Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0F05368g7.126ON23123111931e-168
KLLA0D14333g7.126ON2052236862e-91
Skud_9.1627.126ON2172276733e-89
Suva_9.1947.126ON2152236672e-88
Kpol_1062.577.126ON2192256603e-87
Smik_9.1847.126ON2142186386e-84
YIL010W (DOT5)7.126ON2152236309e-83
CAGL0C03850g7.126ON2092206272e-82
KNAG0G010207.126ON2072236263e-82
KAFR0K012007.126ON2021976245e-82
NDAI0H013107.126ON2612576244e-81
Ecym_83517.126ON2242196181e-80
TDEL0H028807.126ON3541546282e-80
TBLA0A009407.126ON2882266101e-78
ADL018W7.126ON2442325973e-77
ZYRO0C05214g7.126ON2701475993e-77
NCAS0F008107.126ON2312315937e-77
Kwal_55.208397.126ON3051595623e-71
TPHA0C043307.126ON2092235196e-66
KLTH0F12562g7.126ON2931544997e-62
NDAI0A07090singletonON117049692.9
Ecym_43018.269ON56474673.6
Kpol_1004.598.300ON176126654.2
YLR071C (RGR1)8.15ON1082120665.3
AGL330W5.25ON1011106657.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0F05368g
         (231 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0F05368g Chr6 complement(415292..415987) [696 bp, 231 aa] {O...   464   e-168
KLLA0D14333g Chr4 complement(1218148..1218765) [618 bp, 205 aa] ...   268   2e-91
Skud_9.162 Chr9 (304819..305472) [654 bp, 217 aa] {ON} YIL010W (...   263   3e-89
Suva_9.194 Chr9 (323335..323982) [648 bp, 215 aa] {ON} YIL010W (...   261   2e-88
Kpol_1062.57 s1062 complement(128150..128809) [660 bp, 219 aa] {...   258   3e-87
Smik_9.184 Chr9 (309471..310115) [645 bp, 214 aa] {ON} YIL010W (...   250   6e-84
YIL010W Chr9 (334882..335529) [648 bp, 215 aa] {ON}  DOT5Nuclear...   247   9e-83
CAGL0C03850g Chr3 complement(377957..378586) [630 bp, 209 aa] {O...   246   2e-82
KNAG0G01020 Chr7 complement(217202..217825) [624 bp, 207 aa] {ON...   245   3e-82
KAFR0K01200 Chr11 complement(247261..247869) [609 bp, 202 aa] {O...   244   5e-82
NDAI0H01310 Chr8 (318386..319171) [786 bp, 261 aa] {ON} Anc_7.12...   244   4e-81
Ecym_8351 Chr8 complement(702059..702733) [675 bp, 224 aa] {ON} ...   242   1e-80
TDEL0H02880 Chr8 (479958..481022) [1065 bp, 354 aa] {ON} Anc_7.1...   246   2e-80
TBLA0A00940 Chr1 (209206..210072) [867 bp, 288 aa] {ON} Anc_7.12...   239   1e-78
ADL018W Chr4 (678193..678927) [735 bp, 244 aa] {ON} Syntenic hom...   234   3e-77
ZYRO0C05214g Chr3 (407597..408409) [813 bp, 270 aa] {ON} some si...   235   3e-77
NCAS0F00810 Chr6 (165372..166067) [696 bp, 231 aa] {ON} Anc_7.12...   233   7e-77
Kwal_55.20839 s55 (579138..580055) [918 bp, 305 aa] {ON} YIL010W...   221   3e-71
TPHA0C04330 Chr3 complement(934432..935061) [630 bp, 209 aa] {ON...   204   6e-66
KLTH0F12562g Chr6 (1052954..1053835) [882 bp, 293 aa] {ON} simil...   196   7e-62
NDAI0A07090 Chr1 complement(1613809..1617321) [3513 bp, 1170 aa]...    31   2.9  
Ecym_4301 Chr4 (644340..646034) [1695 bp, 564 aa] {ON} similar t...    30   3.6  
Kpol_1004.59 s1004 (127836..128366) [531 bp, 176 aa] {ON} (12783...    30   4.2  
YLR071C Chr12 complement(275378..278626) [3249 bp, 1082 aa] {ON}...    30   5.3  
AGL330W Chr7 (91076..94111) [3036 bp, 1011 aa] {ON} Syntenic hom...    30   7.5  

>SAKL0F05368g Chr6 complement(415292..415987) [696 bp, 231 aa] {ON}
           highly similar to gnl|GLV|KLLA0D14333g Kluyveromyces
           lactis KLLA0D14333g and similar to YIL010W
           uniprot|P40553 Saccharomyces cerevisiae YIL010W DOT5
           Nuclear thiol peroxidase
          Length = 231

 Score =  464 bits (1193), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 231/231 (100%), Positives = 231/231 (100%)

Query: 1   MVELRRSNRLAASKKLGKGEKPSVEPPAKKLKISRKNKSEDKIEDKTEDEVQDKPADKSE 60
           MVELRRSNRLAASKKLGKGEKPSVEPPAKKLKISRKNKSEDKIEDKTEDEVQDKPADKSE
Sbjct: 1   MVELRRSNRLAASKKLGKGEKPSVEPPAKKLKISRKNKSEDKIEDKTEDEVQDKPADKSE 60

Query: 61  DEPTEEPNPASSELEVGDDIPDLILKNQDDKDISLKELAKKNRIVVFFAYPKASTPGCTR 120
           DEPTEEPNPASSELEVGDDIPDLILKNQDDKDISLKELAKKNRIVVFFAYPKASTPGCTR
Sbjct: 61  DEPTEEPNPASSELEVGDDIPDLILKNQDDKDISLKELAKKNRIVVFFAYPKASTPGCTR 120

Query: 121 QVCGYRDNYEDLKEHAAVFGLSADTTKAQKNFQTKQSLPYDLLSDPKREFIGLLGAKKTP 180
           QVCGYRDNYEDLKEHAAVFGLSADTTKAQKNFQTKQSLPYDLLSDPKREFIGLLGAKKTP
Sbjct: 121 QVCGYRDNYEDLKEHAAVFGLSADTTKAQKNFQTKQSLPYDLLSDPKREFIGLLGAKKTP 180

Query: 181 QSGVIRSHWVFSEGKLRFKRVKISPETSVADGKKEVLELAKDLEKDFEEEK 231
           QSGVIRSHWVFSEGKLRFKRVKISPETSVADGKKEVLELAKDLEKDFEEEK
Sbjct: 181 QSGVIRSHWVFSEGKLRFKRVKISPETSVADGKKEVLELAKDLEKDFEEEK 231

>KLLA0D14333g Chr4 complement(1218148..1218765) [618 bp, 205 aa]
           {ON} similar to uniprot|P40553 Saccharomyces cerevisiae
           YIL010W DOT5 Nuclear thiol peroxidase
          Length = 205

 Score =  268 bits (686), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 141/223 (63%), Positives = 167/223 (74%), Gaps = 18/223 (8%)

Query: 1   MVELRRSNRLAASKKLGKGEKPSVEPPAKKLKISRKNKSEDKIEDKTEDEVQDKPADKSE 60
           MVELRRSNR++A K+    E  S EP               K++ KTE +V  KP  K E
Sbjct: 1   MVELRRSNRISAKKEPLDSE--SAEPI--------------KVKAKTESKVT-KPNGKKE 43

Query: 61  DEPTEEPNPASSELEVGDDIPDLILKNQDDKDISLKELAKKNRIVVFFAYPKASTPGCTR 120
            +  +  N  + EL++GDDIPDL L NQDD+ ISLKE+A KN++VVFFAYPKASTPGCTR
Sbjct: 44  VKNEDSANKLA-ELQIGDDIPDLTLLNQDDEPISLKEVASKNKLVVFFAYPKASTPGCTR 102

Query: 121 QVCGYRDNYEDLKEHAAVFGLSADTTKAQKNFQTKQSLPYDLLSDPKREFIGLLGAKKTP 180
           Q CGYRDNY +LKEHAAVFGLSAD  K+QK+FQTKQ+LP+DLLSDPKREFIG LGAKKT 
Sbjct: 103 QACGYRDNYSELKEHAAVFGLSADAPKSQKSFQTKQALPFDLLSDPKREFIGALGAKKTA 162

Query: 181 QSGVIRSHWVFSEGKLRFKRVKISPETSVADGKKEVLELAKDL 223
            SGV+RSHW+F  GKL  KRV++SPE S+ +GKKEVLELAK L
Sbjct: 163 VSGVVRSHWIFKNGKLEVKRVQVSPEVSIEEGKKEVLELAKSL 205

>Skud_9.162 Chr9 (304819..305472) [654 bp, 217 aa] {ON} YIL010W
           (REAL)
          Length = 217

 Score =  263 bits (673), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 138/227 (60%), Positives = 169/227 (74%), Gaps = 24/227 (10%)

Query: 4   LRRSNRLAASKKLGKGEKPSVEP------PAKKLKISRKNKSEDKIEDKTEDEVQDKPAD 57
           LRRS R+AASK+L + E+  + P      P KK+K + K K+ + +              
Sbjct: 5   LRRSTRIAASKRLLEDEESKLVPISPPEVPKKKVKTAPKVKTSEPV-------------- 50

Query: 58  KSEDEPTEEPNPASSELEVGDDIPDLILKNQDDKDISLKELAKKNRIVVFFAYPKASTPG 117
           KSED+       A++ELE+GD IPDL L ++D+  ISLKE+AK+N+IVVFF YPKASTPG
Sbjct: 51  KSEDDSLS----AATELEIGDSIPDLSLLSEDNDPISLKEIAKENKIVVFFVYPKASTPG 106

Query: 118 CTRQVCGYRDNYEDLKEHAAVFGLSADTTKAQKNFQTKQSLPYDLLSDPKREFIGLLGAK 177
           CTRQ CG+RDNYEDLK+HAAVFGLSAD   +QK FQTKQ+LPY L+SDPKREFIGLLGAK
Sbjct: 107 CTRQACGFRDNYEDLKKHAAVFGLSADPVTSQKKFQTKQNLPYHLISDPKREFIGLLGAK 166

Query: 178 KTPQSGVIRSHWVFSEGKLRFKRVKISPETSVADGKKEVLELAKDLE 224
           KTP SG IRSH+VF  GKLRFKR+KISPE SV+D KKEVLE+A+ +E
Sbjct: 167 KTPLSGSIRSHFVFVNGKLRFKRIKISPEVSVSDAKKEVLEIAERVE 213

>Suva_9.194 Chr9 (323335..323982) [648 bp, 215 aa] {ON} YIL010W
           (REAL)
          Length = 215

 Score =  261 bits (667), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 140/223 (62%), Positives = 166/223 (74%), Gaps = 12/223 (5%)

Query: 4   LRRSNRLAASKKLGKGEKPSVEPPAKKLKISRKNKSEDKIEDKTEDEVQDKPADKSEDEP 63
           LRRS R+A SK+L + E   + P +      +K K+  K++   E+ V      K ED  
Sbjct: 5   LRRSARIATSKRLLENEGSKLVPVSPPEPAKKKIKTVPKLD--IEEPV------KREDHS 56

Query: 64  TEEPNPASSELEVGDDIPDLILKNQDDKDISLKELAKKNRIVVFFAYPKASTPGCTRQVC 123
           +   N    EL+VGDDIPDL L N+D+  +SLKE+AK+N+IVVFF YPKASTPGCTRQ C
Sbjct: 57  SLGAN----ELKVGDDIPDLSLLNEDNDPVSLKEIAKENKIVVFFVYPKASTPGCTRQAC 112

Query: 124 GYRDNYEDLKEHAAVFGLSADTTKAQKNFQTKQSLPYDLLSDPKREFIGLLGAKKTPQSG 183
           G+RDNYEDLKEHAAVFGLSAD+  +QK FQTKQ LPY LLSDPKREFIGLLGAKKTP SG
Sbjct: 113 GFRDNYEDLKEHAAVFGLSADSVISQKKFQTKQKLPYHLLSDPKREFIGLLGAKKTPLSG 172

Query: 184 VIRSHWVFSEGKLRFKRVKISPETSVADGKKEVLELAKDLEKD 226
            IRSH+VF +GKLRFKRVKISPE SV D KKEV+ELA+  EK+
Sbjct: 173 SIRSHFVFVDGKLRFKRVKISPEVSVGDAKKEVMELAEKFEKE 215

>Kpol_1062.57 s1062 complement(128150..128809) [660 bp, 219 aa] {ON}
           complement(128150..128809) [660 nt, 220 aa]
          Length = 219

 Score =  258 bits (660), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 132/225 (58%), Positives = 171/225 (76%), Gaps = 6/225 (2%)

Query: 1   MVELRRSNRLAASKKLGKGEKPSVEPPAKKLKISRKNKSEDKIEDKTEDEVQDKPADKSE 60
           MV +RRS R+A SK+  + ++   +  +K  + +  +K   K +D    +V DK + K+E
Sbjct: 1   MVAVRRSTRIANSKRKLEADEAERDVASKSGEETTSSKKLKKEKDVRVTKVDDKES-KAE 59

Query: 61  DEPTEEPNPASSELEVGDDIPDLILKNQDDKDISLKELAKKNRIVVFFAYPKASTPGCTR 120
           ++P+        E+E+GD+IPDL L+NQD   ISL++LAK N I+VFFAYP+A TPGCTR
Sbjct: 60  NKPS-----GIKEVEIGDEIPDLELENQDGVKISLRQLAKDNNILVFFAYPRAMTPGCTR 114

Query: 121 QVCGYRDNYEDLKEHAAVFGLSADTTKAQKNFQTKQSLPYDLLSDPKREFIGLLGAKKTP 180
           Q CG+RD Y+DLK+HAAVFGLSAD+T +QK FQ K SLPYDLLSDPKREFIGLLGAKKTP
Sbjct: 115 QACGFRDTYDDLKKHAAVFGLSADSTHSQKKFQDKYSLPYDLLSDPKREFIGLLGAKKTP 174

Query: 181 QSGVIRSHWVFSEGKLRFKRVKISPETSVADGKKEVLELAKDLEK 225
           QSG+IRSH++F +GKLRFKR+KISPE SV DGKKEVLE+ ++  K
Sbjct: 175 QSGIIRSHFIFVDGKLRFKRIKISPEISVNDGKKEVLEIVEEFSK 219

>Smik_9.184 Chr9 (309471..310115) [645 bp, 214 aa] {ON} YIL010W
           (REAL)
          Length = 214

 Score =  250 bits (638), Expect = 6e-84,   Method: Compositional matrix adjust.
 Identities = 129/218 (59%), Positives = 166/218 (76%), Gaps = 14/218 (6%)

Query: 4   LRRSNRLAASKKLGKGEKPSVEPPAKKLKISRKNKSEDKIE-DKTEDEVQDKPADKSEDE 62
           LRRS R+AASK+  + E+   +P +    + ++ K++ K++  +TED+      D S   
Sbjct: 5   LRRSTRIAASKRSLEDEESKFDPISPPEVLKKRVKTDLKVKVSETEDQ-----GDNSAS- 58

Query: 63  PTEEPNPASSELEVGDDIPDLILKNQDDKDISLKELAKKNRIVVFFAYPKASTPGCTRQV 122
                   S+EL++GD IPDL L ++D+  ISLK++A++N+IVVFF YPKASTPGCTRQ 
Sbjct: 59  -------TSTELKIGDPIPDLSLLSEDNDSISLKKIAEENKIVVFFVYPKASTPGCTRQA 111

Query: 123 CGYRDNYEDLKEHAAVFGLSADTTKAQKNFQTKQSLPYDLLSDPKREFIGLLGAKKTPQS 182
           CG+RDNY+DLK+H+AVFGLS+D+  +QK FQTKQ+LPY LLSDPKREFIGLLGAKKTP S
Sbjct: 112 CGFRDNYDDLKKHSAVFGLSSDSVTSQKRFQTKQNLPYHLLSDPKREFIGLLGAKKTPLS 171

Query: 183 GVIRSHWVFSEGKLRFKRVKISPETSVADGKKEVLELA 220
           G IRSH+VF +GKLRFKRVKISPE SV D KKE+LELA
Sbjct: 172 GSIRSHFVFVDGKLRFKRVKISPEVSVNDAKKEILELA 209

>YIL010W Chr9 (334882..335529) [648 bp, 215 aa] {ON}  DOT5Nuclear
           thiol peroxidase which functions as an
           alkyl-hydroperoxide reductase during post-diauxic growth
          Length = 215

 Score =  247 bits (630), Expect = 9e-83,   Method: Compositional matrix adjust.
 Identities = 127/223 (56%), Positives = 163/223 (73%), Gaps = 24/223 (10%)

Query: 4   LRRSNRLAASKKLGKGEKPSVEP------PAKKLKISRKNKSEDKIEDKTEDEVQDKPAD 57
           LRRS R+A SK++ + E+  + P      P KK+K   K+ +   +       VQ+  A+
Sbjct: 5   LRRSTRIAISKRMLEEEESKLAPISTPEVPKKKIKTGPKHNANQAV-------VQE--AN 55

Query: 58  KSEDEPTEEPNPASSELEVGDDIPDLILKNQDDKDISLKELAKKNRIVVFFAYPKASTPG 117
           +S D          +ELE+GD IPDL L N+D+  ISLK++ + NR+VVFF YP+ASTPG
Sbjct: 56  RSSD---------VNELEIGDPIPDLSLLNEDNDSISLKKITENNRVVVFFVYPRASTPG 106

Query: 118 CTRQVCGYRDNYEDLKEHAAVFGLSADTTKAQKNFQTKQSLPYDLLSDPKREFIGLLGAK 177
           CTRQ CG+RDNY++LK++AAVFGLSAD+  +QK FQ+KQ+LPY LLSDPKREFIGLLGAK
Sbjct: 107 CTRQACGFRDNYQELKKYAAVFGLSADSVTSQKKFQSKQNLPYHLLSDPKREFIGLLGAK 166

Query: 178 KTPQSGVIRSHWVFSEGKLRFKRVKISPETSVADGKKEVLELA 220
           KTP SG IRSH++F +GKL+FKRVKISPE SV D KKEVLE+A
Sbjct: 167 KTPLSGSIRSHFIFVDGKLKFKRVKISPEVSVNDAKKEVLEVA 209

>CAGL0C03850g Chr3 complement(377957..378586) [630 bp, 209 aa] {ON}
           similar to uniprot|P40553 Saccharomyces cerevisiae
           YIL010w DOT5 involved in derepression of telomeric
           silencing
          Length = 209

 Score =  246 bits (627), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 133/220 (60%), Positives = 161/220 (73%), Gaps = 15/220 (6%)

Query: 2   VELRRSNRLAASKKLGKGEKPSVEPPAKKLKISRKNKSEDKIEDKTEDEVQDKPADKSED 61
           +ELRRS RL+A      G +   E P KK     K KS  K +  T++ V+ KP  K E 
Sbjct: 1   MELRRSTRLSAKH----GNEVKDEGPIKK-----KAKSVLKEKVNTKEPVK-KPNTKEEK 50

Query: 62  EPTEEPNPASSELEVGDDIPDLILKNQDDKDISLKELAKKNRIVVFFAYPKASTPGCTRQ 121
             ++E     + LEVGDDIPD+ L+NQD KD+SLK LAK+N++++ F YPKASTPGCTRQ
Sbjct: 51  VSSDE-----AILEVGDDIPDITLQNQDGKDVSLKALAKENKVIIIFLYPKASTPGCTRQ 105

Query: 122 VCGYRDNYEDLKEHAAVFGLSADTTKAQKNFQTKQSLPYDLLSDPKREFIGLLGAKKTPQ 181
            CG+RDN++DLKEH  V GLS DT  AQ  F+ K SLPYDLL DP REFIG+LGAKKTP 
Sbjct: 106 ACGFRDNFDDLKEHGLVLGLSHDTPAAQLKFKEKYSLPYDLLCDPTREFIGMLGAKKTPA 165

Query: 182 SGVIRSHWVFSEGKLRFKRVKISPETSVADGKKEVLELAK 221
           SG IRSH+VF++GKL+FKR+KISPE SVADGKKEVLELAK
Sbjct: 166 SGSIRSHFVFADGKLKFKRLKISPEISVADGKKEVLELAK 205

>KNAG0G01020 Chr7 complement(217202..217825) [624 bp, 207 aa] {ON}
           Anc_7.126 YIL010W
          Length = 207

 Score =  245 bits (626), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 123/223 (55%), Positives = 160/223 (71%), Gaps = 16/223 (7%)

Query: 1   MVELRRSNRLAASKKLGKGEKPSVEPPAKKLKISRKNKSEDKIEDKTEDEVQDKPADKSE 60
           MVELR+S R+A  KK     + ++  PA          + +KI  KT +    K   K  
Sbjct: 1   MVELRKSARVANIKK-----QTTLTTPA----------TSNKIVKKTSNAASHKKV-KIV 44

Query: 61  DEPTEEPNPASSELEVGDDIPDLILKNQDDKDISLKELAKKNRIVVFFAYPKASTPGCTR 120
            E  ++P   +  LE+GD+IPDL L +Q+ + +SL E+A  N+I+V FAYP+ASTPGCTR
Sbjct: 45  AETEDKPLVDAKVLEIGDEIPDLTLVDQEGELVSLTEVASNNKILVIFAYPRASTPGCTR 104

Query: 121 QVCGYRDNYEDLKEHAAVFGLSADTTKAQKNFQTKQSLPYDLLSDPKREFIGLLGAKKTP 180
           Q CG+RDNY +LK+HAAV+GLSADT  +QK FQTKQ+LPY+LLSDPKREFIG+LGAKKT 
Sbjct: 105 QACGFRDNYAELKKHAAVYGLSADTVASQKKFQTKQNLPYNLLSDPKREFIGVLGAKKTS 164

Query: 181 QSGVIRSHWVFSEGKLRFKRVKISPETSVADGKKEVLELAKDL 223
           QSG+IRS+W+F  GKLR K++K+SPE SVA+ K EVLEL K+L
Sbjct: 165 QSGIIRSYWIFFNGKLRIKKIKVSPEASVAESKAEVLELVKEL 207

>KAFR0K01200 Chr11 complement(247261..247869) [609 bp, 202 aa] {ON}
           Anc_7.126 YIL010W
          Length = 202

 Score =  244 bits (624), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 117/197 (59%), Positives = 158/197 (80%), Gaps = 7/197 (3%)

Query: 30  KLKISRKNKSEDKIEDKTEDEVQDKPADK-----SEDEPTEEP-NPASSELEVGDDIPDL 83
           +L+ S + K++   ED  ED+ + +P  K     S++E  E   N +SSEL++GD +PD+
Sbjct: 2   QLRNSTRIKAKVLFED-IEDDKERRPEKKRRVTISKEETVESSGNVSSSELQIGDIMPDI 60

Query: 84  ILKNQDDKDISLKELAKKNRIVVFFAYPKASTPGCTRQVCGYRDNYEDLKEHAAVFGLSA 143
            L NQD++ ISL+E+AK N+I+V FAYPKASTPGCTRQ CG+RDNY+++K+HAAVFGLSA
Sbjct: 61  TLMNQDNQKISLQEVAKNNKILVLFAYPKASTPGCTRQACGFRDNYDEIKKHAAVFGLSA 120

Query: 144 DTTKAQKNFQTKQSLPYDLLSDPKREFIGLLGAKKTPQSGVIRSHWVFSEGKLRFKRVKI 203
           D+  +QK FQ KQ+LP++LLSDPKRE IG+LGAKKTPQSG+IRSHWVF +GKLRF+ +K+
Sbjct: 121 DSVVSQKRFQEKQNLPFELLSDPKRELIGILGAKKTPQSGIIRSHWVFLDGKLRFRNIKV 180

Query: 204 SPETSVADGKKEVLELA 220
           SPE S+++ KKEV+ELA
Sbjct: 181 SPERSISESKKEVMELA 197

>NDAI0H01310 Chr8 (318386..319171) [786 bp, 261 aa] {ON} Anc_7.126
           YIL010W
          Length = 261

 Score =  244 bits (624), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 128/257 (49%), Positives = 170/257 (66%), Gaps = 34/257 (13%)

Query: 1   MVELRRSNRLAASKK---------LGKGEKPSVE----PPAKKLKISRK----------- 36
           ++ELRRS R+ A K+         + K +K + +     P+KKL +S K           
Sbjct: 2   VMELRRSGRVTAGKRTFDEDTDNHVEKRKKIATQKAKKSPSKKLLVSEKKVIKNAGSING 61

Query: 37  ----------NKSEDKIEDKTEDEVQDKPADKSEDEPTEEPNPASSELEVGDDIPDLILK 86
                     +  EDK++    +EV+    D+ +       N +  ELE+GDDIPD+ L 
Sbjct: 62  RETKKETKPRSVVEDKVDGIEHEEVKKVKFDEQQVSDKSANNDSIIELEIGDDIPDITLS 121

Query: 87  NQDDKDISLKELAKKNRIVVFFAYPKASTPGCTRQVCGYRDNYEDLKEHAAVFGLSADTT 146
           NQ+ K+ISLKE+AK N+I+V FA+P+ASTPGCTRQ CG+RDNY++LK++A VFGLSAD  
Sbjct: 122 NQNGKEISLKEIAKTNKIIVIFAFPRASTPGCTRQACGFRDNYDELKKNAIVFGLSADAI 181

Query: 147 KAQKNFQTKQSLPYDLLSDPKREFIGLLGAKKTPQSGVIRSHWVFSEGKLRFKRVKISPE 206
            +QK F+ KQ LPYDLLSDPKR+ IGLLGAKKTPQSG +RS+W+F EGKL  KR+K+SPE
Sbjct: 182 SSQKKFEEKQHLPYDLLSDPKRQLIGLLGAKKTPQSGTVRSYWIFVEGKLSIKRIKVSPE 241

Query: 207 TSVADGKKEVLELAKDL 223
            SVA+ KKEV+E AK L
Sbjct: 242 ISVAESKKEVIEFAKKL 258

>Ecym_8351 Chr8 complement(702059..702733) [675 bp, 224 aa] {ON}
           similar to Ashbya gossypii ADL018W
          Length = 224

 Score =  242 bits (618), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 120/219 (54%), Positives = 157/219 (71%), Gaps = 4/219 (1%)

Query: 3   ELRRSNRLAASKKLGKGEKPSVEPPAKKLKISRKNKSEDKIEDKTEDEVQDKPADKSEDE 62
           ELRRS RLA  K   K E   +    KK+K S       K  +        K     + E
Sbjct: 4   ELRRSTRLATRKANEKPEFEEIRFSQKKIKTSSGVSGVKKKSNNGGSVGVLKADSVLKSE 63

Query: 63  PTEEPNPASSELEVGDDIPDLILKNQDDKDISLKELAKKNRIVVFFAYPKASTPGCTRQV 122
               P     ELEVGD++P++ LKNQDDK+++LK++AKKN+IV+ FAYPKA+TPGCTRQ 
Sbjct: 64  KVGGPK----ELEVGDNVPEIALKNQDDKEVNLKDVAKKNKIVLIFAYPKANTPGCTRQA 119

Query: 123 CGYRDNYEDLKEHAAVFGLSADTTKAQKNFQTKQSLPYDLLSDPKREFIGLLGAKKTPQS 182
           CG+RDNYE+L++HA +FG+S+D+ K+QK FQ+KQ LP+DLLSDP RE IG+LGAKKT Q+
Sbjct: 120 CGFRDNYEELQKHAVIFGISSDSVKSQKAFQSKQHLPFDLLSDPDRELIGMLGAKKTAQA 179

Query: 183 GVIRSHWVFSEGKLRFKRVKISPETSVADGKKEVLELAK 221
           GVIRSHW+F  GKL++KRVK+SPETS+++G +EVL L K
Sbjct: 180 GVIRSHWIFCNGKLKYKRVKVSPETSISEGLEEVLGLIK 218

>TDEL0H02880 Chr8 (479958..481022) [1065 bp, 354 aa] {ON} Anc_7.126
           YIL010W
          Length = 354

 Score =  246 bits (628), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 108/154 (70%), Positives = 133/154 (86%)

Query: 71  SSELEVGDDIPDLILKNQDDKDISLKELAKKNRIVVFFAYPKASTPGCTRQVCGYRDNYE 130
           S+EL++GD+IPD+ L+NQD KD+SL+++AK+++I++ FAYPKASTPGCTRQ CGYRDNY+
Sbjct: 199 STELDIGDEIPDVTLQNQDGKDVSLRDVAKEHKIIIIFAYPKASTPGCTRQACGYRDNYD 258

Query: 131 DLKEHAAVFGLSADTTKAQKNFQTKQSLPYDLLSDPKREFIGLLGAKKTPQSGVIRSHWV 190
           +LKEHAAVFGLS D   AQK FQTKQSLP+DLL DP R  IG LGAKKT QSG +RSHWV
Sbjct: 259 ELKEHAAVFGLSGDNASAQKKFQTKQSLPFDLLCDPGRVLIGHLGAKKTAQSGTLRSHWV 318

Query: 191 FSEGKLRFKRVKISPETSVADGKKEVLELAKDLE 224
           F +GKL++KRVK+SPE S+ DGKKEVLELA  L+
Sbjct: 319 FFDGKLKYKRVKVSPEVSIQDGKKEVLELAASLQ 352

>TBLA0A00940 Chr1 (209206..210072) [867 bp, 288 aa] {ON} Anc_7.126
           YIL010W
          Length = 288

 Score =  239 bits (610), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 125/226 (55%), Positives = 161/226 (71%), Gaps = 3/226 (1%)

Query: 7   SNRLAASKKLGKGEKPSVEPPAKKLKISRKNKSEDKIEDKTEDEVQDKPAD-KSEDEPTE 65
           SN +      GKG +   +   KK     KN  E K+  + E EV+DK A    ++   +
Sbjct: 60  SNGVTKMNSNGKGTEKVKDAKEKKGSTDEKNVKEKKVSTE-EKEVKDKKASTDEKESKEK 118

Query: 66  EPNPASSELEVGDDIPDLILKNQDDKDISLKELAKKNRIVVFFAYPKASTPGCTRQVCGY 125
           +  P+  ELEVGD++PD  LKNQ+++ ISLK++ ++NRIVV FAYPKA+TPGCTRQ CG 
Sbjct: 119 KDEPSVKELEVGDEVPDFELKNQNNETISLKKVMEENRIVVIFAYPKANTPGCTRQACGM 178

Query: 126 RDNYEDLKEHAAVFGLSADTTKAQKNFQTKQSLPYDLLSDPKREFIGLLGAKKTPQSGVI 185
           RDNY DLK++A VFG+SAD+  AQK+FQ KQ+LPYDLLSD  RE IG LG KKTP SG+I
Sbjct: 179 RDNYNDLKKYAVVFGISADSVSAQKSFQEKQNLPYDLLSDKNRELIGALGCKKTPTSGII 238

Query: 186 RSHWVFSEGKLRFKRVKISPETSVADGKKEVLELAKDLEKDFEEEK 231
           RSH++   GKL+FKRVKISPE SV+D KKEVLE++K  E D +EE+
Sbjct: 239 RSHFIIVNGKLKFKRVKISPEVSVSDCKKEVLEISKS-ESDVKEER 283

>ADL018W Chr4 (678193..678927) [735 bp, 244 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL010W (DOT5)
          Length = 244

 Score =  234 bits (597), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 124/232 (53%), Positives = 156/232 (67%), Gaps = 12/232 (5%)

Query: 2   VELRRSNRLAASKKLGKGEKP-SVEPPAKKLKISRKNKSEDKIE-DKTEDEVQDKP---- 55
            ELRRS RLA  K     E   S  P  K+++ + K  +  K+  D  +  V + P    
Sbjct: 3   TELRRSTRLATRKASDASEYAESKLPLTKRVRKAPKTDAPKKVATDAPKKVVTEAPKKEA 62

Query: 56  -ADKSEDEP-----TEEPNPASSELEVGDDIPDLILKNQDDKDISLKELAKKNRIVVFFA 109
            A K  + P      E       EL+VGD +P++ LKNQD  D+ L ++ KKN+IVV FA
Sbjct: 63  GAAKKVETPKKAAAAEASTGPGGELQVGDVLPEITLKNQDQADVKLSDVVKKNKIVVLFA 122

Query: 110 YPKASTPGCTRQVCGYRDNYEDLKEHAAVFGLSADTTKAQKNFQTKQSLPYDLLSDPKRE 169
           YPKASTPGCTRQ CG+RDNY++L++HA VFG+SAD+ K+QK+FQ KQ LP+DLLSDPKRE
Sbjct: 123 YPKASTPGCTRQACGFRDNYQELQKHAVVFGISADSVKSQKSFQQKQKLPFDLLSDPKRE 182

Query: 170 FIGLLGAKKTPQSGVIRSHWVFSEGKLRFKRVKISPETSVADGKKEVLELAK 221
            IG LGA+KT Q+GVIRSHWVF +GKL  KR+KISPE S+ADG  EVL  AK
Sbjct: 183 LIGALGARKTAQTGVIRSHWVFVDGKLGSKRIKISPEMSIADGLSEVLLFAK 234

>ZYRO0C05214g Chr3 (407597..408409) [813 bp, 270 aa] {ON} some
           similarities with uniprot|P40553 Saccharomyces
           cerevisiae YIL010W DOT5 Nuclear thiol peroxidase
          Length = 270

 Score =  235 bits (599), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 127/147 (86%)

Query: 77  GDDIPDLILKNQDDKDISLKELAKKNRIVVFFAYPKASTPGCTRQVCGYRDNYEDLKEHA 136
           GD IPD++LKNQD K+ISLK+++ +++IVV F YPKASTPGCTRQ CG+RDNYED+KEHA
Sbjct: 95  GDPIPDILLKNQDGKEISLKKVSDEHKIVVIFGYPKASTPGCTRQACGFRDNYEDIKEHA 154

Query: 137 AVFGLSADTTKAQKNFQTKQSLPYDLLSDPKREFIGLLGAKKTPQSGVIRSHWVFSEGKL 196
           AVFGLSADT  AQK FQ KQ LP+DLLSDP+R  +GLLGAKK+P+SG+IRSHWVF++G L
Sbjct: 155 AVFGLSADTVNAQKKFQEKQHLPFDLLSDPERHLVGLLGAKKSPESGIIRSHWVFADGVL 214

Query: 197 RFKRVKISPETSVADGKKEVLELAKDL 223
           + KRVKISPE S+ +GKKEVLEL K  
Sbjct: 215 KHKRVKISPEVSIEEGKKEVLELVKQF 241

>NCAS0F00810 Chr6 (165372..166067) [696 bp, 231 aa] {ON} Anc_7.126
           YIL010W
          Length = 231

 Score =  233 bits (593), Expect = 7e-77,   Method: Compositional matrix adjust.
 Identities = 121/231 (52%), Positives = 166/231 (71%), Gaps = 9/231 (3%)

Query: 1   MVELRRSNRLAASKK---LGKGEKPSVEPPAKKLKISRKNK-----SEDKIEDKTED-EV 51
           MVELRRS R++  KK   L + +   V+P  KK ++S+  K     S  K++ K +  E 
Sbjct: 1   MVELRRSGRISTLKKTHFLTEEDSEEVKPAIKKQRVSKTKKIVIKKSNGKMKPKLDGKEE 60

Query: 52  QDKPADKSEDEPTEEPNPASSELEVGDDIPDLILKNQDDKDISLKELAKKNRIVVFFAYP 111
             K   + +    +  +    EL++GDDIPD+IL +++   +SLK++ ++N+IVVFFA+P
Sbjct: 61  IVKSVKELDSTAVKNTDSIYKELQIGDDIPDIILPDEEGVSVSLKKVVEENKIVVFFAFP 120

Query: 112 KASTPGCTRQVCGYRDNYEDLKEHAAVFGLSADTTKAQKNFQTKQSLPYDLLSDPKREFI 171
           KA+TPGCTRQ CG+RDNY++LKEHAAV+G+SAD   AQK F+TKQ+LPY LLSD KR+FI
Sbjct: 121 KANTPGCTRQACGFRDNYKELKEHAAVYGISADPVTAQKKFKTKQNLPYSLLSDSKRDFI 180

Query: 172 GLLGAKKTPQSGVIRSHWVFSEGKLRFKRVKISPETSVADGKKEVLELAKD 222
           GLLGAKKTPQSGVIRS+++F +GKL+ KRVKISPE SV + +KEV   A +
Sbjct: 181 GLLGAKKTPQSGVIRSYFIFVDGKLKVKRVKISPELSVEEARKEVSAFASN 231

>Kwal_55.20839 s55 (579138..580055) [918 bp, 305 aa] {ON} YIL010W
           (DOT5) - involved in telomeric silencing [contig 138]
           FULL
          Length = 305

 Score =  221 bits (562), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 101/159 (63%), Positives = 128/159 (80%), Gaps = 1/159 (0%)

Query: 70  ASSELEVGDDIPDLILKNQDDKDISLKELAKKNRIVVFFAYPKASTPGCTRQVCGYRDNY 129
           +  ELEVGD++PD++LKNQD++++SLK++A++N++V+ F+YPKASTPGCT Q CG+RDNY
Sbjct: 43  SQGELEVGDEVPDVVLKNQDEEEVSLKKVAQENKVVIIFSYPKASTPGCTTQACGFRDNY 102

Query: 130 EDLKEHAAVFGLSADTTKAQKNFQTKQSLPYDLLSDPKREFIGLLGAKKTPQSGVIRSHW 189
           EDLKE  AVFGLSADT  AQ+ FQ   SLP+DLLSDPKRE IGLLGAKK+P SG  RSHW
Sbjct: 103 EDLKEVGAVFGLSADTPAAQRKFQDAHSLPFDLLSDPKRELIGLLGAKKSP-SGTKRSHW 161

Query: 190 VFSEGKLRFKRVKISPETSVADGKKEVLELAKDLEKDFE 228
           VF+ GKL  KR+ +SPE S+ D K E  E AK  ++D E
Sbjct: 162 VFANGKLINKRIAVSPEVSIRDAKTEAHEAAKGDDEDNE 200

>TPHA0C04330 Chr3 complement(934432..935061) [630 bp, 209 aa] {ON}
           Anc_7.126 YIL010W
          Length = 209

 Score =  204 bits (519), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 101/223 (45%), Positives = 157/223 (70%), Gaps = 14/223 (6%)

Query: 1   MVELRRSNRLAASKKLGKGEKPSVEPPAKKLKISRKNKSEDKIEDKTEDEVQDKPADKSE 60
           M E+RRS+R+A  K + + +  + E  +K  K ++    +     K E ++++   D  E
Sbjct: 1   MTEVRRSSRIANKKIIHQADVKA-EHSSKVSKKAKTTVKKTLSVSKIETDLKETQKDDYE 59

Query: 61  DEPTEEPNPASSELEVGDDIPDLILKNQDDKDISLKELAKKNRIVVFFAYPKASTPGCTR 120
                       E++VGD+IPDL L+NQ+ +++SL++LA+KN+I+  F YP+ASTPGCTR
Sbjct: 60  ------------EIQVGDEIPDLTLENQEGEELSLRDLAQKNKIITIFVYPRASTPGCTR 107

Query: 121 QVCGYRDNYEDLKEHAAVFGLSADTTKAQKNFQTKQSLPYDLLSDPKREFIGLLGAKKTP 180
           Q CG+RDN++DLK+++ + GLS D+  AQK+F+TKQ+LPYDLL D +++ I +LG KK P
Sbjct: 108 QACGFRDNFDDLKKYSLILGLSGDSITAQKHFKTKQNLPYDLLCDTEKKLITILGCKKKP 167

Query: 181 QSGVIRSHWVFSEGKLRFKRVKISPETSVADGKKEVLELAKDL 223
            SG+IRS+++F +GKL+ KRVK+SPE S+ + KKE+L+L K+L
Sbjct: 168 -SGIIRSYFIFVDGKLKLKRVKVSPEVSITESKKEILDLVKEL 209

>KLTH0F12562g Chr6 (1052954..1053835) [882 bp, 293 aa] {ON} similar
           to uniprot|P40553 Saccharomyces cerevisiae YIL010W DOT5
           Nuclear thiol peroxidase
          Length = 293

 Score =  196 bits (499), Expect = 7e-62,   Method: Compositional matrix adjust.
 Identities = 93/154 (60%), Positives = 126/154 (81%), Gaps = 1/154 (0%)

Query: 68  NPASSELEVGDDIPDLILKNQDDKDISLKELAKKNRIVVFFAYPKASTPGCTRQVCGYRD 127
           N +  ELE GD++PD++LKNQ+ +++SLK + ++N++VV FAYPKASTPGCT+Q CG+RD
Sbjct: 38  NGSKGELEEGDEVPDVVLKNQEGEEVSLKSVVQQNKVVVVFAYPKASTPGCTKQACGFRD 97

Query: 128 NYEDLKEHAAVFGLSADTTKAQKNFQTKQSLPYDLLSDPKREFIGLLGAKKTPQSGVIRS 187
           NYE+LK++AAVFGLS DT  AQ+ F+ K SLP+DLLSDP+R+ IG LGA K+P SG  RS
Sbjct: 98  NYEELKKNAAVFGLSTDTPNAQQKFKEKNSLPFDLLSDPQRKLIGPLGASKSP-SGTKRS 156

Query: 188 HWVFSEGKLRFKRVKISPETSVADGKKEVLELAK 221
           +WVF +GKLR KR+ +SPE SV++ KKE +E A+
Sbjct: 157 YWVFVQGKLRTKRISVSPEASVSEAKKEAIEAAQ 190

>NDAI0A07090 Chr1 complement(1613809..1617321) [3513 bp, 1170 aa]
           {ON} 
          Length = 1170

 Score = 31.2 bits (69), Expect = 2.9,   Method: Composition-based stats.
 Identities = 16/49 (32%), Positives = 23/49 (46%)

Query: 59  SEDEPTEEPNPASSELEVGDDIPDLILKNQDDKDISLKELAKKNRIVVF 107
           S D    + N    E E  +DI D  L+N DD    L E+ ++   +VF
Sbjct: 197 SNDHAAPQQNDEEREEETSNDIVDGTLENNDDASFRLPEMHEQQEQIVF 245

>Ecym_4301 Chr4 (644340..646034) [1695 bp, 564 aa] {ON} similar to
           Ashbya gossypii AGR079W
          Length = 564

 Score = 30.4 bits (67), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 41/74 (55%), Gaps = 9/74 (12%)

Query: 21  KPSVEPPAKKLKISRKNKSEDKIEDKTED-----EVQDKPADKSEDEPTEEPNPASSELE 75
           K SVEPP++ L +S+K++ E +   + +D     E +D P  K+   P EEPN  S   E
Sbjct: 178 KMSVEPPSQLL-VSQKHEVELEALAQADDAGGIQEDEDLPTAKTASGPLEEPNSLS---E 233

Query: 76  VGDDIPDLILKNQD 89
           V + + +L ++  D
Sbjct: 234 VAEQLEELSIETVD 247

>Kpol_1004.59 s1004 (127836..128366) [531 bp, 176 aa] {ON}
           (127836..128366) [531 nt, 177 aa]
          Length = 176

 Score = 29.6 bits (65), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 31/126 (24%), Positives = 55/126 (43%), Gaps = 9/126 (7%)

Query: 93  ISLKELAKKNRIVVFFAYPKASTPGCT-RQVCGYRDNYEDLKEHA-AVFGLSADTTKAQK 150
           I   +  K+N+ +V    P A +P C+   + GY +  ++L + A  +  L+ D   AQ+
Sbjct: 39  IDWTQFVKENKTIVITGAPAAFSPTCSISHIPGYLEKKDELLKKADQIIVLTVDNPFAQQ 98

Query: 151 NFQTKQSLP----YDLLSDPKREFIGLLGAKKTPQSGVIRS-HW--VFSEGKLRFKRVKI 203
            +  +  +         SD    FI  LG +    +GV  S  W  V  +G + +   + 
Sbjct: 99  AWARQLGVTDTTKLKFASDAGAHFIKSLGLELDVGNGVFWSGRWALVVKDGIVTYAGKEE 158

Query: 204 SPETSV 209
           +P T V
Sbjct: 159 NPATDV 164

>YLR071C Chr12 complement(275378..278626) [3249 bp, 1082 aa] {ON}
           RGR1Subunit of the RNA polymerase II mediator complex;
           associates with core polymerase subunits to form the RNA
           polymerase II holoenzyme; required for glucose
           repression, HO repression, RME1 repression and
           sporulation
          Length = 1082

 Score = 30.0 bits (66), Expect = 5.3,   Method: Composition-based stats.
 Identities = 25/120 (20%), Positives = 53/120 (44%), Gaps = 5/120 (4%)

Query: 3   ELRRSNRLAASKKLGKGEKPSVEPPAKKLKISRKNKSEDKIEDKTEDEVQDKPADKSEDE 62
           E R SN + A K   +      + P K  ++   + ++ +     ++ ++  P D S   
Sbjct: 14  EERLSNEMHALKNRSEQNGQEQQGPVKNTQLHGPSATDPETTATQKESLEMVPKDTSAAT 73

Query: 63  PTEEPNPASSELEVGDDIPDLILKNQDDKDISLKELAKKNRIVVFFAYPKASTPGCTRQV 122
            T  P PA   +E+      L+++N      ++KELA+  +  V   + +A+ P   +++
Sbjct: 74  MTSAPPPALPHVEINQVSLALVIRNL--TVFTMKELAQYMKTNV---HTQANEPNSAKKI 128

>AGL330W Chr7 (91076..94111) [3036 bp, 1011 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR274C (TAF1)
          Length = 1011

 Score = 29.6 bits (65), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 22/106 (20%), Positives = 46/106 (43%), Gaps = 24/106 (22%)

Query: 3   ELRRSNRLAASKKLGKGEKPSVEPPAKKLKISRKNKSEDKIEDKTEDEVQDKPADKSEDE 62
           +LR  +R       GKG +P       K+K+ R+ +                  DK +D 
Sbjct: 413 QLRHFHRC----HFGKGIRPGTNIVFSKIKVRRRKR------------------DKGKD- 449

Query: 63  PTEEPNPASSELEVGDDIPDLILKNQDDKDISLKELAKKNRIVVFF 108
              E    SS+L +GD +P  +++  + + I+L +    ++++ ++
Sbjct: 450 -VREIFSNSSDLTIGDSVPVFLMEYCEQQPIALSKFGMASKLINYY 494

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.308    0.129    0.356 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 26,938,572
Number of extensions: 1294578
Number of successful extensions: 15473
Number of sequences better than 10.0: 751
Number of HSP's gapped: 14308
Number of HSP's successfully gapped: 924
Length of query: 231
Length of database: 53,481,399
Length adjustment: 106
Effective length of query: 125
Effective length of database: 41,326,803
Effective search space: 5165850375
Effective search space used: 5165850375
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 64 (29.3 bits)