGMLVLLISNPAEKATSCALSVATGSHNDPKEILGLAHF 69
           D+ F  P     RS+R I+L N    LLI + +   ++ +L V  G+  DPK + GLAHF
Sbjct: 62  DLNFIKP-DLDDRSYRFIELPNKFKALLIHDASTDKSAASLDVNIGAFQDPKNLQGLAHF 120

Query: 70  CEHMILSAGSKSYPDPNAYHDVISKNGGSQNAFTTGEQTTFCFELPNLSNSDELVFDKVL 129
           CEH++   GSK +P+ N Y   ++K+GGS NA+T  + T + FE+    N + L     L
Sbjct: 121 CEHLLF-MGSKKFPNENEYSSYLNKHGGSSNAYTGAQNTNYFFEI----NHEHL--HGAL 173

Query: 130 DIFSSSFKKPLFNELLVNKEIYAINSEHTANKSSRDKIFYHATRLLANGDHPFSQFSTGD 189
           D FS  F  PLFN    +KEI A++SE+  N  +     Y   + L+N  HP+ +FSTG+
Sbjct: 174 DRFSGFFTCPLFNPNSTSKEINAVDSENKKNLQNDVWRMYQLDKSLSNEKHPYHKFSTGN 233

Query: 190 ITTLSDILQLNKVDLRTEVIKYFKNNFYAENMCLCIKGPQSLNTLGKLVFSKFNDIKGLP 249
           + TL ++ +   +D+R E++K++ +++ A  M LC+ G + L+T+   V++ F  +    
Sbjct: 234 LKTLDEMPKKEGLDIRNELLKFYSDSYSANLMKLCVLGREDLDTMSDWVYNLFEAVPN-- 291

Query: 250 ISRPLRTKNQPWLKLKSRNFSNDGFGLGLESFKILSRNWLQKYGNVGIFTGCDNHNTVLV 309
            +RPL   N+P                      IL    L+K  +V              
Sbjct: 292 NNRPLPEYNEP----------------------ILLEENLKKIIHVKPV----------- 318

Query: 310 DSQKLPALRLIFPIHHRLTRLTKKEIDLLSQCWCELFGDESEGSLCHFMKKNDYITELTA 369
             + L  L + F           K   +LS     L G E  GS+   +K   +  EL+A
Sbjct: 319 --KDLKKLEITFLAQDMDLFWESKPQHILSH----LIGHEGSGSILSHLKTLSWANELSA 372

Query: 370 FMSHFAVNDNALI-LELYLTNTGWKNLQMIVAVFF 403
              H    DNA   +++ LT  G+++ + IV + F
Sbjct: 373 -GGHTVSKDNAFFSIDIDLTENGFQHYKEIVHIVF 406

 Score = 45.8 bits (107), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 63/340 (18%), Positives = 141/340 (41%), Gaps = 24/340 (7%)

Query: 612 PHVLPKLLGKNCFYEMWVKEEDFELTFKSKSIVTFEIISTHLNPEPSYTMMLEILCELLG 671
           P V P LL  +   ++W K++D    ++ +  +   +   H        ++  +  +L+ 
Sbjct: 555 PLVEPLLLKDSPVSKLWYKKDD--RFWQPRGFIYITMKLPHTQASVINNLLTSLYVQLVN 612

Query: 672 DMLSSQLYPSEKIGYTYEIAASSKGDVRIGFTVSGFSEGVYKIIEKIVGTLVQIVYSEVV 731
           D L    Y +         + +++G   +  T+SGF++ +  ++++ +  +   VY    
Sbjct: 613 DSLKDLQYDAACANLHLSFSKTNQG---LDITISGFNDKLIVLLQRFIYGVS--VYQPSK 667

Query: 732 IARDLFRKSRIA-VRNKYEEAASVNSTTLVNIGLLIVLEKYMWRLESRLEALESTDMESF 790
           +   +F++  I  ++N   E      +TL +     ++ +  W ++ +L  +E    E F
Sbjct: 668 LRFKIFKEKTIQNLKNCLYEVPYSQISTLYSS----LINERTWSVKQKLSIIEKITYEQF 723

Query: 791 KQFLSDFFGNSTYMNLFIQGDQTYTDQINIFLDRNLTGHLSKKRDAVKILNEPTSTILKP 850
             FL   +    Y +  + G+  + ++  + +D  +   ++     + + N    + + P
Sbjct: 724 LAFLPTIY-EECYFDGLVHGN--FRNEEAVEIDSLVQSLITTDIVNLHVKNTRLRSYVIP 780

Query: 851 GSNLFITHKGFKDDPN-NSIV-YFIQTGDRTDNYSYTLTAFTAFLISLTLVP---DLRGR 905
               +      +D  N NS V + +Q G     YS  L+A +     +   P    LR +
Sbjct: 781 NGETYRFEIDLEDAENVNSCVQHVVQLG----GYSEELSAMSGLFAQILNEPCFDTLRTK 836

Query: 906 KQVGYIVLGGLRTLSSTVGLHITITSSSPPHFLEEKIGEY 945
           +Q+GY+V         T  + I + S     +LE +I E+
Sbjct: 837 EQLGYVVFSSSLNNHGTANIRILVQSEHSTPYLEWRIDEF 876

>AER053C Chr5 complement(735402..738443) [3042 bp, 1013 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR389C
           (STE23)
          Length = 1013

 Score =  149 bits (377), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 84/241 (34%), Positives = 134/241 (55%), Gaps = 8/241 (3%)

Query: 5   GVRNFDVQFYTPISCSSRSHRVIQLDNGMLVLLISNPAEKATSCALSVATGSHNDPKEIL 64
           G+R        P+    R +R I+L N + VLL+ +     ++ +L V  G+  DP+++ 
Sbjct: 51  GLRELAATLEQPL-LDDRKYRYIELPNHLRVLLVHDKNTDKSAASLDVNVGAFEDPEDLP 109

Query: 65  GLAHFCEHMILSAGSKSYPDPNAYHDVISKNGGSQNAFTTGEQTTFCFELPNLSNSDELV 124
           GLAHFCEH++   GSK +P+ N Y   +SK+GG+ NA+T  + T + F +     + E +
Sbjct: 110 GLAHFCEHLLF-MGSKKFPNENEYASFLSKHGGASNAYTASQNTNYYFHV-----NHENL 163

Query: 125 FDKVLDIFSSSFKKPLFNELLVNKEIYAINSEHTANKSSRDKIFYHATRLLANGDHPFSQ 184
           +D  LD FS  F  PLFNE    KEI A++SE+  N  +     Y   + L N  HP+ +
Sbjct: 164 YD-ALDRFSGFFSCPLFNESSTEKEIKAVDSENKKNLQNDMWRLYQLGKSLTNPIHPYHK 222

Query: 185 FSTGDITTLSDILQLNKVDLRTEVIKYFKNNFYAENMCLCIKGPQSLNTLGKLVFSKFND 244
           FSTG+  TL  I +   V++R E++K++  ++ A  M L I G + L+TL +  +  F D
Sbjct: 223 FSTGNFETLWSIPRSKGVNVRDELLKFYNRSYSANLMKLVILGREDLDTLAQWAYELFKD 282

Query: 245 I 245
           +
Sbjct: 283 V 283

 Score = 48.9 bits (115), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 72/351 (20%), Positives = 143/351 (40%), Gaps = 46/351 (13%)

Query: 609 NANPHVLPKLLGKNCFYEMWVKEEDFELTFKSKSIVTFEIISTHLNPEPSYTMMLEILCE 668
           N  P + P LL  +   ++W K++D     K    ++ ++  TH +   S  M+  +  +
Sbjct: 547 NVKPLLEPFLLRDDRCGKLWYKKDDMFWVPKGYIYISMKLPHTHSSIVNS--MLCTLYVD 604

Query: 669 LLGDMLSSQLYPSEKIGYTYEIAASSKGDVRIGFTVSGFSEGVYKIIEKIVGTLVQIVYS 728
            + D L    Y +E  G    +  +++G   +  ++SG+++ +  ++ +    + ++   
Sbjct: 605 HINDSLKDLAYNAECAGLEISLRKTNQG---LDLSLSGYNDKLLVLLARFFEGIQKLFLR 661

Query: 729 E---VVIARDLFRKSRIAVRNKYEEAASVNSTTLVNIGLLI--VLEKYMWRLESRLEALE 783
           E   +V+ + L +K    + N       +  T    IG L   ++ +  W  + +L+  E
Sbjct: 662 EERFMVLKQRLIQK----LHNH------LYDTPYTQIGRLYSSLINERSWTTQEKLDITE 711

Query: 784 STDMESFKQFLSDFFGNSTYMNLFIQGDQTYTDQINIF---------LDRNLTGHLSKKR 834
               +    F+   +    Y  L + G+ ++ + + ++           RN  G  SK R
Sbjct: 712 QLTFDHLANFVPTIY-EQMYFELLVHGNFSHEEALEVYDLVSSLVPNEIRNSEGRNSKLR 770

Query: 835 DAVKILNEPTSTILKPGSNLFITHKGFKDDPNNSIVYFIQTGDRTDNYSYTLTAFTAFLI 894
                    +  I   G+  + T    K++ N+ I   IQ G     YS  L+A  + L 
Sbjct: 771 ---------SYFIPAGGAYHYETALADKENVNSCIQKVIQLGA----YSELLSAKGSLLA 817

Query: 895 SLTLVP---DLRGRKQVGYIVLGGLRTLSSTVGLHITITSSSPPHFLEEKI 942
            +   P    LR  +Q+GY+V         TV L I + S     +LE +I
Sbjct: 818 QMVNEPCFNTLRTEEQLGYVVFSSKLNTHGTVNLRILVQSERSSSYLESRI 868

>Ecym_3273 Chr3 (515048..518119) [3072 bp, 1023 aa] {ON} similar to
           Ashbya gossypii AER053C
          Length = 1023

 Score =  149 bits (376), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 224/997 (22%), Positives = 394/997 (39%), Gaps = 169/997 (16%)

Query: 2   SSFGVRNFDVQFYTPISCSSRSHRVIQLDNGMLVLLISNPAEKATSCALSVATGSHNDPK 61
           S  G +     F  P     R++R IQL N + V LI + +    + AL V  G   DP+
Sbjct: 59  SDLGYKILASSFEKP-ELDDRNYRYIQLPNRLKVFLIQDKSTDKAAAALDVNVGFFQDPE 117

Query: 62  EILGLAHFCEHMILSAGSKSYPDPNAYHDVISKNGGSQNAFTTGEQTTFCFELPNLSNSD 121
           ++ GLAHFCEH++   GS+ +P+ N Y   +S +GG+ NA+T+ + T + F + N  N  
Sbjct: 118 DLPGLAHFCEHLLF-MGSEKFPNENEYSSYLSHHGGASNAYTSTQNTNYYF-MVNHGN-- 173

Query: 122 ELVFDKVLDIFSSSFKKPLFNELLVNKEIYAINSEHTANKSSRDKIFYHATRLLANGDHP 181
             ++D  LD FS  F  PLF+    NKE+ A++SE+  N  S         R L N  HP
Sbjct: 174 --LYD-ALDRFSGFFTSPLFSVSSTNKEVNAVDSENKKNLQSDLWRMQQLDRSLTNPGHP 230

Query: 182 FSQFSTGDITTLSDILQLNKVDLRTEVIKYFKNNFYAENMCLCIKGPQSLNTLGKLVFSK 241
           F +FSTG+  TL    +   +++R E++K++   + A  M L I G + L+TL    +  
Sbjct: 231 FHKFSTGNYQTLYKEPKSRGIEIREELLKFYDKTYSANLMRLVILGMEDLDTLSAWAYEL 290

Query: 242 FNDIKGLPISRPLRTKNQPWLKLKSRNFSNDGFGLGLESFKILSRNWLQKYGNVGIFTGC 301
           F D+                         + G  +   + K+ +  +L K          
Sbjct: 291 FKDV------------------------PDKGIDVHEYNAKVFTPTYLTK---------- 316

Query: 302 DNHNTVLVDSQKLPALRLI---FPIHHRLTRLTKKEIDLLSQCWCELFGDESEGSLCHFM 358
                 ++ ++ +  L+ +   F +    T    +  D +S     L G ES  SL  ++
Sbjct: 317 ------IIKAKPIKDLKRVEVSFDVPDTETFWDSRPADYISH----LIGHESSNSLLSYL 366

Query: 359 KKNDYITELTAFMSHFAVNDNALILELYLTNTGWKNLQMIVAVFFNKYVPIVIECGTYEL 418
               + TEL       +  +    + + LT+ G ++ + +V   F +Y+ ++ +    E 
Sbjct: 367 ISQSWATELYCGAQTVSKGNAYFCIHIELTDKGVQDYEEVVYTVF-QYIEMLKKSLPQE- 424

Query: 419 AEFLSELNCIELLKFLYQDV-----TLSSMEECSNLSSLLLTDIESLGPSFILKGNPMND 473
                ELN I   KF ++       T+SS+    NL    L        S I K  P   
Sbjct: 425 -RIFVELNKIGESKFRFKQKGSPSNTVSSL--AKNLQKDFLPPEIIFNASLIRKFKP--- 478

Query: 474 CNEIDSELGSFAESEESRMWWIGHAIKFQSFIKEFINFENVRLVLMGDLKECPLMKTDLT 533
             E+     S  + + SR+  I  ++                              T+LT
Sbjct: 479 --ELIMSFLSHLQPKNSRISLISRSV-----------------------------TTNLT 507

Query: 534 SLKLNIEPYYEFEYHKCRSDQSNF-KLTVEEISYSFHIPYKNVFLPSVGFNLSLIKNALL 592
                 E +Y  EY     D+    KL   E++ S  +P  N+F+P+   N  + K   +
Sbjct: 508 ------ERWYGTEYAVEDYDKELLKKLEAPELNPSLQLPTPNMFIPT---NFDVNKQEDV 558

Query: 593 ASSNRSQTAALSLGSQNANPHVLPKLLGKNCFYEMWVKEEDFELTFKSKSIVTFEIISTH 652
                                       ++C   +W K++D     +    V+F++   H
Sbjct: 559 KPLLEPLLLKED----------------RSC--RLWYKKDDRFWVPEGHVYVSFKL--PH 598

Query: 653 LNPEPSYTMMLEILCELLGDMLSSQLYPSEKIGYTYEIAASSKGDVRIGFTVSGFSEGVY 712
                  +M+  +  E++ D L   LY +E   +      +++G   +  +++G+++ + 
Sbjct: 599 SYSSVVNSMLSTLYVEMVKDSLKDLLYNAECANFEVSFVKTNQG---LDLSLTGYNDKMT 655

Query: 713 KIIEKIVGTLVQIVYSEVVIARDLFRKSRIAVRNKYEEAASVN---STTLVNIGLLI--V 767
            ++  I+         E +   D  +K R  V  K       N   +     IG+L   +
Sbjct: 656 LLLTSIL---------EGIRNFDP-KKERFDVLQKLLCQKLYNRLYNVPYSQIGVLYNSL 705

Query: 768 LEKYMWRLESRLEALESTDMESFKQFLSDFFGNSTYMNLFIQGD--QTYTDQINIF---L 822
           +    W    +L+  +    E FK F+   +    Y    + G+  +    ++N +   L
Sbjct: 706 INDRSWTPSEKLKVTKQLTFEHFKAFVPSIY-EQMYFETLVHGNFPENQAIELNSYICSL 764

Query: 823 DRNLTGHLSKKRDAVKILNEPTSTILKPGSNLFITHKGFKDDPNNSIV-YFIQTGDRTDN 881
             N   H   +       N P S +L  G         F ++  NS     IQ G     
Sbjct: 765 IPNQIKHSGARN------NRPRSYMLPEGKTYRYETTLFDEENVNSCFEMVIQLG----M 814

Query: 882 YSYTLTAFTAFLISLTLVP---DLRGRKQVGYIVLGGLRTLSSTVGLHITITSSSPPHFL 938
           YS  + A  + L  L   P    LR  +Q+GY+V    +   ++  L I + S S   ++
Sbjct: 815 YSEDMNAKGSLLAQLINEPCFNTLRTEEQLGYVVWSSKQNTHASTNLRILVQSESDTVYI 874

Query: 939 EEKIGEYLSYLEKDLLDNLKPQLFREKYVKEYLNVIL 975
           E ++ ++L+    D L ++  Q F EK+     N +L
Sbjct: 875 ESRVDKFLNNF-ADTLRSMSEQAF-EKHKGALCNTLL 909

>TBLA0A08050 Chr1 (1988388..1991375) [2988 bp, 995 aa] {ON}
           Anc_4.246 YLR389C
          Length = 995

 Score =  135 bits (340), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 117/399 (29%), Positives = 187/399 (46%), Gaps = 56/399 (14%)

Query: 16  PISCSSRSHRVIQLD-NGMLVLLISNPAEKATSCALSVATGSHNDPKEILGLAHFCEHMI 74
           PI+   R+++ I+L+ N +  L+I +      + AL V  G+  DP  + GLAHFCEH++
Sbjct: 34  PIT-DERNYQFIKLNKNNLHALIIQDKTTDKAAAALDVNAGAFMDPSNLPGLAHFCEHLL 92

Query: 75  LSAGSKSYPDPNAYHDVISKNGGSQNAFTTGEQTTFCFELPNLSNSDELVFDKVLDIFSS 134
              GSK++P+ N Y   +++NGG  NA+T    T + FE+ N +N  E      L  FS 
Sbjct: 93  F-MGSKNFPNENDYSSYLNQNGGFSNAYTGSMNTNYHFEI-NHANLFE-----ALRRFSC 145

Query: 135 SFKKPLFNELLVNKEIYAINSEHTANKSSRDKIFYHATRLLANGDHPFSQFSTGDITTLS 194
            FK PLFN     KEI+AI+SE+  N  +     Y   + L+N +HP+ +FSTG   TL 
Sbjct: 146 FFKTPLFNNDSTIKEIHAIDSENKKNLQNDYWRLYQLGKSLSNHEHPYHKFSTGSKLTLL 205

Query: 195 DILQLNKVDLRTEVIKYFKNNFYAEN-MCLCIKGPQSLNTLGKLVFSKFNDIKGLPISRP 253
           +  +   +++R E+IK++ N +Y+ N M LCI G + L TL +     F ++    +  P
Sbjct: 206 ENTETLNLNIREELIKFY-NKWYSSNIMNLCIIGREDLGTLSRWAKILFENVPNKNVILP 264

Query: 254 LRTKNQPWLKLKSRNFSNDGFGLGLESFKILSRNWLQKYGNVGIFTGCDNHNTVLVDSQK 313
             T +QP                                    ++T  D    + V   K
Sbjct: 265 --TFSQP------------------------------------VWTIADKKKVISVKPVK 286

Query: 314 -LPALRLIFPIHH-RLTRLTKKEIDLLSQCWCELFGDESEGSLCHFMKKNDYITELTAFM 371
            L  L L F I    LT    K   +LS     LFG +  GS+   +K    IT +++  
Sbjct: 287 DLKQLELTFHIKEDELTTWKSKPSYILSH----LFGHKGNGSISSLLKNQQLITGISSGS 342

Query: 372 SHFAVNDNALILELYLTNTGWKNLQMIVAVFFNKYVPIV 410
            + +  ++   L   LT  G    + I+ + F +Y+ ++
Sbjct: 343 ENISKENSLFSLNFDLTEDGINQYEKIIKIVF-QYIKML 380

 Score = 39.7 bits (91), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 50/200 (25%), Positives = 82/200 (41%), Gaps = 19/200 (9%)

Query: 773 WRLESRLEALESTDMESFKQFLSDFFGNSTYMNLFIQGDQTYTDQINIFLDRNLTGHLSK 832
           W +E  L+ ++  D    + F+   +    +  L     Q    Q    L R L  +  K
Sbjct: 675 WSVEENLKVVQDIDFPQLQDFIPTIYQELFFETLAFGNIQYEQAQEVDSLVRTLIPNTIK 734

Query: 833 KRDAVKILNEPTSTILKPGSNLFITHKGFKDDPNN---SIVYFIQTGDRTDNYSYTLTAF 889
                ++ N+   + + P    F  ++ F+ D NN    I Y  Q G     YS  L A 
Sbjct: 735 NS---QVKNDRLRSYIIPSGKTF-KYEVFQKDKNNLNTCIQYICQFGI----YSEYLAAV 786

Query: 890 TAFLISLTLVP---DLRGRKQVGYIVLGGLRTLSSTVGLHITITSSSPPHFLEEKIGEYL 946
            + L  +   P    LR ++Q+GYIV     +   T  L I + S     +L+ +I  +L
Sbjct: 787 VSLLAQIMHEPCFNTLRTKEQLGYIVFSSSLSNHGTCNLSIMVQSEYSTDYLQFRIENFL 846

Query: 947 SYLEKDLLDNLKPQLFREKY 966
               KD L  LK ++ RE++
Sbjct: 847 ----KDFLSYLK-EMPREEF 861

>KNAG0A02760 Chr1 (301136..302539) [1404 bp, 467 aa] {ON} Anc_8.376
           YLR163C
          Length = 467

 Score = 49.7 bits (117), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 56/237 (23%), Positives = 91/237 (38%), Gaps = 17/237 (7%)

Query: 25  RVIQLDNGMLVLLISNPAEKATSCALSVATGSHNDPKEILGLAHFCEHMILSAGSKSYPD 84
           R   LDNG+ V     P   + +  + V  GS  +  +  G AHF EH+    G+K+   
Sbjct: 30  RTSVLDNGLTVATEFIPNTASATVGIFVDAGSRAENVKNNGTAHFLEHLAFK-GTKNRSQ 88

Query: 85  PNAYHDVISKNGGSQ-NAFTTGEQTTFCFELPNLSNSDELVFDKVLDIFSSSFKKPLFNE 143
                ++  +N GS  NA+T+ E T +       + S      K +DI S    K + + 
Sbjct: 89  RGIELEI--ENIGSHLNAYTSRENTVY------YAKSLREDIPKAVDILSDILTKSVLDP 140

Query: 144 LLVNKEIYAINSEHTANKSSRDKIFYHATRLLANGDHPFSQFSTGDITTLSDILQLNKVD 203
             + +E   I  E        D++ +     +A  D P  +   G I  +  I       
Sbjct: 141 KAIERERDVIIRESEEVDKMYDEVVFDHLHEIAYRDQPLGRTILGPIKNIKSI------- 193

Query: 204 LRTEVIKYFKNNFYAENMCLCIKGPQSLNTLGKLVFSKFNDIKGLPISRPLRTKNQP 260
            RT++  Y   N+  + M L   G    + L       F  +K   +S PL +   P
Sbjct: 194 KRTDLQNYIMTNYKGDRMVLASAGSVDHDNLVAYAQKYFGHLKRSDVSVPLGSPRGP 250

>KLTH0F08954g Chr6 (770605..771981) [1377 bp, 458 aa] {ON} highly
           similar to uniprot|P10507 Saccharomyces cerevisiae
           YLR163C MAS1 Smaller subunit of the mitochondrial
           processing protease essential processing enzyme that
           cleaves the N-terminal targeting sequences from
           mitochondrially imported proteins
          Length = 458

 Score = 48.1 bits (113), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 49/225 (21%), Positives = 85/225 (37%), Gaps = 27/225 (12%)

Query: 9   FDVQFYTPISCSSRSHRVIQLDNGMLVLLISNPAEKATSCALSVATGSHNDPKEILGLAH 68
           F  +F  P++ ++ S R   L NG+ V     P   + +  + V  GS  +     G AH
Sbjct: 7   FGTRFSRPLATAASSTRTSVLRNGLTVATEHIPNTSSATVGIFVDAGSRAENTRNNGTAH 66

Query: 69  FCEHMILSAGSKSYPDPNAYHDVISKNGGSQ-NAFTTGEQT-----TFCFELPNLSNSDE 122
           F EH+    G+K+        ++  +N GS  NA+T+ E T     T    +PN      
Sbjct: 67  FLEHLAFK-GTKNRTQVGIELEI--ENIGSHLNAYTSRENTVYYAKTLTQNIPN------ 117

Query: 123 LVFDKVLDIFSSSFKKPLFNELLVNKEIYAINSEHTANKSSRDKIFYHATRLLANGDHPF 182
                 +D+ S    + + +   + +E   I  E        D++ +     +   D P 
Sbjct: 118 -----AVDVLSDILTRSVLDARAIERERDVIIRESEEVDKMYDEVVFDHLHAITYKDQPL 172

Query: 183 SQFSTGDITTLSDILQLNKVDLRTEVIKYFKNNFYAENMCLCIKG 227
            +   G I  +  I        R ++  Y   N+  + M L   G
Sbjct: 173 GRTILGPIENIKTI-------QRRDLQDYISKNYKGDRMVLAGAG 210

>Kwal_23.3345 s23 (253614..254990) [1377 bp, 458 aa] {ON} YLR163C
           (MAS1) - mitochondrial processing protease subunit
           [contig 252] FULL
          Length = 458

 Score = 46.6 bits (109), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 57/242 (23%), Positives = 90/242 (37%), Gaps = 27/242 (11%)

Query: 25  RVIQLDNGMLVLLISNPAEKATSCALSVATGSHNDPKEILGLAHFCEHMILSAGSKSYPD 84
           R   L NG+ V   + P   + +  + V  GS  +  +  G AHF EH+    G+K+   
Sbjct: 23  RTSVLPNGLTVATEAIPNTSSATVGIFVDAGSRAENSKNNGTAHFLEHLAFK-GTKNRTQ 81

Query: 85  PNAYHDVISKNGGSQ-NAFTTGEQT-----TFCFELPNLSNSDELVFDKVLDIFSSSFKK 138
                ++  +N GS  NA+T+ E T     T    +PN            +DI S    K
Sbjct: 82  VGIEMEI--ENIGSHLNAYTSRENTVYYAKTLTQNIPN-----------AVDILSDILTK 128

Query: 139 PLFNELLVNKEIYAINSEHTANKSSRDKIFYHATRLLANGDHPFSQFSTGDITTLSDILQ 198
            + +   + +E   I  E        D++ +     +   D P  +   G I  +  I Q
Sbjct: 129 SVLDTNAIERERDVIIRESEEVDKMYDEVVFDHLHAITYKDQPLGRTILGPIKNIKTIQQ 188

Query: 199 LNKVDLRTEVIKYFKNNFYAENMCLCIKGPQSLNTLGKLVFSKFNDIKGLPISRPLRTKN 258
               DLR    +Y   N+  + M L   G    + L +     F  I    I  PL +  
Sbjct: 189 R---DLR----EYISTNYKGDRMVLAGAGDVDHDKLVEYAGKYFGHIPKSEIPVPLGSPR 241

Query: 259 QP 260
            P
Sbjct: 242 GP 243

>NDAI0G02320 Chr7 (518661..520052) [1392 bp, 463 aa] {ON} Anc_8.376
           YLR163C
          Length = 463

 Score = 46.2 bits (108), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 53/227 (23%), Positives = 90/227 (39%), Gaps = 23/227 (10%)

Query: 2   SSFGVRNFDVQFYTPISCSSRSHRVIQLDNGMLVLLISNPAEKATSCALSVATGSHNDPK 61
           SS  ++ F  Q  TP      S R   L NG+ V     P   + +  + V  GS  + +
Sbjct: 11  SSTIIKRFLKQAATP------STRTSVLPNGLTVATEWMPNTSSATVGIFVDAGSRAENE 64

Query: 62  EILGLAHFCEHMILSAGSKSYPDPNAYHDVISKNGGSQ-NAFTTGEQTTFCFELPNLSNS 120
           +  G AHF EH+    G+K+        ++  +N GS  NA+T+ E T +       + S
Sbjct: 65  KNNGTAHFLEHLAFK-GTKNRSQKGIELEI--ENIGSHLNAYTSRENTVY------YAKS 115

Query: 121 DELVFDKVLDIFSSSFKKPLFNELLVNKEIYAINSEHTANKSSRDKIFYHATRLLANGDH 180
            +    K +DI S    + + +   + +E   I  E        D++ +     +   D 
Sbjct: 116 LKEDIPKAVDILSDILTRSVLDPEAIERERDVIIRESEEVDKMYDEVVFDHLHEVTYKDQ 175

Query: 181 PFSQFSTGDITTLSDILQLNKVDLRTEVIKYFKNNFYAENMCLCIKG 227
           P  +   G I  +  I        R ++ KY  +N+  + M L   G
Sbjct: 176 PLGRTILGPIKNIQSI-------TRDDLSKYITDNYKGDRMVLAGAG 215

>AGL138C Chr7 complement(453737..455149) [1413 bp, 470 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR163C
           (MAS1)
          Length = 470

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 48/204 (23%), Positives = 82/204 (40%), Gaps = 17/204 (8%)

Query: 25  RVIQLDNGMLVLLISNPAEKATSCALSVATGSHNDPKEILGLAHFCEHMILSAGSKSYPD 84
           R+ QL NG+ V   + P     S  + V  GS  +     G AHF EH+    G+K+   
Sbjct: 30  RISQLPNGLTVASEAMPNTATASVGIFVDAGSRAENVRNNGTAHFLEHLAFK-GTKNRTQ 88

Query: 85  PNAYHDVISKNGGSQ-NAFTTGEQTTFCFELPNLSNSDELVFDKVLDIFSSSFKKPLFNE 143
                ++  +N GS  NA+T+ E T +       + S +    + LD+ S    + + + 
Sbjct: 89  VGIELEI--ENLGSHLNAYTSRENTVY------YAKSLQEDIPRALDVLSDILTRSVLDP 140

Query: 144 LLVNKEIYAINSEHTANKSSRDKIFYHATRLLANGDHPFSQFSTGDITTLSDILQLNKVD 203
             V +E   I  E        D++ +     ++  + P  +   G I  +  I Q    D
Sbjct: 141 KAVERERDVIIRESEEVDKMYDEVVFDHLHAISYENQPLGRTILGPIENIKSIQQR---D 197

Query: 204 LRTEVIKYFKNNFYAENMCLCIKG 227
           L+    +Y   N+  + M L   G
Sbjct: 198 LK----EYISTNYKGDRMALVGAG 217

>KAFR0H02030 Chr8 (374862..376250) [1389 bp, 462 aa] {ON} Anc_8.376
           YLR163C
          Length = 462

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 52/227 (22%), Positives = 87/227 (38%), Gaps = 19/227 (8%)

Query: 1   MSSFGVRNFDVQFYTPISCSSRSHRVIQLDNGMLVLLISNPAEKATSCALSVATGSHNDP 60
           + S G+RN   +  T I  +    R   L NG+ +     P   + +  + V  GS  + 
Sbjct: 6   VKSLGLRNKVARLTTAIPKT----RTSTLPNGLTIATEYIPNTSSATVGIFVDAGSRAEN 61

Query: 61  KEILGLAHFCEHMILSAGSKSYPDPNAYHDVISKNGGSQNAFTTGEQTTFCFELPNLSNS 120
            +  G AHF EH+    G+++     A    I   G   NA+T+ E T +  +  +L N 
Sbjct: 62  VKNNGTAHFLEHLAFK-GTENRSQ-RAIELEIENIGSHLNAYTSRENTVYYAK--SLQND 117

Query: 121 DELVFDKVLDIFSSSFKKPLFNELLVNKEIYAINSEHTANKSSRDKIFYHATRLLANGDH 180
                 K ++I S    K   +   + +E   I  E        D++ +     +A  D 
Sbjct: 118 ----IPKAVEILSDILTKSTLDPRAIERERDVIIRESEEVDKMYDEVVFDHLHDIAYKDQ 173

Query: 181 PFSQFSTGDITTLSDILQLNKVDLRTEVIKYFKNNFYAENMCLCIKG 227
           P  +   G I  +  I        RT++  Y   N+  + M L   G
Sbjct: 174 PLGRTILGPIKNIKSI-------SRTDLKSYINKNYKGDRMVLAGAG 213

>YLR163C Chr12 complement(491866..493254) [1389 bp, 462 aa] {ON}
           MAS1Smaller subunit of the mitochondrial processing
           protease (MPP), essential processing enzyme that cleaves
           the N-terminal targeting sequences from mitochondrially
           imported proteins
          Length = 462

 Score = 42.7 bits (99), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 47/217 (21%), Positives = 84/217 (38%), Gaps = 17/217 (7%)

Query: 12  QFYTPISCSSRSHRVIQLDNGMLVLLISNPAEKATSCALSVATGSHNDPKEILGLAHFCE 71
           +  + IS      R  +L NG+ +     P   + +  + V  GS  +  +  G AHF E
Sbjct: 14  RLLSTISSQIPGTRTSKLPNGLTIATEYIPNTSSATVGIFVDAGSRAENVKNNGTAHFLE 73

Query: 72  HMILSAGSKSYPDPNAYHDVISKNGGSQ-NAFTTGEQTTFCFELPNLSNSDELVFDKVLD 130
           H+    G+++        ++  +N GS  NA+T+ E T +       + S +    K +D
Sbjct: 74  HLAFK-GTQNRSQQGIELEI--ENIGSHLNAYTSRENTVY------YAKSLQEDIPKAVD 124

Query: 131 IFSSSFKKPLFNELLVNKEIYAINSEHTANKSSRDKIFYHATRLLANGDHPFSQFSTGDI 190
           I S    K + +   + +E   I  E        D++ +     +   D P  +   G I
Sbjct: 125 ILSDILTKSVLDNSAIERERDVIIRESEEVDKMYDEVVFDHLHEITYKDQPLGRTILGPI 184

Query: 191 TTLSDILQLNKVDLRTEVIKYFKNNFYAENMCLCIKG 227
             +  I        RT++  Y   N+  + M L   G
Sbjct: 185 KNIKSI-------TRTDLKDYITKNYKGDRMVLAGAG 214

>TBLA0H01010 Chr8 (217060..218559) [1500 bp, 499 aa] {ON} Anc_8.376
           YLR163C
          Length = 499

 Score = 42.0 bits (97), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 54/232 (23%), Positives = 86/232 (37%), Gaps = 25/232 (10%)

Query: 29  LDNGMLVLLISNPAEKATSCALSVATGSHNDPKEILGLAHFCEHMILSA-GSKSYPDPNA 87
           L NG+ V     P     S  + V  GS  +  +  G AHF EH+      ++S  D   
Sbjct: 65  LSNGLTVASEYIPNTSTASIGIYVDAGSRAENSKNNGTAHFLEHLAFKGTTTRSQRD--- 121

Query: 88  YHDVISKNGGSQNAFTTGEQTTFCFEL--PNLSNSDELVFDKVLDIFSSSFKKPLFNELL 145
              VI   G   NA+T+ E T +  +    N+ N+        +DI S    K   ++  
Sbjct: 122 IELVIENLGSHLNAYTSRENTVYYAKTLKDNIPNA--------IDILSDILTKSTLDKNA 173

Query: 146 VNKEIYAINSEHTANKSSRDKIFYHATRLLANGDHPFSQFSTGDITTLSDILQLNKVDLR 205
           + +E   I  E        D++ +     +   D P  +      T L  I  +N +  R
Sbjct: 174 IERERSVIIRESEEVDQMYDEVVFDHLHEIVYKDQPLGR------TILGPIKNINTIQ-R 226

Query: 206 TEVIKYFKNNFYAENMCLCIKGPQSLNTLGKLVFSKFNDIKG----LPISRP 253
            ++  Y   N+  + M L   G  +   L K     F  +K     LP+  P
Sbjct: 227 NDLQNYITTNYKGDRMVLAGAGDVNHEELVKYAEKYFGHVKKSDSPLPLGSP 278

>Smik_12.225 Chr12 complement(439006..440394) [1389 bp, 462 aa] {ON}
           YLR163C (REAL)
          Length = 462

 Score = 42.0 bits (97), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 45/204 (22%), Positives = 80/204 (39%), Gaps = 17/204 (8%)

Query: 25  RVIQLDNGMLVLLISNPAEKATSCALSVATGSHNDPKEILGLAHFCEHMILSAGSKSYPD 84
           R  +L NG+ +     P   + +  + V  GS  +  +  G AHF EH+    G+++   
Sbjct: 27  RTSKLPNGLTIATEYIPNTSSATVGIFVDAGSRAENLKNNGTAHFLEHLAFK-GTQNRSQ 85

Query: 85  PNAYHDVISKNGGSQ-NAFTTGEQTTFCFELPNLSNSDELVFDKVLDIFSSSFKKPLFNE 143
                ++  +N GS  NA+T+ E T +       + S E    K +DI S    K + + 
Sbjct: 86  QGIELEI--ENIGSHLNAYTSRENTVY------YAKSLEEDIPKAVDILSDILTKSVLDS 137

Query: 144 LLVNKEIYAINSEHTANKSSRDKIFYHATRLLANGDHPFSQFSTGDITTLSDILQLNKVD 203
             + +E   I  E        D++ +     +   D P  +   G I  +  I       
Sbjct: 138 NAIERERDVIIRESEEVDKMYDEVVFDHLHEITYKDQPLGRTILGPIKNIKSI------- 190

Query: 204 LRTEVIKYFKNNFYAENMCLCIKG 227
            R+++  Y   N+  + M L   G
Sbjct: 191 TRSDLKDYITKNYKGDRMVLAGAG 214

>NCAS0C02970 Chr3 (558478..559863) [1386 bp, 461 aa] {ON} Anc_8.376
          Length = 461

 Score = 41.6 bits (96), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 48/211 (22%), Positives = 84/211 (39%), Gaps = 17/211 (8%)

Query: 18  SCSSRSHRVIQLDNGMLVLLISNPAEKATSCALSVATGSHNDPKEILGLAHFCEHMILSA 77
           + S  + R   L NG+ V     P   + +  + V  GS  +  +  G AHF EH+    
Sbjct: 19  AASIPTTRTSILPNGLTVATELIPNTSSATVGIFVDAGSRAENVKNNGTAHFLEHLAFK- 77

Query: 78  GSKSYPDPNAYHDVISKNGGSQ-NAFTTGEQTTFCFELPNLSNSDELVFDKVLDIFSSSF 136
           G+++        ++  +N GS  NA+T+ E T +       + S +    K +DI S   
Sbjct: 78  GTQNRSQKGIELEI--ENIGSHLNAYTSRENTVYY------AKSLKEDIPKAVDILSDIL 129

Query: 137 KKPLFNELLVNKEIYAINSEHTANKSSRDKIFYHATRLLANGDHPFSQFSTGDITTLSDI 196
            K + +   + +E   I  E        D++ +     +   D P  +   G I    +I
Sbjct: 130 TKSVLDPRAIERERDVIIRESEEVDKMHDEVVFDHLHAITYKDQPLGRTILGPI---KNI 186

Query: 197 LQLNKVDLRTEVIKYFKNNFYAENMCLCIKG 227
             + + DLR    +Y   N+  + M L   G
Sbjct: 187 KSITRNDLR----EYITKNYKGDRMVLAGAG 213

>TPHA0C02450 Chr3 (545815..547224) [1410 bp, 469 aa] {ON} Anc_8.376
           YLR163C
          Length = 469

 Score = 40.8 bits (94), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 50/217 (23%), Positives = 84/217 (38%), Gaps = 15/217 (6%)

Query: 26  VIQLDNGMLVLLISNPAEKATSCALSVATGSHNDPKEILGLAHFCEHMILSAGSKSYPDP 85
           + +L NG+ V     P     +  + V  GS  +  +  G AHF EH+     SK     
Sbjct: 29  ISKLSNGLTVATEYMPNTSTATVGIYVNAGSRAENVKNNGTAHFLEHLAFKGTSKRSQKQ 88

Query: 86  NAYHDVISKNGGSQNAFTTGEQTTFCFELPNLSNSDELVFDKVLDIFSSSFKKPLFNELL 145
                 I   G   NA+T+ E T +  +   L  +  L  D + DI ++S  K   N + 
Sbjct: 89  IELD--IENIGSHLNAYTSRENTVYYAK--TLKENLPLAVDILSDILTNS--KLEKNAIE 142

Query: 146 VNKEIYAINSEHTANKSSRDKIFYHATRLLANGDHPFSQFSTGDITTLSDILQLNKVDLR 205
             +++    SE        D++ +     +A  D P  +   G I  +  I        R
Sbjct: 143 RERDVIVRESEEV--DKMYDEVVFDHLHEIAYKDQPLGRTILGPIKNIKSI-------NR 193

Query: 206 TEVIKYFKNNFYAENMCLCIKGPQSLNTLGKLVFSKF 242
           ++++ Y  +N+  + M L   G  +   L KL    F
Sbjct: 194 SDLVHYITSNYKGDRMVLAGAGDINHQDLIKLAEKYF 230

>NCAS0C04950 Chr3 complement(1009698..1012796) [3099 bp, 1032 aa]
           {ON} Anc_3.93
          Length = 1032

 Score = 40.4 bits (93), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 55/220 (25%), Positives = 92/220 (41%), Gaps = 31/220 (14%)

Query: 25  RVIQLDNGMLVLLISNPAEKATSCALSVATGSHNDPKEILGLAHFCEHMILSAGSKSYPD 84
           + I    G+ ++ + + +        +V T   ND     G+ H  EH+I   GSK +P 
Sbjct: 21  KYISPRTGLQLVHVDHKSSPLVQGYFAVGTECPNDS----GVPHTLEHLIF-MGSKQHPY 75

Query: 85  PNAYHDVISKNGGSQNAFTTGEQTTFCFELPNLSNSDELVFDKVLDIFSSSFKKPLFNEL 144
                 V +    S NA+T  +QT +      L+++    F K+L  + +    P   + 
Sbjct: 76  KGLLDTVGNLCMSSTNAWTATDQTVY-----TLTSAGWKGFSKILPAYLNHILFPTLTDD 130

Query: 145 LVNKEIYAINSEHTANK----SSRDKIFYHA--TRLLANGDHPFSQFS-----TGDITTL 193
               E+Y ++ E  ++K    S  + I   +    +L      F + S     TG +T  
Sbjct: 131 ACTTEVYHVDPEDLSDKGVVFSEMEAIESQSWFVTMLEKQRLMFPRGSGYRSETGGLTN- 189

Query: 194 SDILQLNKVDLRTEVIKYF-KNNFYAENMCLCIKG--PQS 230
                 N  DL  E IK F K N+ ++N+CL I G  P+S
Sbjct: 190 ------NLRDLTNEEIKEFHKANYSSDNLCLIICGNVPES 223

>Ecym_4191 Chr4 (396094..397482) [1389 bp, 462 aa] {ON} similar to
           Ashbya gossypii AGL138C
          Length = 462

 Score = 40.0 bits (92), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 50/237 (21%), Positives = 87/237 (36%), Gaps = 17/237 (7%)

Query: 25  RVIQLDNGMLVLLISNPAEKATSCALSVATGSHNDPKEILGLAHFCEHMILSAGSKSYPD 84
           ++ QL NG+ V     P     +  + V  GS  +     G AHF EH+    G+ +   
Sbjct: 26  QISQLSNGITVASEVLPNTSTATVGIFVDAGSRAENSRNNGTAHFLEHLAFK-GTTNRSQ 84

Query: 85  PNAYHDVISKNGGSQ-NAFTTGEQTTFCFELPNLSNSDELVFDKVLDIFSSSFKKPLFNE 143
                ++  +N GS  NA+T+ E T +       + S +    K +DI S    +   N 
Sbjct: 85  VGIELEI--ENIGSHLNAYTSRENTVY------YAKSLKEDIPKAMDILSDILTRSTLNP 136

Query: 144 LLVNKEIYAINSEHTANKSSRDKIFYHATRLLANGDHPFSQFSTGDITTLSDILQLNKVD 203
             + +E   I  E        D++ +     +   D    +   G I  +  I       
Sbjct: 137 KAIERERDVIIRESEEVDKMYDEVVFDHLHAITYKDQALGRTILGPIENIKSI------- 189

Query: 204 LRTEVIKYFKNNFYAENMCLCIKGPQSLNTLGKLVFSKFNDIKGLPISRPLRTKNQP 260
            R ++ +Y   N+  + M L   G    + L +     F  I+   +  PL +   P
Sbjct: 190 QRKDLAEYISTNYTGDRMALVGAGSVDHDKLVEYGERYFGHIRKSAVPVPLGSPRGP 246

>TDEL0F05000 Chr6 complement(942516..943886) [1371 bp, 456 aa] {ON}
           Anc_8.376 YLR163C
          Length = 456

 Score = 39.7 bits (91), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 51/237 (21%), Positives = 89/237 (37%), Gaps = 17/237 (7%)

Query: 25  RVIQLDNGMLVLLISNPAEKATSCALSVATGSHNDPKEILGLAHFCEHMILSAGSKSYPD 84
           R   L+NG+ V     P     +  + V  GS  + ++  G AHF EH+    G+K    
Sbjct: 21  RTSVLNNGLTVATERIPEMSTATVGIFVDAGSRAENEKNNGTAHFLEHLAFK-GTKDRTQ 79

Query: 85  PNAYHDVISKNGGSQ-NAFTTGEQTTFCFELPNLSNSDELVFDKVLDIFSSSFKKPLFNE 143
                ++  +N GS  NA+T+ E T +  +    S  D++   + +DI S    + + + 
Sbjct: 80  SGIELEI--ENIGSHLNAYTSRENTVYYAK----SLRDDI--PRAVDILSDILTRSVLDP 131

Query: 144 LLVNKEIYAINSEHTANKSSRDKIFYHATRLLANGDHPFSQFSTGDITTLSDILQLNKVD 203
             + +E   I  E        D++ +     +A  D    +   G +  +  I       
Sbjct: 132 RAIERERDVIIRESEEVDKMYDEVVFDHLHEIAYKDQSLGRTILGPVKNIKSI------- 184

Query: 204 LRTEVIKYFKNNFYAENMCLCIKGPQSLNTLGKLVFSKFNDIKGLPISRPLRTKNQP 260
            R ++  Y   N+  + M L   G    + L K     F  I       PL +   P
Sbjct: 185 TRKDLKDYITKNYKGDRMVLAGAGAVDHDDLVKQAERFFGHIPKSEFPVPLGSPRGP 241

>KLLA0D18095g Chr4 complement(1526808..1528217) [1410 bp, 469 aa]
           {ON} highly similar to uniprot|P10507 Saccharomyces
           cerevisiae YLR163C MAS1 Smaller subunit of the
           mitochondrial processing protease essential processing
           enzyme that cleaves the N-terminal targeting sequences
           from mitochondrially imported proteins
          Length = 469

 Score = 38.9 bits (89), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 48/243 (19%), Positives = 97/243 (39%), Gaps = 18/243 (7%)

Query: 19  CSSRSHRVIQLDNGMLVLLISNPAEKATSCALSVATGSHNDPKEILGLAHFCEHMILSAG 78
           C S++   + L NG+ V   S P     +  + V TGS  + ++  G AHF EH+    G
Sbjct: 29  CLSKTATSV-LPNGLTVASESLPNTNTATVGIFVDTGSRAENEKNNGTAHFLEHLAFK-G 86

Query: 79  SKSYPDPNAYHDVISKNGGSQ-NAFTTGEQTTFCFELPNLSNSDELVFDKVLDIFSSSFK 137
           +++        ++  +N GS  NA+T+ E T +       + S +    K +DI +    
Sbjct: 87  TQNRSQTGIELEI--ENIGSHLNAYTSRENTVY------YAKSLKQDIPKAVDILADILT 138

Query: 138 KPLFNELLVNKEIYAINSEHTANKSSRDKIFYHATRLLANGDHPFSQFSTGDITTLSDIL 197
           + + +   + +E   I  E        D++ +     +   + P  +   G I  +  I 
Sbjct: 139 RSVLDPKAIERERDVIIRESEEVDKMYDEVVFDHLHTITYKNQPLGRTILGPIKNIKSI- 197

Query: 198 QLNKVDLRTEVIKYFKNNFYAENMCLCIKGPQSLNTLGKLVFSKFNDIKGLPISRPLRTK 257
                  R+++ ++ + ++  + M L   G    + L +     F  ++      PL + 
Sbjct: 198 ------QRSDLQEFIEKHYTGDRMVLVGTGAVDHDKLVEYAGKYFGHVRKSEAPIPLGSP 251

Query: 258 NQP 260
             P
Sbjct: 252 RGP 254

>Skud_12.230 Chr12 complement(438565..439953) [1389 bp, 462 aa] {ON}
           YLR163C (REAL)
          Length = 462

 Score = 38.9 bits (89), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 44/217 (20%), Positives = 84/217 (38%), Gaps = 17/217 (7%)

Query: 12  QFYTPISCSSRSHRVIQLDNGMLVLLISNPAEKATSCALSVATGSHNDPKEILGLAHFCE 71
           + ++ +S      R  +L NG+ +     P   + +  + V  GS  +  +  G AHF E
Sbjct: 14  RLFSTVSPQIPGTRTSRLPNGLTIATEYIPNTSSATVGIFVDAGSRAENVKNNGTAHFLE 73

Query: 72  HMILSAGSKSYPDPNAYHDVISKNGGSQ-NAFTTGEQTTFCFELPNLSNSDELVFDKVLD 130
           H+    G+++        ++  +N GS  NA+T+ E T +       + S +    K + 
Sbjct: 74  HLAFK-GTQNRSQQGIELEI--ENIGSHLNAYTSRENTVY------YAKSLQEDIPKAVG 124

Query: 131 IFSSSFKKPLFNELLVNKEIYAINSEHTANKSSRDKIFYHATRLLANGDHPFSQFSTGDI 190
           I S    K + +   + +E   I  E        D++ +     +   D P  +   G I
Sbjct: 125 ILSDILTKSVLDNNAIERERDVIIRESEEVDKMYDEVVFDHLHEITYKDQPLGRTILGPI 184

Query: 191 TTLSDILQLNKVDLRTEVIKYFKNNFYAENMCLCIKG 227
             +  I        R+++  Y   N+  + M L   G
Sbjct: 185 KNIKSI-------TRSDLKNYITRNYKGDRMVLAGAG 214

>Suva_10.260 Chr10 complement(463944..465332) [1389 bp, 462 aa] {ON}
           YLR163C (REAL)
          Length = 462

 Score = 38.5 bits (88), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 43/204 (21%), Positives = 80/204 (39%), Gaps = 17/204 (8%)

Query: 25  RVIQLDNGMLVLLISNPAEKATSCALSVATGSHNDPKEILGLAHFCEHMILSAGSKSYPD 84
           R  +L NG+ +     P   + +  + V  GS  +  +  G AHF EH+    G+++   
Sbjct: 27  RTSKLPNGLTIASEYIPNTSSATVGIFVDAGSRAENIKNNGTAHFLEHLAFK-GTQNRSQ 85

Query: 85  PNAYHDVISKNGGSQ-NAFTTGEQTTFCFELPNLSNSDELVFDKVLDIFSSSFKKPLFNE 143
                ++  +N GS  NA+T+ E T +       + S +    K ++I S    K + + 
Sbjct: 86  QGIELEI--ENIGSHLNAYTSRENTVYY------AKSLQEDIPKAVEILSDILTKSVLDS 137

Query: 144 LLVNKEIYAINSEHTANKSSRDKIFYHATRLLANGDHPFSQFSTGDITTLSDILQLNKVD 203
             + +E   I  E        D++ +     +   D P  +   G I  +  I       
Sbjct: 138 NAIERERDVIIRESEEVDKMYDEVVFDHLHEITYKDQPLGRTILGPIKNIKSI------- 190

Query: 204 LRTEVIKYFKNNFYAENMCLCIKG 227
            R+++  Y   N+  + M L   G
Sbjct: 191 TRSDLKNYITKNYKGDRMVLAGAG 214

>CAGL0H02739g Chr8 (248511..249908) [1398 bp, 465 aa] {ON} highly
           similar to uniprot|P10507 Saccharomyces cerevisiae
           YLR163c MAS1
          Length = 465

 Score = 38.5 bits (88), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 45/204 (22%), Positives = 83/204 (40%), Gaps = 17/204 (8%)

Query: 25  RVIQLDNGMLVLLISNPAEKATSCALSVATGSHNDPKEILGLAHFCEHMILSAGSKSYPD 84
           R   L NG+ V     P +   +  + V  GS  + +   G AHF EH+    G+++   
Sbjct: 29  RTSVLPNGLTVASEFIPNKSTATVGIFVDAGSRAENERNNGTAHFLEHLAFK-GTQNRSQ 87

Query: 85  PNAYHDVISKNGGSQ-NAFTTGEQTTFCFELPNLSNSDELVFDKVLDIFSSSFKKPLFNE 143
            +   ++  +N GS  NA+T+ E T +       + S E    K ++I S    + + + 
Sbjct: 88  TDIELEI--ENIGSHLNAYTSRENTVY------YAKSLEGDVPKAVNILSDILTRSVLDP 139

Query: 144 LLVNKEIYAINSEHTANKSSRDKIFYHATRLLANGDHPFSQFSTGDITTLSDILQLNKVD 203
             + +E   I  E        D++ +     +A    P  +   G I    +I  +++ D
Sbjct: 140 KAIERERDVIIRESEEVDKMYDEVVFDHLHEIAYKQQPLGRTILGPI---KNIKSISRKD 196

Query: 204 LRTEVIKYFKNNFYAENMCLCIKG 227
           L++    Y   N+  + M L   G
Sbjct: 197 LKS----YITENYKGDRMVLAAAG 216

>SAKL0H14168g Chr8 (1211470..1212855) [1386 bp, 461 aa] {ON} highly
           similar to uniprot|P10507 Saccharomyces cerevisiae
           YLR163C MAS1 Smaller subunit of the mitochondrial
           processing protease essential processing enzyme that
           cleaves the N-terminal targeting sequences from
           mitochondrially imported proteins
          Length = 461

 Score = 38.5 bits (88), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 49/233 (21%), Positives = 86/233 (36%), Gaps = 17/233 (7%)

Query: 29  LDNGMLVLLISNPAEKATSCALSVATGSHNDPKEILGLAHFCEHMILSAGSKSYPDPNAY 88
           L NG+ V     P     +  + V  GS  +  +  G AHF EH+    G+++       
Sbjct: 30  LANGLTVASERIPNTSTATVGIFVDAGSRAENAKNNGTAHFLEHLAFK-GTQNRTQTGIE 88

Query: 89  HDVISKNGGSQ-NAFTTGEQTTFCFELPNLSNSDELVFDKVLDIFSSSFKKPLFNELLVN 147
            ++  +N GS  NA+T+ E T +       + S E    + +DI S    + + +   + 
Sbjct: 89  LEI--ENIGSHLNAYTSRENTVY------YAKSLENDIPQAVDILSDILTRSVLDPRAIE 140

Query: 148 KEIYAINSEHTANKSSRDKIFYHATRLLANGDHPFSQFSTGDITTLSDILQLNKVDLRTE 207
           +E   I  E        D++ +     +   D P  +   G I  +  I        R +
Sbjct: 141 RERDVIIRESEEVDKMYDEVVFDHLHAIVYQDQPLGRTILGPIKNIKTI-------QRDD 193

Query: 208 VIKYFKNNFYAENMCLCIKGPQSLNTLGKLVFSKFNDIKGLPISRPLRTKNQP 260
           +  Y   N+  + M L   G    + L     + F  I+      PL +   P
Sbjct: 194 LQAYISKNYSGDRMVLVGAGAVDHHKLVDYAQTYFGHIRKSQQPVPLGSPRGP 246

>NDAI0G04280 Chr7 (1027206..1030310) [3105 bp, 1034 aa] {ON}
           Anc_3.93 YOL098C
          Length = 1034

 Score = 37.7 bits (86), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 53/223 (23%), Positives = 92/223 (41%), Gaps = 37/223 (16%)

Query: 25  RVIQLDNGMLVLLISNPAEKATSCALSVATGSHNDPKEILGLAHFCEHMILSAGSKSYPD 84
           + +    G+ ++ I + +        +V T   ND     G+ H  EH+I   GSK +P 
Sbjct: 21  KYVSARTGLQLVHIDHKSSPLVQGYFAVGTECPNDS----GVPHTLEHLIF-MGSKEHPY 75

Query: 85  PNAYHDVISKNGGSQNAFTTGEQTTFCFELPNLSNSDELVFDKVLDIFSSSFKKPLFNEL 144
                 V +    S NA+T  +QT +      L+++    F K+L  + +    P   + 
Sbjct: 76  KGLLDTVGNLCMSSTNAWTATDQTVY-----TLTSAGWKGFSKLLPSYLNHILFPTLTDE 130

Query: 145 LVNKEIYAINSEHTANK----SSRDKIFYHA--TRLLANGDHPFSQFS-----TGDITTL 193
               E+Y ++ E  ++K    S  + I   +    +L      F + S     TG +T  
Sbjct: 131 ACTTEVYHVDPEDFSDKGVVFSEMEAIESQSWFVTMLEKQRLMFPEGSGYRSETGGLTN- 189

Query: 194 SDILQLNKVDLRT----EVIKYFKNNFYAENMCLCIKG--PQS 230
                    +LRT    E+ K+ K  + ++N+CL I G  PQS
Sbjct: 190 ---------NLRTLTNDEIKKFHKEMYSSDNLCLIICGNVPQS 223

>TPHA0P01040 Chr16 (208875..211991) [3117 bp, 1038 aa] {ON} Anc_3.93
           YOL098C
          Length = 1038

 Score = 37.7 bits (86), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 46/183 (25%), Positives = 75/183 (40%), Gaps = 15/183 (8%)

Query: 50  LSVATGSHNDPKEILGLAHFCEHMILSAGSKSYPDPNAYHDVISKNGGSQNAFTTGEQTT 109
            +VAT   ND     G+ H  EH+I   GS  YP       V +    S NA+T  +QT 
Sbjct: 46  FAVATECGNDS----GVPHTLEHLIF-MGSPKYPYKGLLDTVGNLCMSSTNAWTATDQTV 100

Query: 110 FCFELPNLSNSDELVFDKVLDIFSSSFKKPLFNELLVNKEIYAINSEHTANKS---SRDK 166
           +      L+++    F K+L ++      P   +     E+Y I+ +   +K    S  +
Sbjct: 101 YT-----LTSAGWTGFKKLLPMYLEHIINPTLTDDAYVTEVYHIDPDTLTDKGVVYSEME 155

Query: 167 IFYHATRLLANGDHPFSQFSTGD-ITTLSDILQLNKVDLRTEVIKYFKNNFYA-ENMCLC 224
                   +   +     F  G+   + +  L  N  +L  E IK F  ++Y  EN+C+ 
Sbjct: 156 AIETQNWFVTMLEKQRMMFPEGNGYRSETGGLTENLRNLTNEEIKQFHADYYKRENLCII 215

Query: 225 IKG 227
           I G
Sbjct: 216 ICG 218

>Kpol_1024.23 s1024 (68467..69831) [1365 bp, 454 aa] {OFF}
           (68467..69831) [1365 nt, 455 aa]
          Length = 454

 Score = 37.4 bits (85), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 43/207 (20%), Positives = 78/207 (37%), Gaps = 17/207 (8%)

Query: 22  RSHRVIQLDNGMLVLLISNPAEKATSCALSVATGSHNDPKEILGLAHFCEHMILSAGSKS 81
           +S  + +L NG+ +     P     +  + V  GS  +  +  G AHF EH+    G++ 
Sbjct: 9   QSTNISRLSNGLTIATEYIPNTPTATVGIYVDAGSRAENTKNNGTAHFLEHLAFK-GTEK 67

Query: 82  YPDPNAYHDVISKNGGSQ-NAFTTGEQTTFCFELPNLSNSDELVFDKVLDIFSSSFKKPL 140
                   D+  +N GS  NA+T+ E T +  +    +        + +DI S    K  
Sbjct: 68  RSQKKIELDI--ENIGSHLNAYTSRENTVYYAKTLKEN------VPQAIDILSDILTKST 119

Query: 141 FNELLVNKEIYAINSEHTANKSSRDKIFYHATRLLANGDHPFSQFSTGDITTLSDILQLN 200
            ++  + +E   I  E        D++ +     +A  D    +   G I  +  I    
Sbjct: 120 LDKSAIERERDVIIRESEEVDKMYDEVVFDHLHEIAYSDQSLGRTILGPIKNIKSI---- 175

Query: 201 KVDLRTEVIKYFKNNFYAENMCLCIKG 227
               R ++  Y   N+  + M L   G
Sbjct: 176 ---TRDDLKNYITQNYKGDRMVLASAG 199

>Kpol_YGOB_1024.23 s1024 (68437..69831) [1395 bp, 464 aa] {ON}
           ANNOTATED BY YGOB -
          Length = 464

 Score = 37.4 bits (85), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 43/207 (20%), Positives = 78/207 (37%), Gaps = 17/207 (8%)

Query: 22  RSHRVIQLDNGMLVLLISNPAEKATSCALSVATGSHNDPKEILGLAHFCEHMILSAGSKS 81
           +S  + +L NG+ +     P     +  + V  GS  +  +  G AHF EH+    G++ 
Sbjct: 19  QSTNISRLSNGLTIATEYIPNTPTATVGIYVDAGSRAENTKNNGTAHFLEHLAFK-GTEK 77

Query: 82  YPDPNAYHDVISKNGGSQ-NAFTTGEQTTFCFELPNLSNSDELVFDKVLDIFSSSFKKPL 140
                   D+  +N GS  NA+T+ E T +  +    +        + +DI S    K  
Sbjct: 78  RSQKKIELDI--ENIGSHLNAYTSRENTVYYAKTLKEN------VPQAIDILSDILTKST 129

Query: 141 FNELLVNKEIYAINSEHTANKSSRDKIFYHATRLLANGDHPFSQFSTGDITTLSDILQLN 200
            ++  + +E   I  E        D++ +     +A  D    +   G I  +  I    
Sbjct: 130 LDKSAIERERDVIIRESEEVDKMYDEVVFDHLHEIAYSDQSLGRTILGPIKNIKSI---- 185

Query: 201 KVDLRTEVIKYFKNNFYAENMCLCIKG 227
               R ++  Y   N+  + M L   G
Sbjct: 186 ---TRDDLKNYITQNYKGDRMVLASAG 209

>KNAG0C03170 Chr3 (625226..628210) [2985 bp, 994 aa] {ON} Anc_5.541
           YDR430C
          Length = 994

 Score = 37.0 bits (84), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 41/177 (23%), Positives = 75/177 (42%), Gaps = 29/177 (16%)

Query: 60  PKEILGLAHFCEHMILSAGSKSYPDPNAYHDVISKN-GGSQNAFTTGEQTTFCFELPNLS 118
           P +  G+ H  EH  L  GS  YP  + +  +++K+     NA T    T F F   N  
Sbjct: 88  PPDSTGVPHILEHTTL-CGSVKYPVHDPFFKMLNKSLANFMNAMTGPHYTFFPFATTNGR 146

Query: 119 NSDELVFDKVLDIFSSSFKKPLFNELLVNKEIYAINSEHTANKSS----RDKIFYHATRL 174
           +     F  + D++  S   PL       +E + + +    +K+S    +  ++      
Sbjct: 147 D-----FANLRDVYLDSILNPLLKWEDFVQEGWRLENRDLEDKTSEIVFKGVVYNEMKGQ 201

Query: 175 LANGDHPF-SQF----------STGDITTLSDILQLNKVDLRTEVIKYFKNNFYAEN 220
           ++N D+ F SQF          S GD   ++D+          +++K+ +NN++A N
Sbjct: 202 ISNADYFFWSQFQQALYPDLNNSGGDPQKITDLTY-------EDLVKFHRNNYHASN 251

>SAKL0C10406g Chr3 complement(946709..948196) [1488 bp, 495 aa] {ON}
           similar to uniprot|P38109 Saccharomyces cerevisiae
           YBR139W Hypothetical ORF
          Length = 495

 Score = 35.8 bits (81), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 43/87 (49%), Gaps = 14/87 (16%)

Query: 336 DLLSQCWCELFGDESEGSLCH----FMKKNDYITELTAFM----SHFAVNDNALILELYL 387
           D+ S C      +++EG LC+    +++K   + E+ A +    +H+   DN + L   L
Sbjct: 327 DIRSPC------EDAEGGLCYKGLDYVEKYMNLPEVQAAVGSDVNHYTGCDNDVFLRFIL 380

Query: 388 TNTGWKNLQMIVAVFFNKYVPIVIECG 414
           T  G K  Q  VA   +K +P++I  G
Sbjct: 381 TGDGNKPFQQYVAELLDKDIPVLIYAG 407

>ZYRO0C03806g Chr3 complement(301873..303270) [1398 bp, 465 aa] {ON}
           highly similar to uniprot|P10507 Saccharomyces
           cerevisiae YLR163C MAS1 Smaller subunit of the
           mitochondrial processing protease essential processing
           enzyme that cleaves the N-terminal targeting sequences
           from mitochondrially imported proteins
          Length = 465

 Score = 35.0 bits (79), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 49/237 (20%), Positives = 85/237 (35%), Gaps = 17/237 (7%)

Query: 25  RVIQLDNGMLVLLISNPAEKATSCALSVATGSHNDPKEILGLAHFCEHMILSAGSKSYPD 84
           R   L NG+ V     P   + +  + V  GS  +     G AHF EH+    G+K+   
Sbjct: 30  RTSVLPNGLTVASERLPNVSSATVGIFVDAGSRAENARNNGTAHFLEHLAFK-GTKNRSQ 88

Query: 85  PNAYHDVISKNGGSQ-NAFTTGEQTTFCFELPNLSNSDELVFDKVLDIFSSSFKKPLFNE 143
                ++  +N GS  NA+T+ E T +       + S E    + ++I S    + + + 
Sbjct: 89  TGIELEI--ENIGSHLNAYTSRENTVY------FAKSLEEDVPRAVEILSDILTRSVLDP 140

Query: 144 LLVNKEIYAINSEHTANKSSRDKIFYHATRLLANGDHPFSQFSTGDITTLSDILQLNKVD 203
             + +E   I  E        D++ +     +A  +    +   G I  +  I       
Sbjct: 141 KAIERERDVIIRESEEVDKMYDEVVFDHLHDVAYKNQALGRTILGPIKNIKTI------- 193

Query: 204 LRTEVIKYFKNNFYAENMCLCIKGPQSLNTLGKLVFSKFNDIKGLPISRPLRTKNQP 260
            R ++  Y   N+  + M L   G      L +     F  I       PL +   P
Sbjct: 194 TREDLKNYIDKNYKGDRMVLAGAGAIDHEKLIEYAQKSFGHIPKAEFPVPLGSPRGP 250

>TDEL0D05310 Chr4 (961842..964949) [3108 bp, 1035 aa] {ON} Anc_3.93
           YOL098C
          Length = 1035

 Score = 35.0 bits (79), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 43/189 (22%), Positives = 82/189 (43%), Gaps = 31/189 (16%)

Query: 65  GLAHFCEHMILSAGSKSYPDPNAYHDVISKNG----GSQNAFTTGEQTTFCFELPNLSNS 120
           G  H  EH+I   GS+ +P    Y  ++   G     S NA+T  +QT +      L+++
Sbjct: 57  GAPHTLEHLIF-MGSQQHP----YKGLLDTAGNLCMSSTNAWTATDQTVYT-----LTSA 106

Query: 121 DELVFDKVLDIFSSSFKKPLFNELLVNKEIYAINSEHTANK----SSRDKIFYHA--TRL 174
               F ++L  +      P   +     E+Y ++ +  ++K    S  D I   +    +
Sbjct: 107 GWQGFKQLLPAYLDHILNPTLTDAACLTEVYHVDPDDLSDKGVVFSEMDAIESQSWFVTM 166

Query: 175 LANGDHPFSQFS-----TGDITTLSDILQLNKVDLRTEVIKYFKNNFYAENMCLCIKGPQ 229
           L      F + S     TG +T   ++ Q++  ++R    K+ K+ +  +N+CL + G  
Sbjct: 167 LEKQRLMFPEGSGYRSETGGLT--PNLRQISNDEIR----KFHKDAYSPDNLCLIVSGNV 220

Query: 230 SLNTLGKLV 238
             + L K+V
Sbjct: 221 PEDELLKIV 229

>ZYRO0C11088g Chr3 complement(857314..858771) [1458 bp, 485 aa] {ON}
           highly similar to uniprot|P11914 Saccharomyces
           cerevisiae YHR024C MAS2 Larger subunit of the
           mitochondrial processing protease essential processing
           enzyme that cleaves the N-terminal targeting sequences
           from mitochondrially imported proteins
          Length = 485

 Score = 33.5 bits (75), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 29/130 (22%), Positives = 58/130 (44%), Gaps = 9/130 (6%)

Query: 20  SSRSHRVIQLDNGMLVLLISNPAEKATSCALSVATGSHNDPKEILGLAHFCEHMILSAGS 79
           ++ S R+ QL NG+ V   S P    ++  L V  GS  + + + G  H  + +     S
Sbjct: 13  ANNSFRLTQLPNGLKVATSSTPGH-FSALGLYVGAGSRYETRNLKGCTHILDRLAFK--S 69

Query: 80  KSYPDPNAYHDVISKNGGSQNAFTTGEQTTFCFELPNLSNSDELVFDKVLDIFSSSFKKP 139
             + D     + +   GG+    ++ E   +     ++ N D    DK+L++ S + + P
Sbjct: 70  SEHVDGRTMAETLELLGGNYQCTSSRENMMY---QASVFNQD---VDKMLNLMSETVRYP 123

Query: 140 LFNELLVNKE 149
           L  +  V+++
Sbjct: 124 LIKQEEVDEQ 133

>TBLA0A06940 Chr1 complement(1694417..1697392) [2976 bp, 991 aa]
           {ON} Anc_5.541 YDR430C
          Length = 991

 Score = 33.9 bits (76), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 29/115 (25%), Positives = 53/115 (46%), Gaps = 8/115 (6%)

Query: 55  GSHNDPKEILGLAHFCEHMILSAGSKSYPDPNAYHDVISKN-GGSQNAFTTGEQTTFCFE 113
           G   +P +  G+AH  EH  L  GSK YP  + +  +++++     NA T  + T + F 
Sbjct: 72  GFKTNPPDSTGVAHILEHTTL-CGSKKYPVRDPFFKMLNRSLSNFMNAMTGHDYTMYPFA 130

Query: 114 LPNLSNSDELVFDKVLDIFSSSFKKPLFNELLVNKEIYAINSEHTANKSSRDKIF 168
             N  +     F  + D++  +   PL  +    +E + + ++   +K S D IF
Sbjct: 131 TTNSKD-----FKNLQDVYLDATFSPLLKQEDFFQEGWRLENKDATDKDS-DLIF 179

>YKL203C Chr11 complement(55935..63359) [7425 bp, 2474 aa] {ON}
           TOR2PIK-related protein kinase and rapamycin target;
           subunit of TORC1, a complex that regulates growth in
           response to nutrients and TORC2, a complex that
           regulates cell-cycle dependent polarization of the actin
           cytoskeleton; involved in meiosis
          Length = 2474

 Score = 33.9 bits (76), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 41/137 (29%), Positives = 54/137 (39%), Gaps = 26/137 (18%)

Query: 126 DKVLDIFSSSFKKPLFNELLVNKEIYAINSEHTA------NKSSRDKIFYHATRLLA--- 176
           DK  DI+ S+ K   +   ++ +E+YAI     A       K   D+I  H  R L    
Sbjct: 346 DKYDDIYKSTMKYKEYKFDVIRREVYAILPLLAAFDPAIFTKKYLDRIMVHYLRYLKNID 405

Query: 177 -----NGDHPFSQFSTGDIT---------TLSDILQLNKVDLRT--EVIKYF-KNNFYAE 219
                N D PF   S GDI           ++ IL   +  LRT  +V K F K+ FY  
Sbjct: 406 MNAANNSDKPFILVSIGDIAFEVGSSISPYMTLILDNIREGLRTKFKVRKQFEKDLFYCI 465

Query: 220 NMCLCIKGPQSLNTLGK 236
               C  GP     L K
Sbjct: 466 GKLACALGPAFAKHLNK 482

>KLTH0E05764g Chr5 complement(507436..516744) [9309 bp, 3102 aa] {ON}
            similar to uniprot|Q07878 Saccharomyces cerevisiae
            YLL040C VPS13 homologous to human COH1 component of
            peripheral vacuolar membrane protein complex
          Length = 3102

 Score = 33.1 bits (74), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 36/75 (48%), Gaps = 19/75 (25%)

Query: 510  NFENVRLVLMGDLKECPLMKTDLTSLKLN-------------IEPYYE-FEYHKCRSDQS 555
            NFE +RLVL+GD+ E P++   +    LN             IE Y   F Y +     S
Sbjct: 1705 NFEGLRLVLIGDIHELPIIDLSIKPFTLNAKDWTNDVEAVASIETYANVFNYSR-----S 1759

Query: 556  NFKLTVEEISYSFHI 570
            +++  +E +  SFH+
Sbjct: 1760 SWEPLLETVPLSFHL 1774

>TPHA0K01720 Chr11 (363438..365873) [2436 bp, 811 aa] {ON} Anc_4.90
           YGL027C
          Length = 811

 Score = 32.7 bits (73), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 31/104 (29%), Positives = 48/104 (46%), Gaps = 6/104 (5%)

Query: 681 SEKIGYTYEIAASSKGDVRIGFTVSGFSEGVYKIIEKIVGTLVQIVYSEVVIARDLFRKS 740
           SE +   YEI  SSK +   G  V+G    + +   +I+   ++ +Y ++V   D FR S
Sbjct: 480 SEMLIKAYEIHESSKSNSNFG--VAGEENNLLEENYEILAARIKSLYPKLVKHYDWFRSS 537

Query: 741 RIAVRNKYEEAASVNSTTLVNIGLLIVLEKYMWRLESRLEALES 784
           +  + + YEE    +   L NI L    E Y W   +R   L S
Sbjct: 538 QKVLTDDYEEIFD-DEGILDNIHL---DELYRWSGRTRKHCLPS 577

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.136    0.392 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 126,782,111
Number of extensions: 5801332
Number of successful extensions: 17509
Number of sequences better than 10.0: 91
Number of HSP's gapped: 17836
Number of HSP's successfully gapped: 117
Length of query: 1183
Length of database: 53,481,399
Length adjustment: 121
Effective length of query: 1062
Effective length of database: 39,606,813
Effective search space: 42062435406
Effective search space used: 42062435406
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 72 (32.3 bits)