Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0F05346g7.127ON44744722890.0
ADL017C7.127ON44344619240.0
KLTH0F12584g7.127ON44144519070.0
Kwal_55.208437.127ON44144518920.0
Ecym_83507.127ON44544618900.0
KLLA0D14311g7.127ON44344618270.0
TDEL0H028907.127ON44244718160.0
TBLA0A009507.127ON46946818160.0
ZYRO0C05236g7.127ON44744718130.0
Kpol_1062.567.127ON45045417890.0
YPL259C (APM1)7.127ON47547417910.0
KNAG0L009507.127ON46146117730.0
Suva_16.457.127ON47847717670.0
TPHA0C043207.127ON45445617570.0
NDAI0E036807.127ON44444717510.0
Smik_6.4667.127ON47647517520.0
NCAS0E021407.127ON48144917520.0
Skud_16.197.127ON47647517440.0
KAFR0L004707.127ON46546817070.0
CAGL0K00539g7.127ON45645616800.0
Ecym_52393.165ON4644725622e-66
CAGL0C05203g3.165ON4754855013e-57
SAKL0C07414g3.165ON4824925005e-57
KLLA0C03894g3.165ON4754834995e-57
KLTH0F06534g3.165ON4664864986e-57
NCAS0C035803.165ON4913914892e-55
Kwal_33.141823.165ON4673724821e-54
TDEL0D045803.165ON4824894822e-54
SAKL0D13090g2.555ON4995224822e-54
Kpol_1045.443.165ON4694804645e-52
ZYRO0B04840g3.165ON4764904602e-51
Suva_15.1033.165ON4915024587e-51
YOL062C (APM4)3.165ON4915074552e-50
ABR047W2.555ON4984684519e-50
ADR315W3.165ON4923274509e-50
Kwal_26.81462.555ON5055364492e-49
TBLA0F008403.165ON4813844445e-49
NDAI0G029203.165ON4864944446e-49
Smik_15.963.165ON4915034448e-49
Skud_15.913.165ON4915074351e-47
KLTH0D07502g2.555ON5045434352e-47
TPHA0P006603.165ON4733804192e-45
Ecym_45912.555ON5015314184e-45
KLLA0F25432g2.555ON5075354027e-43
Kpol_1056.132.555ON5415713845e-40
TDEL0B064302.555ON5253303642e-37
ZYRO0E05874g2.555ON5493383573e-36
TPHA0I023902.555ON5593633521e-35
CAGL0K03223g2.555ON5983933494e-35
KAFR0A020602.555ON5403393432e-34
KNAG0K011503.165ON4744823384e-34
NCAS0A126502.555ON5883593161e-30
Smik_8.232.555ON6033633107e-30
Skud_8.262.555ON5963683053e-29
KNAG0C055502.555ON5823733035e-29
KAFR0C010203.165ON4284572942e-28
Suva_8.332.555ON5963702983e-28
YHL019C (APM2)2.555ON6053722941e-27
TBLA0B067602.555ON6572822452e-21
NDAI0B016102.555ON6722532311e-19
AGL061W2.522ON4113761801e-13
SAKL0A09218g2.522ON4732171571e-10
KLTH0D06556g2.522ON4563741552e-10
TDEL0A029702.522ON4963121491e-09
KLLA0E18789g2.522ON4971391445e-09
TPHA0C041302.522ON5331671445e-09
TBLA0I006202.522ON6091491411e-08
Kwal_26.79572.522ON4561321411e-08
KAFR0D035602.522ON4553821365e-08
ZYRO0B01738g2.522ON4921381232e-06
Kpol_1018.422.522ON5751461187e-06
NCAS0A048702.522ON4893231017e-04
Suva_4.5482.522ON4841341000.001
Skud_2.4192.522ON484134990.001
Ecym_72662.522ON517177980.002
CAGL0L02145g2.522ON543149930.007
YBR288C (APM3)2.522ON483136920.011
Smik_2.4302.522ON484131910.014
NDAI0K019302.522ON612155790.43
KNAG0A069702.522ON505101770.60
CAGL0B02475g8.858ON58077697.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0F05346g
         (447 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0F05346g Chr6 (413830..415173) [1344 bp, 447 aa] {ON} highly...   886   0.0  
ADL017C Chr4 complement(679085..680416) [1332 bp, 443 aa] {ON} S...   745   0.0  
KLTH0F12584g Chr6 complement(1053944..1055269) [1326 bp, 441 aa]...   739   0.0  
Kwal_55.20843 s55 complement(580157..581482) [1326 bp, 441 aa] {...   733   0.0  
Ecym_8350 Chr8 (700421..701758) [1338 bp, 445 aa] {ON} similar t...   732   0.0  
KLLA0D14311g Chr4 (1216574..1217905) [1332 bp, 443 aa] {ON} simi...   708   0.0  
TDEL0H02890 Chr8 complement(481125..482453) [1329 bp, 442 aa] {O...   704   0.0  
TBLA0A00950 Chr1 complement(210799..212208) [1410 bp, 469 aa] {O...   704   0.0  
ZYRO0C05236g Chr3 complement(408616..409959) [1344 bp, 447 aa] {...   702   0.0  
Kpol_1062.56 s1062 (126558..127910) [1353 bp, 450 aa] {ON} (1265...   693   0.0  
YPL259C Chr16 complement(51244..52671) [1428 bp, 475 aa] {ON}  A...   694   0.0  
KNAG0L00950 Chr12 complement(174410..175795) [1386 bp, 461 aa] {...   687   0.0  
Suva_16.45 Chr16 complement(66786..68222) [1437 bp, 478 aa] {ON}...   685   0.0  
TPHA0C04320 Chr3 (932871..934235) [1365 bp, 454 aa] {ON} Anc_7.1...   681   0.0  
NDAI0E03680 Chr5 complement(794613..795947) [1335 bp, 444 aa] {O...   679   0.0  
Smik_6.466 Chr6 (768507..769937) [1431 bp, 476 aa] {ON} YPL259C ...   679   0.0  
NCAS0E02140 Chr5 complement(410049..411494) [1446 bp, 481 aa] {O...   679   0.0  
Skud_16.19 Chr16 complement(30298..31728) [1431 bp, 476 aa] {ON}...   676   0.0  
KAFR0L00470 Chr12 complement(85772..87169) [1398 bp, 465 aa] {ON...   662   0.0  
CAGL0K00539g Chr11 complement(64028..65398) [1371 bp, 456 aa] {O...   651   0.0  
Ecym_5239 Chr5 complement(492091..493485) [1395 bp, 464 aa] {ON}...   221   2e-66
CAGL0C05203g Chr3 (496561..497988) [1428 bp, 475 aa] {ON} highly...   197   3e-57
SAKL0C07414g Chr3 complement(683859..685307) [1449 bp, 482 aa] {...   197   5e-57
KLLA0C03894g Chr3 complement(354889..356316) [1428 bp, 475 aa] {...   196   5e-57
KLTH0F06534g Chr6 complement(565211..566611) [1401 bp, 466 aa] {...   196   6e-57
NCAS0C03580 Chr3 complement(715761..717236) [1476 bp, 491 aa] {O...   192   2e-55
Kwal_33.14182 s33 complement(560456..561859) [1404 bp, 467 aa] {...   190   1e-54
TDEL0D04580 Chr4 (840369..841817) [1449 bp, 482 aa] {ON} Anc_3.1...   190   2e-54
SAKL0D13090g Chr4 (1093315..1094814) [1500 bp, 499 aa] {ON} weak...   190   2e-54
Kpol_1045.44 s1045 complement(103089..104498) [1410 bp, 469 aa] ...   183   5e-52
ZYRO0B04840g Chr2 (389669..391099) [1431 bp, 476 aa] {ON} highly...   181   2e-51
Suva_15.103 Chr15 complement(183026..184501) [1476 bp, 491 aa] {...   181   7e-51
YOL062C Chr15 complement(210520..211995) [1476 bp, 491 aa] {ON} ...   179   2e-50
ABR047W Chr2 (479283..480779) [1497 bp, 498 aa] {ON} Syntenic ho...   178   9e-50
ADR315W Chr4 (1259839..1261317) [1479 bp, 492 aa] {ON} Syntenic ...   177   9e-50
Kwal_26.8146 s26 (665689..667206) [1518 bp, 505 aa] {ON} YHL019C...   177   2e-49
TBLA0F00840 Chr6 (213915..215360) [1446 bp, 481 aa] {ON} Anc_3.1...   175   5e-49
NDAI0G02920 Chr7 complement(676413..677873) [1461 bp, 486 aa] {O...   175   6e-49
Smik_15.96 Chr15 complement(174750..176225) [1476 bp, 491 aa] {O...   175   8e-49
Skud_15.91 Chr15 complement(169608..171083) [1476 bp, 491 aa] {O...   172   1e-47
KLTH0D07502g Chr4 (650799..652313) [1515 bp, 504 aa] {ON} simila...   172   2e-47
TPHA0P00660 Chr16 (136114..137535) [1422 bp, 473 aa] {ON} Anc_3....   166   2e-45
Ecym_4591 Chr4 complement(1154444..1155949) [1506 bp, 501 aa] {O...   165   4e-45
KLLA0F25432g Chr6 complement(2365434..2366957) [1524 bp, 507 aa]...   159   7e-43
Kpol_1056.13 s1056 complement(30531..32156) [1626 bp, 541 aa] {O...   152   5e-40
TDEL0B06430 Chr2 (1137277..1138854) [1578 bp, 525 aa] {ON} Anc_2...   144   2e-37
ZYRO0E05874g Chr5 (452910..454559) [1650 bp, 549 aa] {ON} simila...   142   3e-36
TPHA0I02390 Chr9 (528997..530676) [1680 bp, 559 aa] {ON} Anc_2.5...   140   1e-35
CAGL0K03223g Chr11 (296371..298167) [1797 bp, 598 aa] {ON} simil...   139   4e-35
KAFR0A02060 Chr1 (428640..430262) [1623 bp, 540 aa] {ON} Anc_2.5...   136   2e-34
KNAG0K01150 Chr11 complement(225095..226519) [1425 bp, 474 aa] {...   134   4e-34
NCAS0A12650 Chr1 (2492345..2494111) [1767 bp, 588 aa] {ON} Anc_2...   126   1e-30
Smik_8.23 Chr8 complement(51372..53183) [1812 bp, 603 aa] {ON} Y...   124   7e-30
Skud_8.26 Chr8 complement(55759..57549) [1791 bp, 596 aa] {ON} Y...   122   3e-29
KNAG0C05550 Chr3 complement(1076437..1078185) [1749 bp, 582 aa] ...   121   5e-29
KAFR0C01020 Chr3 (208272..209558) [1287 bp, 428 aa] {ON} Anc_3.1...   117   2e-28
Suva_8.33 Chr8 complement(69735..71525) [1791 bp, 596 aa] {ON} Y...   119   3e-28
YHL019C Chr8 complement(67731..69548) [1818 bp, 605 aa] {ON}  AP...   117   1e-27
TBLA0B06760 Chr2 (1594957..1596930) [1974 bp, 657 aa] {ON} Anc_2...    99   2e-21
NDAI0B01610 Chr2 complement(384287..386305) [2019 bp, 672 aa] {O...    94   1e-19
AGL061W Chr7 (593647..594882) [1236 bp, 411 aa] {ON} Syntenic ho...    74   1e-13
SAKL0A09218g Chr1 complement(802348..803734,803809..803843) [142...    65   1e-10
KLTH0D06556g Chr4 complement(570972..572342) [1371 bp, 456 aa] {...    64   2e-10
TDEL0A02970 Chr1 complement(532395..533885) [1491 bp, 496 aa] {O...    62   1e-09
KLLA0E18789g Chr5 (1669103..1670596) [1494 bp, 497 aa] {ON} simi...    60   5e-09
TPHA0C04130 Chr3 complement(886804..888405) [1602 bp, 533 aa] {O...    60   5e-09
TBLA0I00620 Chr9 complement(110231..112060) [1830 bp, 609 aa] {O...    59   1e-08
Kwal_26.7957 s26 complement(586544..587914) [1371 bp, 456 aa] {O...    59   1e-08
KAFR0D03560 Chr4 complement(695693..697060) [1368 bp, 455 aa] {O...    57   5e-08
ZYRO0B01738g Chr2 complement(139975..141453) [1479 bp, 492 aa] {...    52   2e-06
Kpol_1018.42 s1018 (137162..138889) [1728 bp, 575 aa] {ON} (1371...    50   7e-06
NCAS0A04870 Chr1 (973552..975021) [1470 bp, 489 aa] {ON} Anc_2.5...    44   7e-04
Suva_4.548 Chr4 complement(950244..951698) [1455 bp, 484 aa] {ON...    43   0.001
Skud_2.419 Chr2 complement(746943..748397) [1455 bp, 484 aa] {ON...    43   0.001
Ecym_7266 Chr7 (559988..560022,560112..561630) [1554 bp, 517 aa]...    42   0.002
CAGL0L02145g Chr12 (252110..253741) [1632 bp, 543 aa] {ON} simil...    40   0.007
YBR288C Chr2 complement(778012..779463) [1452 bp, 483 aa] {ON}  ...    40   0.011
Smik_2.430 Chr2 complement(763687..765141) [1455 bp, 484 aa] {ON...    40   0.014
NDAI0K01930 Chr11 (437535..439373) [1839 bp, 612 aa] {ON} Anc_2....    35   0.43 
KNAG0A06970 Chr1 complement(1086674..1088191) [1518 bp, 505 aa] ...    34   0.60 
CAGL0B02475g Chr2 (236029..237771) [1743 bp, 580 aa] {ON} highly...    31   7.1  

>SAKL0F05346g Chr6 (413830..415173) [1344 bp, 447 aa] {ON} highly
           similar to uniprot|Q00776 Saccharomyces cerevisiae
           YPL259C APM1 medium subunit of the clathrin- associated
           protein complex
          Length = 447

 Score =  886 bits (2289), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 429/447 (95%), Positives = 429/447 (95%)

Query: 1   MASCIYFCDSKGKKILSRRYKDDIPTNAIDKFPMLLVEREQESSVIPPCLAHNGIQYLFV 60
           MASCIYFCDSKGKKILSRRYKDDIPTNAIDKFPMLLVEREQESSVIPPCLAHNGIQYLFV
Sbjct: 1   MASCIYFCDSKGKKILSRRYKDDIPTNAIDKFPMLLVEREQESSVIPPCLAHNGIQYLFV 60

Query: 61  QHNDLYVLTMTRSLSTNVAQLFAFXXXXXXXXXXXXXXXXXXSIRDNFVIIYELLDEMMD 120
           QHNDLYVLTMTRSLSTNVAQLFAF                  SIRDNFVIIYELLDEMMD
Sbjct: 61  QHNDLYVLTMTRSLSTNVAQLFAFLYKVVEVLTEYVKVVEEESIRDNFVIIYELLDEMMD 120

Query: 121 YGIPQITETKMLKQYITQKSFKLMKSAKKSKNVIRPPIALTNSVSWRPEGIMYKKNEAFL 180
           YGIPQITETKMLKQYITQKSFKLMKSAKKSKNVIRPPIALTNSVSWRPEGIMYKKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLMKSAKKSKNVIRPPIALTNSVSWRPEGIMYKKNEAFL 180

Query: 181 DVVESINMLITQQGQVLRSEILGKVKVKSHLSGMPDLKLGLNDKGIFSNHVSGGVEDEAD 240
           DVVESINMLITQQGQVLRSEILGKVKVKSHLSGMPDLKLGLNDKGIFSNHVSGGVEDEAD
Sbjct: 181 DVVESINMLITQQGQVLRSEILGKVKVKSHLSGMPDLKLGLNDKGIFSNHVSGGVEDEAD 240

Query: 241 DLSATGKKKANIELEDLKFHQCVRLSKFENEKIITFIPPDGDFELMSYRLTTPIKPLIWC 300
           DLSATGKKKANIELEDLKFHQCVRLSKFENEKIITFIPPDGDFELMSYRLTTPIKPLIWC
Sbjct: 241 DLSATGKKKANIELEDLKFHQCVRLSKFENEKIITFIPPDGDFELMSYRLTTPIKPLIWC 300

Query: 301 DIKIQVHSKSRIEVHCRAKAQIKKKSTANNVEILIPVPEDADSPKFRYSHGSIKWAPEKN 360
           DIKIQVHSKSRIEVHCRAKAQIKKKSTANNVEILIPVPEDADSPKFRYSHGSIKWAPEKN
Sbjct: 301 DIKIQVHSKSRIEVHCRAKAQIKKKSTANNVEILIPVPEDADSPKFRYSHGSIKWAPEKN 360

Query: 361 AILWKIKSFPGGKEYSMAAQLGLPSVSDFEEPVMKRPVQVKFQIPYFTTSGIQVRYLKIN 420
           AILWKIKSFPGGKEYSMAAQLGLPSVSDFEEPVMKRPVQVKFQIPYFTTSGIQVRYLKIN
Sbjct: 361 AILWKIKSFPGGKEYSMAAQLGLPSVSDFEEPVMKRPVQVKFQIPYFTTSGIQVRYLKIN 420

Query: 421 EPKMQYQSYPWVRYITQSGDDYTIRMN 447
           EPKMQYQSYPWVRYITQSGDDYTIRMN
Sbjct: 421 EPKMQYQSYPWVRYITQSGDDYTIRMN 447

>ADL017C Chr4 complement(679085..680416) [1332 bp, 443 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL259C
           (APM1)
          Length = 443

 Score =  745 bits (1924), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/446 (79%), Positives = 395/446 (88%), Gaps = 3/446 (0%)

Query: 1   MASCIYFCDSKGKKILSRRYKDDIPTNAIDKFPMLLVEREQESSVIPPCLAHNGIQYLFV 60
           M S IYFCDSKGK +LSRRYKDDIP NAI++FP LL+E+EQESSV+PPC + NG+QYLF+
Sbjct: 1   MTSGIYFCDSKGKLLLSRRYKDDIPANAIEQFPHLLIEKEQESSVLPPCFSFNGVQYLFI 60

Query: 61  QHNDLYVLTMTRSLSTNVAQLFAFXXXXXXXXXXXXXXXXXXSIRDNFVIIYELLDEMMD 120
           QHNDLYVLT+T+S+S NVAQ+F++                  SI+DNFVIIYELLDEMMD
Sbjct: 61  QHNDLYVLTLTKSMSINVAQVFSYLHKLIEVLEEYMKVVEEESIKDNFVIIYELLDEMMD 120

Query: 121 YGIPQITETKMLKQYITQKSFKLMKSAKKSKNVIRPPIALTNSVSWRPEGIMYKKNEAFL 180
           +GIPQIT+TKML+QYITQKSFKL++SAKK KNV+RPP  LTNSVSWRPEGI+YKKNEAFL
Sbjct: 121 HGIPQITDTKMLRQYITQKSFKLIRSAKKKKNVVRPPATLTNSVSWRPEGIVYKKNEAFL 180

Query: 181 DVVESINMLITQQGQVLRSEILGKVKVKSHLSGMPDLKLGLNDKGIFSNHVSGGVEDEAD 240
           DVVESINML+TQQGQVLRSEILGKVKVKS LSGMPDLKLGLNDKGIF+       E+ A 
Sbjct: 181 DVVESINMLLTQQGQVLRSEILGKVKVKSRLSGMPDLKLGLNDKGIFAQGDDDDDEEGA- 239

Query: 241 DLSATGKKKANIELEDLKFHQCVRLSKFENEKIITFIPPDGDFELMSYRLTTPIKPLIWC 300
             S   KKK+NIELEDLKFHQCVRL+KFENEKIITFIPPDGDFELMSYRL+TPIKPLIWC
Sbjct: 240 --SGGTKKKSNIELEDLKFHQCVRLTKFENEKIITFIPPDGDFELMSYRLSTPIKPLIWC 297

Query: 301 DIKIQVHSKSRIEVHCRAKAQIKKKSTANNVEILIPVPEDADSPKFRYSHGSIKWAPEKN 360
           D+K+QVHS+SRIE+HCRAKAQIKKKSTANNVEILIPVPEDADSPKFRYSHG+IKW P +N
Sbjct: 298 DVKLQVHSRSRIEIHCRAKAQIKKKSTANNVEILIPVPEDADSPKFRYSHGTIKWVPSQN 357

Query: 361 AILWKIKSFPGGKEYSMAAQLGLPSVSDFEEPVMKRPVQVKFQIPYFTTSGIQVRYLKIN 420
           AILWKIKSFPGGK+YSMAA++GLPSVSD  +  +KRPVQ+KFQIPYFTTSGIQVRYLKIN
Sbjct: 358 AILWKIKSFPGGKDYSMAAEMGLPSVSDNSDHKLKRPVQIKFQIPYFTTSGIQVRYLKIN 417

Query: 421 EPKMQYQSYPWVRYITQSGDDYTIRM 446
           EPKMQY SYPWVRYITQSGDDYTIRM
Sbjct: 418 EPKMQYNSYPWVRYITQSGDDYTIRM 443

>KLTH0F12584g Chr6 complement(1053944..1055269) [1326 bp, 441 aa]
           {ON} highly similar to uniprot|Q00776 Saccharomyces
           cerevisiae YPL259C APM1 medium subunit of the clathrin-
           associated protein complex
          Length = 441

 Score =  739 bits (1907), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 357/445 (80%), Positives = 390/445 (87%), Gaps = 6/445 (1%)

Query: 1   MASCIYFCDSKGKKILSRRYKDDIPTNAIDKFPMLLVEREQESSVIPPCLAHNGIQYLFV 60
           MASCIYFCD+KGK ILSRRY+DD+P +AI+KFP LL+E EQESS++PPCL HNG+QYLF+
Sbjct: 1   MASCIYFCDNKGKVILSRRYRDDVPPSAIEKFPSLLLEAEQESSIVPPCLTHNGVQYLFI 60

Query: 61  QHNDLYVLTMTRSLSTNVAQLFAFXXXXXXXXXXXXXXXXXXSIRDNFVIIYELLDEMMD 120
           QHND+YVLTM+RSLS NVAQ+F+F                  SIRDNFVIIYELLDEM+D
Sbjct: 61  QHNDIYVLTMSRSLSINVAQVFSFLYKLVEVLAEYVKTVEEESIRDNFVIIYELLDEMLD 120

Query: 121 YGIPQITETKMLKQYITQKSFKLMKSAKKSKNVIRPPIALTNSVSWRPEGIMYKKNEAFL 180
           YGIPQITETKMLKQYITQKS+KL+KSAKKSKNVIRPP  LT SVSWRPEGI YKKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSYKLIKSAKKSKNVIRPPSQLTKSVSWRPEGITYKKNEAFL 180

Query: 181 DVVESINMLITQQGQVLRSEILGKVKVKSHLSGMPDLKLGLNDKGIFSNHVSGGVEDEAD 240
           DV ESINMLIT  GQVLRSEILGKV V+S LSGMPDLKLGLNDKGIF++  S      A 
Sbjct: 181 DVTESINMLITASGQVLRSEILGKVNVRSRLSGMPDLKLGLNDKGIFTSVES------AS 234

Query: 241 DLSATGKKKANIELEDLKFHQCVRLSKFENEKIITFIPPDGDFELMSYRLTTPIKPLIWC 300
              AT  KK+NIELEDLKFHQCVRLSKFENEKIITFIPPDGDFELM+YRL+TPIKPLIWC
Sbjct: 235 SSEATEGKKSNIELEDLKFHQCVRLSKFENEKIITFIPPDGDFELMNYRLSTPIKPLIWC 294

Query: 301 DIKIQVHSKSRIEVHCRAKAQIKKKSTANNVEILIPVPEDADSPKFRYSHGSIKWAPEKN 360
           D KIQVHS+SRIE+HCRAKAQIKKKSTANNVEILIPVPEDADSPKFRYSHGS+K+ PEK+
Sbjct: 295 DAKIQVHSQSRIEIHCRAKAQIKKKSTANNVEILIPVPEDADSPKFRYSHGSLKYVPEKS 354

Query: 361 AILWKIKSFPGGKEYSMAAQLGLPSVSDFEEPVMKRPVQVKFQIPYFTTSGIQVRYLKIN 420
           AILWKIK+F GGKEYS AAQLGLPS++D E P  KRP+QVKFQIPYFTTSGIQVRYLKIN
Sbjct: 355 AILWKIKTFNGGKEYSFAAQLGLPSMTDAEVPRAKRPIQVKFQIPYFTTSGIQVRYLKIN 414

Query: 421 EPKMQYQSYPWVRYITQSGDDYTIR 445
           EPK+QYQSYPWVRYITQSGDDYTIR
Sbjct: 415 EPKLQYQSYPWVRYITQSGDDYTIR 439

>Kwal_55.20843 s55 complement(580157..581482) [1326 bp, 441 aa] {ON}
           YPL259C (APM1) - medium subunit of the
           clathrin-associated protein complex [contig 138] FULL
          Length = 441

 Score =  733 bits (1892), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/445 (77%), Positives = 389/445 (87%), Gaps = 6/445 (1%)

Query: 1   MASCIYFCDSKGKKILSRRYKDDIPTNAIDKFPMLLVEREQESSVIPPCLAHNGIQYLFV 60
           MASCIYFCD+ GK ILSRRY+DD+P +AI++FP LL+E EQESSV+PPCL HNG+QY+F+
Sbjct: 1   MASCIYFCDNTGKVILSRRYRDDVPPSAIERFPALLLEAEQESSVVPPCLTHNGLQYMFI 60

Query: 61  QHNDLYVLTMTRSLSTNVAQLFAFXXXXXXXXXXXXXXXXXXSIRDNFVIIYELLDEMMD 120
           QHND+YVLTM+RSLS NVAQ+F+F                  SIRDNFVIIYELLDEM+D
Sbjct: 61  QHNDIYVLTMSRSLSINVAQVFSFLYKLVEVLAEYLKTVEEESIRDNFVIIYELLDEMLD 120

Query: 121 YGIPQITETKMLKQYITQKSFKLMKSAKKSKNVIRPPIALTNSVSWRPEGIMYKKNEAFL 180
           YGIPQITETKMLKQYITQKS+KL+KS KKSKNV+RPP  LT SVSWRPEGI YKKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSYKLIKSVKKSKNVVRPPAQLTKSVSWRPEGITYKKNEAFL 180

Query: 181 DVVESINMLITQQGQVLRSEILGKVKVKSHLSGMPDLKLGLNDKGIFSNHVSGGVEDEAD 240
           DV ESINMLIT  GQVLRSEILGKVKV+S LSGMPDLKLGLNDKGIF++      E+  +
Sbjct: 181 DVTESINMLITASGQVLRSEILGKVKVRSRLSGMPDLKLGLNDKGIFTS------EEGGN 234

Query: 241 DLSATGKKKANIELEDLKFHQCVRLSKFENEKIITFIPPDGDFELMSYRLTTPIKPLIWC 300
           +      KK+NIELEDL+FHQCVRLSKFENEKII+FIPPDGDF+LM+YRL+TPIKPLIWC
Sbjct: 235 NAEGGSGKKSNIELEDLQFHQCVRLSKFENEKIISFIPPDGDFDLMNYRLSTPIKPLIWC 294

Query: 301 DIKIQVHSKSRIEVHCRAKAQIKKKSTANNVEILIPVPEDADSPKFRYSHGSIKWAPEKN 360
           D KIQVHS+SRIE+HCRAKAQIKKKSTANNVEILIPVPEDADSPKFRYSHGS+K+ PEK+
Sbjct: 295 DAKIQVHSQSRIEIHCRAKAQIKKKSTANNVEILIPVPEDADSPKFRYSHGSLKYVPEKS 354

Query: 361 AILWKIKSFPGGKEYSMAAQLGLPSVSDFEEPVMKRPVQVKFQIPYFTTSGIQVRYLKIN 420
           AILW+IK+F GGKEYS AAQLGLPS++D E P  KRP+QVKFQIPYFTTSGIQVRYLK++
Sbjct: 355 AILWRIKTFNGGKEYSFAAQLGLPSMTDVEVPKAKRPIQVKFQIPYFTTSGIQVRYLKVH 414

Query: 421 EPKMQYQSYPWVRYITQSGDDYTIR 445
           EPK+QYQSYPWVRYITQSGDDYTIR
Sbjct: 415 EPKLQYQSYPWVRYITQSGDDYTIR 439

>Ecym_8350 Chr8 (700421..701758) [1338 bp, 445 aa] {ON} similar to
           Ashbya gossypii ADL017C
          Length = 445

 Score =  732 bits (1890), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/446 (77%), Positives = 391/446 (87%), Gaps = 1/446 (0%)

Query: 1   MASCIYFCDSKGKKILSRRYKDDIPTNAIDKFPMLLVEREQESSVIPPCLAHNGIQYLFV 60
           M+S IYFCD+KGK +LSRRYKDDIP +AI++FP LL+E+EQES+VIPPC +HNG+QYLF+
Sbjct: 1   MSSGIYFCDAKGKLLLSRRYKDDIPISAIEQFPYLLIEKEQESNVIPPCFSHNGVQYLFI 60

Query: 61  QHNDLYVLTMTRSLSTNVAQLFAFXXXXXXXXXXXXXXXXXXSIRDNFVIIYELLDEMMD 120
           QHNDLY+LT+TRS+  NVAQ+F+F                  SI+DNFVIIYELLDE+MD
Sbjct: 61  QHNDLYILTLTRSMYANVAQVFSFLHTLVDVLQEYMKVVEEESIKDNFVIIYELLDEVMD 120

Query: 121 YGIPQITETKMLKQYITQKSFKLMKSAKKSKNVIRPPIALTNSVSWRPEGIMYKKNEAFL 180
            GIPQIT+TKML+QYITQKSFKL++SAKK KNV+RPP +LT +VSWRPEGI YKKNEAFL
Sbjct: 121 SGIPQITDTKMLRQYITQKSFKLIRSAKKKKNVVRPPSSLTTAVSWRPEGIKYKKNEAFL 180

Query: 181 DVVESINMLITQQGQVLRSEILGKVKVKSHLSGMPDLKLGLNDKGIFSNHVSGGVEDEAD 240
           DV+ESINM++TQQGQVLRSEILGKVKV+S LSGMPDLKLGLNDKGIF+   +   EDE  
Sbjct: 181 DVIESINMMMTQQGQVLRSEILGKVKVRSRLSGMPDLKLGLNDKGIFTQS-NEEEEDEPS 239

Query: 241 DLSATGKKKANIELEDLKFHQCVRLSKFENEKIITFIPPDGDFELMSYRLTTPIKPLIWC 300
              +  +KK+NIELEDLKFHQCVRLSKFENEKIITFIPPDGDFELMSYRL+TPIKPLIWC
Sbjct: 240 SQPSITRKKSNIELEDLKFHQCVRLSKFENEKIITFIPPDGDFELMSYRLSTPIKPLIWC 299

Query: 301 DIKIQVHSKSRIEVHCRAKAQIKKKSTANNVEILIPVPEDADSPKFRYSHGSIKWAPEKN 360
           D KIQVHS+SR+EVHCRAKAQIK KSTANNVEILIPVP DADSPKFRYSHGSIKW PEKN
Sbjct: 300 DAKIQVHSRSRVEVHCRAKAQIKAKSTANNVEILIPVPNDADSPKFRYSHGSIKWVPEKN 359

Query: 361 AILWKIKSFPGGKEYSMAAQLGLPSVSDFEEPVMKRPVQVKFQIPYFTTSGIQVRYLKIN 420
           AILWKIKSFPGGK+YSMAA++GLPSV+D  +   KRPVQ+KFQIPYFTTSGIQVRYLKIN
Sbjct: 360 AILWKIKSFPGGKDYSMAAEMGLPSVNDIADYNFKRPVQIKFQIPYFTTSGIQVRYLKIN 419

Query: 421 EPKMQYQSYPWVRYITQSGDDYTIRM 446
           EPK+QY SYPWVRYITQSG+DY IRM
Sbjct: 420 EPKLQYNSYPWVRYITQSGEDYIIRM 445

>KLLA0D14311g Chr4 (1216574..1217905) [1332 bp, 443 aa] {ON} similar
           to uniprot|Q00776 Saccharomyces cerevisiae YPL259C APM1
           medium subunit of the clathrin-associated protein
           complex
          Length = 443

 Score =  708 bits (1827), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/446 (74%), Positives = 378/446 (84%), Gaps = 3/446 (0%)

Query: 1   MASCIYFCDSKGKKILSRRYKDDIPTNAIDKFPMLLVEREQESSVIPPCLAHNGIQYLFV 60
           MAS + FCDSKGK +LSRRY+DD+  +A++ F  LL+EREQESSV+PPC  HNGI Y++V
Sbjct: 1   MASYVAFCDSKGKPLLSRRYQDDVSQSAVESFQHLLLEREQESSVMPPCFHHNGIHYMYV 60

Query: 61  QHNDLYVLTMTRSLSTNVAQLFAFXXXXXXXXXXXXXXXXXXSIRDNFVIIYELLDEMMD 120
           Q+ND+YVL +TRS+S N   +FAF                  SIRDN++IIYELLDEMMD
Sbjct: 61  QYNDVYVLALTRSVSVNATTMFAFMYKLINVVEEYVKRVEEESIRDNYIIIYELLDEMMD 120

Query: 121 YGIPQITETKMLKQYITQKSFKLMKSAKKSKNVIRPPIALTNSVSWRPEGIMYKKNEAFL 180
            G+PQ+TETKMLKQYITQKSFKL +SAKK KNV RPP  LTNSVSWRPEGI YKKNEAFL
Sbjct: 121 KGVPQVTETKMLKQYITQKSFKLTRSAKKQKNVARPPTELTNSVSWRPEGIKYKKNEAFL 180

Query: 181 DVVESINMLITQQGQVLRSEILGKVKVKSHLSGMPDLKLGLNDKGIFSNHVSGGVEDEAD 240
           DV+ESINML+TQQGQVLRSEILG VKV+S LSGMPDLKLGLNDKGIF+   +   ED  +
Sbjct: 181 DVIESINMLMTQQGQVLRSEILGTVKVRSRLSGMPDLKLGLNDKGIFT---TNDQEDSPE 237

Query: 241 DLSATGKKKANIELEDLKFHQCVRLSKFENEKIITFIPPDGDFELMSYRLTTPIKPLIWC 300
            + ++ KK +NIELEDLKFHQCVRLSKFENEKIITFIPPDG+F+LM+YRL+TPIKPLIWC
Sbjct: 238 PVVSSKKKNSNIELEDLKFHQCVRLSKFENEKIITFIPPDGEFDLMTYRLSTPIKPLIWC 297

Query: 301 DIKIQVHSKSRIEVHCRAKAQIKKKSTANNVEILIPVPEDADSPKFRYSHGSIKWAPEKN 360
           D+K+QVHS SRIE+HCRAKAQIKKKS ANNVEILIP+PEDADSP F+YS G+IKW PEKN
Sbjct: 298 DVKVQVHSGSRIEIHCRAKAQIKKKSVANNVEILIPIPEDADSPTFKYSRGNIKWVPEKN 357

Query: 361 AILWKIKSFPGGKEYSMAAQLGLPSVSDFEEPVMKRPVQVKFQIPYFTTSGIQVRYLKIN 420
           AILWK  SF GGKEYSMAAQLGLPSVSD E P +KRPVQ+KFQIPYFTTSGIQVRYLKI 
Sbjct: 358 AILWKFSSFQGGKEYSMAAQLGLPSVSDAEPPKLKRPVQIKFQIPYFTTSGIQVRYLKIE 417

Query: 421 EPKMQYQSYPWVRYITQSGDDYTIRM 446
           EPK+QY SYPWVRYITQSGDDYTIR+
Sbjct: 418 EPKLQYNSYPWVRYITQSGDDYTIRL 443

>TDEL0H02890 Chr8 complement(481125..482453) [1329 bp, 442 aa] {ON}
           Anc_7.127 YPL259C
          Length = 442

 Score =  704 bits (1816), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/447 (74%), Positives = 376/447 (84%), Gaps = 5/447 (1%)

Query: 1   MASCIYFCDSKGKKILSRRYKDDIPTNAIDKFPMLLVEREQESSVIPPCLAHNGIQYLFV 60
           M S IYFCD KG+ ILSRRY+DDIP +AID+F  LL + E+ESSVIPPCL H GIQYLF+
Sbjct: 1   MVSGIYFCDIKGRPILSRRYRDDIPLSAIDRFAPLLADLEEESSVIPPCLNHRGIQYLFI 60

Query: 61  QHNDLYVLTMTRSLSTNVAQLFAFXXXXXXXXXXXXXXXXXXSIRDNFVIIYELLDEMMD 120
           +H DLYV+ ++ SL+TN AQ+F F                  S+RDNFVIIYELLDEMMD
Sbjct: 61  EHEDLYVVALSTSLATNAAQVFTFLHKLVEALGDYLKTVEEESVRDNFVIIYELLDEMMD 120

Query: 121 YGIPQITETKMLKQYITQKSFKLMKSAKKSKNVIRPPIALTNSVSWRPEGIMYKKNEAFL 180
           YGIPQITETKMLKQYITQKSFKL+K+ KK K   RPP  LTNSVSWR +GI YKKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLIKAVKKVKATARPPTGLTNSVSWRADGITYKKNEAFL 180

Query: 181 DVVESINMLITQQGQVLRSEILGKVKVKSHLSGMPDLKLGLNDKGIFSNHVSGGVEDEAD 240
           D+VESINM++ QQGQVLRSEI+G+V V+S LSGMPDLKLG+NDKGIF+     G     +
Sbjct: 181 DIVESINMVMNQQGQVLRSEIIGQVIVRSRLSGMPDLKLGINDKGIFTRDPETG-----E 235

Query: 241 DLSATGKKKANIELEDLKFHQCVRLSKFENEKIITFIPPDGDFELMSYRLTTPIKPLIWC 300
                GKKK++ ELEDLKFHQCVRLSKFENEKIITFIPPDG+FELMSYRLTTP+KPLIWC
Sbjct: 236 SQVTAGKKKSSAELEDLKFHQCVRLSKFENEKIITFIPPDGEFELMSYRLTTPVKPLIWC 295

Query: 301 DIKIQVHSKSRIEVHCRAKAQIKKKSTANNVEILIPVPEDADSPKFRYSHGSIKWAPEKN 360
           D+ +QVHSKSRIE+HCRAKAQIKKKS ANNVEILIPVP+DAD+P FRYSHGSIKW PEKN
Sbjct: 296 DVNVQVHSKSRIEIHCRAKAQIKKKSVANNVEILIPVPDDADTPSFRYSHGSIKWVPEKN 355

Query: 361 AILWKIKSFPGGKEYSMAAQLGLPSVSDFEEPVMKRPVQVKFQIPYFTTSGIQVRYLKIN 420
           AILWKI+SF GGKEYSMAAQ+GLPS++  E+P  KRPVQVKFQIPYFTTSGIQVRYLKIN
Sbjct: 356 AILWKIRSFYGGKEYSMAAQMGLPSINGVEKPKFKRPVQVKFQIPYFTTSGIQVRYLKIN 415

Query: 421 EPKMQYQSYPWVRYITQSGDDYTIRMN 447
           EPK+QY+SYPWVRYITQ+GDDYTIR+N
Sbjct: 416 EPKLQYKSYPWVRYITQNGDDYTIRLN 442

>TBLA0A00950 Chr1 complement(210799..212208) [1410 bp, 469 aa] {ON}
           Anc_7.127 YPL259C
          Length = 469

 Score =  704 bits (1816), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/468 (72%), Positives = 385/468 (82%), Gaps = 21/468 (4%)

Query: 1   MASCIYFCDSKGKKILSRRYKDDIPTNAIDKFPMLLVEREQESSVIPPCLAHNGIQYLFV 60
           M S I FCDSKGK++LSR+Y+DDIP  AID F  LL++ E+ESSV+PPCL HNGI YLF+
Sbjct: 1   MVSSISFCDSKGKQLLSRKYRDDIPLTAIDNFATLLMKLEEESSVVPPCLTHNGIHYLFI 60

Query: 61  QHNDLYVLTMTRSLSTNVAQLFAFXXXXXXXXXXXXXXXXXXSIRDNFVIIYELLDEMMD 120
           QHNDLY++ +T SLSTN +Q+F F                  SIRDNFVIIYELLDEMMD
Sbjct: 61  QHNDLYIVALTTSLSTNASQVFTFLHKLVEVMSEYLKDVEEESIRDNFVIIYELLDEMMD 120

Query: 121 YGIPQITETKMLKQYITQKSFKLMKSAKKSKNVIRPPIALTNSVSWRPEGIMYKKNEAFL 180
           YGIPQITETKMLKQYITQKSFKL+K+AKK +N  RPP ALTNSVSWRPEGI YKKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLVKAAKKKRNAARPPQALTNSVSWRPEGIKYKKNEAFL 180

Query: 181 DVVESINMLITQQGQVLRSEILGKVKVKSHLSGMPDLKLGLNDKGIFSNHV--------- 231
           D+VESINML+TQQGQVLRSEI+G+VKV+S LSGMPDLKLG+NDKGIFS ++         
Sbjct: 181 DIVESINMLMTQQGQVLRSEIIGEVKVRSRLSGMPDLKLGINDKGIFSKYLESTSSNSNS 240

Query: 232 ------------SGGVEDEADDLSATGKKKANIELEDLKFHQCVRLSKFENEKIITFIPP 279
                       S   +        + +K +N+ELEDLKFHQCVRLSKFENEKIITFIPP
Sbjct: 241 NDDNSNEVNSSKSSTPQPSTGQDEGSSRKTSNVELEDLKFHQCVRLSKFENEKIITFIPP 300

Query: 280 DGDFELMSYRLTTPIKPLIWCDIKIQVHSKSRIEVHCRAKAQIKKKSTANNVEILIPVPE 339
           DG+FELMSYRLTTPIKPLIWCD+ I VHSKSR+E+HCRAKAQIKKKS ANNVEILIPVP+
Sbjct: 301 DGNFELMSYRLTTPIKPLIWCDVNIHVHSKSRVEIHCRAKAQIKKKSIANNVEILIPVPD 360

Query: 340 DADSPKFRYSHGSIKWAPEKNAILWKIKSFPGGKEYSMAAQLGLPSVSDFEEPVMKRPVQ 399
           DAD+P FRYSHGSIKW PEKNAILWKI+SF GGKEYSMAAQLGLPS+ D E+P +KRPVQ
Sbjct: 361 DADTPSFRYSHGSIKWVPEKNAILWKIRSFAGGKEYSMAAQLGLPSIDDNEKPKLKRPVQ 420

Query: 400 VKFQIPYFTTSGIQVRYLKINEPKMQYQSYPWVRYITQSGDDYTIRMN 447
           +KFQIPYFTTSGIQVRYLK+NEPK+QY+SYPWVRYITQSGDDYTIR+N
Sbjct: 421 IKFQIPYFTTSGIQVRYLKVNEPKLQYKSYPWVRYITQSGDDYTIRLN 468

>ZYRO0C05236g Chr3 complement(408616..409959) [1344 bp, 447 aa] {ON}
           highly similar to uniprot|Q00776 Saccharomyces
           cerevisiae YPL259C APM1 medium subunit of the clathrin-
           associated protein complex
          Length = 447

 Score =  702 bits (1813), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/447 (72%), Positives = 381/447 (85%), Gaps = 1/447 (0%)

Query: 1   MASCIYFCDSKGKKILSRRYKDDIPTNAIDKFPMLLVEREQESSVIPPCLAHNGIQYLFV 60
           M S +YFCD KG+ ILSRRY+DDIP +AIDKF  LL++ E+ESSVIPPCL+H+GIQYLF+
Sbjct: 1   MVSAVYFCDGKGRPILSRRYRDDIPISAIDKFAPLLLQLEEESSVIPPCLSHDGIQYLFI 60

Query: 61  QHNDLYVLTMTRSLSTNVAQLFAFXXXXXXXXXXXXXXXXXXSIRDNFVIIYELLDEMMD 120
           QHNDLYV+ +  SL+TNVAQ+FAF                  S+RDNF+IIYELLDEMMD
Sbjct: 61  QHNDLYVVALATSLATNVAQVFAFLHKLMEVLEEYLKSVEEESVRDNFIIIYELLDEMMD 120

Query: 121 YGIPQITETKMLKQYITQKSFKLMKSAKKSKNVIRPPIALTNSVSWRPEGIMYKKNEAFL 180
           YGIPQITETKMLKQYITQKSFKLMK+ KKSK   RPP  +TNSVSWR   I++KKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLMKAVKKSKAAPRPPTEVTNSVSWRAPNIVHKKNEAFL 180

Query: 181 DVVESINMLITQQGQVLRSEILGKVKVKSHLSGMPDLKLGLNDKGIFSNHVSGGVEDEAD 240
           D+VESINML+ QQGQVLRSEI+G++KVKS LSGMPDLKLG+NDKGIFS +V G   D   
Sbjct: 181 DIVESINMLMNQQGQVLRSEIIGQIKVKSKLSGMPDLKLGINDKGIFSKYVEGD-SDPVT 239

Query: 241 DLSATGKKKANIELEDLKFHQCVRLSKFENEKIITFIPPDGDFELMSYRLTTPIKPLIWC 300
                GKKK NIELEDLKFHQCVRLSKFENEKIITFIPPDG FELM+YRL+ P+KPLIWC
Sbjct: 240 TAVTEGKKKTNIELEDLKFHQCVRLSKFENEKIITFIPPDGAFELMNYRLSMPVKPLIWC 299

Query: 301 DIKIQVHSKSRIEVHCRAKAQIKKKSTANNVEILIPVPEDADSPKFRYSHGSIKWAPEKN 360
           D+ +QVHS+SRIE+HCRA+AQIKK+S AN+VEILIPVP+DAD+P F+Y+HGS+KW P+KN
Sbjct: 300 DVNVQVHSQSRIEIHCRARAQIKKRSIANSVEILIPVPDDADTPSFKYTHGSVKWVPQKN 359

Query: 361 AILWKIKSFPGGKEYSMAAQLGLPSVSDFEEPVMKRPVQVKFQIPYFTTSGIQVRYLKIN 420
           AILWKI+SF GGKEYSM+AQ+GLPS++  ++P +KRPVQ+KFQIPYFTTSGIQVRYLKI 
Sbjct: 360 AILWKIRSFTGGKEYSMSAQMGLPSINALDKPKVKRPVQIKFQIPYFTTSGIQVRYLKIT 419

Query: 421 EPKMQYQSYPWVRYITQSGDDYTIRMN 447
           EPK+ Y+SYPWVRYITQSGDDYTI++N
Sbjct: 420 EPKLLYKSYPWVRYITQSGDDYTIKLN 446

>Kpol_1062.56 s1062 (126558..127910) [1353 bp, 450 aa] {ON}
           (126558..127910) [1353 nt, 451 aa]
          Length = 450

 Score =  693 bits (1789), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/454 (74%), Positives = 383/454 (84%), Gaps = 13/454 (2%)

Query: 1   MASCIYFCDSKGKKILSRRYKDDIPTNAIDKFPMLLVEREQESSVIPPCLAHNGIQYLFV 60
           M S +YFCD+ GK ILSRRY+DDIP +AIDKF  +L+E E+ESSV+PPCL + GI YLF+
Sbjct: 1   MVSGVYFCDASGKPILSRRYRDDIPLSAIDKFSQILLEHEEESSVVPPCLLYQGIHYLFI 60

Query: 61  QHNDLYVLTMTRSLSTNVAQLFAFXXXXXXXXXXXXXXXXXXSIRDNFVIIYELLDEMMD 120
           QH+D+YV+ +T S  TN+AQ+F F                  SIRDNFVIIYELLDEMMD
Sbjct: 61  QHSDIYVVALTTSYQTNIAQIFMFLHQLVSVLGDYLKSVEEESIRDNFVIIYELLDEMMD 120

Query: 121 YGIPQITETKMLKQYITQKSFKLMKSAKKSKNVIRPPIALTNSVSWRPEGIMYKKNEAFL 180
           YGIPQITETKMLKQYITQKSFKL+K+AKK +N  RPP+ALTNSVSWR EGI YKKNEA+L
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLIKAAKKKRNAARPPVALTNSVSWRQEGIKYKKNEAYL 180

Query: 181 DVVESINMLITQQGQVLRSEILGKVKVKSHLSGMPDLKLGLNDKGIFSNHVSGGVEDEAD 240
           D++ESINML+ QQGQVLRSEI+G+VKVKS LSGMPDLKLG+NDKGIFS ++    E+E D
Sbjct: 181 DIIESINMLMNQQGQVLRSEIIGEVKVKSRLSGMPDLKLGINDKGIFSKYL----ENEED 236

Query: 241 ---------DLSATGKKKANIELEDLKFHQCVRLSKFENEKIITFIPPDGDFELMSYRLT 291
                    D S T  KK+NIELEDLKFHQCVRLSKFENEKIITFIPPDG+FELM+YRLT
Sbjct: 237 FSKPVQIINDDSTTNGKKSNIELEDLKFHQCVRLSKFENEKIITFIPPDGEFELMNYRLT 296

Query: 292 TPIKPLIWCDIKIQVHSKSRIEVHCRAKAQIKKKSTANNVEILIPVPEDADSPKFRYSHG 351
           TPIKPLIWCDI IQVHSKSRIE+HCRAKAQIKKKS ANNVEILIPVP+DAD+P F+YSHG
Sbjct: 297 TPIKPLIWCDINIQVHSKSRIEIHCRAKAQIKKKSIANNVEILIPVPDDADTPTFKYSHG 356

Query: 352 SIKWAPEKNAILWKIKSFPGGKEYSMAAQLGLPSVSDFEEPVMKRPVQVKFQIPYFTTSG 411
           SIKW PEKNAILWK++SF GGKEYSM AQLGLPSV   E P +KRPVQ+KFQIPYFTTSG
Sbjct: 357 SIKWLPEKNAILWKLRSFAGGKEYSMTAQLGLPSVDGIEPPKVKRPVQIKFQIPYFTTSG 416

Query: 412 IQVRYLKINEPKMQYQSYPWVRYITQSGDDYTIR 445
           IQVRYLKINEPK+QY+S+PWVRYITQSGDDYTIR
Sbjct: 417 IQVRYLKINEPKLQYKSFPWVRYITQSGDDYTIR 450

>YPL259C Chr16 complement(51244..52671) [1428 bp, 475 aa] {ON}
           APM1Mu1-like medium subunit of the clathrin-associated
           protein complex (AP-1); binds clathrin; involved in
           clathrin-dependent Golgi protein sorting
          Length = 475

 Score =  694 bits (1791), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/474 (69%), Positives = 385/474 (81%), Gaps = 28/474 (5%)

Query: 1   MASCIYFCDSKGKKILSRRYKDDIPTNAIDKFPMLLVEREQESSVIPPCLAHNGIQYLFV 60
           MAS +YFCD  GK +LSRRY+DDIP +AIDKFP+LL + E++S++IPPCL HNG++YLF+
Sbjct: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPILLSDLEEQSNLIPPCLNHNGLEYLFI 60

Query: 61  QHNDLYVLTMTRSLSTNVAQLFAFXXXXXXXXXXXXXXXXXXSIRDNFVIIYELLDEMMD 120
           QHNDLYV+ +  SLS N A +F F                  SIRDNFVIIYELLDE+MD
Sbjct: 61  QHNDLYVVAIVTSLSANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120

Query: 121 YGIPQITETKMLKQYITQKSFKLMKSAKKSKNVIRPPIALTNSVSWRPEGIMYKKNEAFL 180
           YGIPQITETKMLKQYITQKSFKL+KSAKK +N  RPP+ALTNSVSWRPEGI +KKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLVKSAKKKRNATRPPVALTNSVSWRPEGITHKKNEAFL 180

Query: 181 DVVESINMLITQQGQVLRSEILGKVKVKSHLSGMPDLKLGLNDKGIFSNHV--------- 231
           D+VESINML+TQ+GQVLRSEI+G VKV S LSGMPDLKLG+NDKGIFS ++         
Sbjct: 181 DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDDDTNIPSA 240

Query: 232 SGGVEDEADDL---------SATGKKKANIELEDLKFHQCVRLSKFENEKIITFIPPDGD 282
           S    D   +          SAT KKK NIELEDLKFHQCVRLSKFENEKIITFIPPDG 
Sbjct: 241 SATTSDNNTETDKKPSITSSSATNKKKVNIELEDLKFHQCVRLSKFENEKIITFIPPDGK 300

Query: 283 FELMSYRLTTPIKPLIWCDIKIQVHSKSRIEVHCRAKAQIKKKSTANNVEILIPVPEDAD 342
           F+LM+YRL+T IKPLIWCD+ +QVHS SRIE+HC+AKAQIK+KSTA NVEILIPVP+DAD
Sbjct: 301 FDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEILIPVPDDAD 360

Query: 343 SPKFRYSHGSIKWAPEKNAILWKIKSFPGGKEYSMAAQLGLPSVSDFEE----------P 392
           +P F+YSHGS+K+ PEK+AILWKI+SFPGGKEYSM+A+LGLPS+S+ E+           
Sbjct: 361 TPTFKYSHGSLKYVPEKSAILWKIRSFPGGKEYSMSAELGLPSISNNEDGNRTMPKSNAE 420

Query: 393 VMKRPVQVKFQIPYFTTSGIQVRYLKINEPKMQYQSYPWVRYITQSGDDYTIRM 446
           ++K PVQ+KFQIPYFTTSGIQVRYLKINEPK+QY+SYPWVRYITQSGDDYTIR+
Sbjct: 421 ILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRL 474

>KNAG0L00950 Chr12 complement(174410..175795) [1386 bp, 461 aa] {ON}
           Anc_7.127 YPL259C
          Length = 461

 Score =  687 bits (1773), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/461 (70%), Positives = 379/461 (82%), Gaps = 14/461 (3%)

Query: 1   MASCIYFCDSKGKKILSRRYKDDIPTNAIDKFPMLLVEREQESSVIPPCLAHNGIQYLFV 60
           MAS +YFCD KGK +LSRRYKDD+P +AIDKF  LL + E ES+VIPPC+ HNGI+YLF+
Sbjct: 1   MASAVYFCDDKGKPLLSRRYKDDVPLSAIDKFSTLLTDLEDESAVIPPCINHNGIEYLFI 60

Query: 61  QHNDLYVLTMTRSLSTNVAQLFAFXXXXXXXXXXXXXXXXXXSIRDNFVIIYELLDEMMD 120
           QHNDLYV+ +  SL+ N+A++FAF                  SIRDNFVIIYEL+DEMMD
Sbjct: 61  QHNDLYVVALATSLTVNIAEVFAFLHKLMGVLGEYLKTVEEESIRDNFVIIYELMDEMMD 120

Query: 121 YGIPQITETKMLKQYITQKSFKLMKSAKKSKNVIRPPIALTNSVSWRPEGIMYKKNEAFL 180
           YGIPQITE +MLK+YITQKSFKL K+ KK +N  RPP  L NSVSWR EGI YKKNEAFL
Sbjct: 121 YGIPQITEPRMLKKYITQKSFKLEKAHKKKRNAARPPSELNNSVSWRAEGIKYKKNEAFL 180

Query: 181 DVVESINMLITQQGQVLRSEILGKVKVKSHLSGMPDLKLGLNDKGIFSNHVSGG-----V 235
           D+VESINMLITQ+GQVLRSEI+G VK+KS LSGMPDLKLG+ND+GIF+ ++ G      +
Sbjct: 181 DIVESINMLITQKGQVLRSEIIGAVKIKSRLSGMPDLKLGINDRGIFTKYLEGNNIGVNI 240

Query: 236 EDEADDLSATG---------KKKANIELEDLKFHQCVRLSKFENEKIITFIPPDGDFELM 286
            D  +  S            K+K NIELEDLKFHQCVRLSKFENEKIITFIPPDG+F+LM
Sbjct: 241 PDPQEHGSGVAESSITNDGKKRKTNIELEDLKFHQCVRLSKFENEKIITFIPPDGEFDLM 300

Query: 287 SYRLTTPIKPLIWCDIKIQVHSKSRIEVHCRAKAQIKKKSTANNVEILIPVPEDADSPKF 346
           +YRLTT IKPLIWCD+ IQVHSKSRIE+ CRAKAQIKKKS A NV+ILIPVP+DAD+P F
Sbjct: 301 NYRLTTSIKPLIWCDVSIQVHSKSRIEIRCRAKAQIKKKSVAANVQILIPVPDDADTPSF 360

Query: 347 RYSHGSIKWAPEKNAILWKIKSFPGGKEYSMAAQLGLPSVSDFEEPVMKRPVQVKFQIPY 406
           +YSHGSIK+ PE++AILWKIKSFPGGKEY+M A++GLPS+  +EEP +KRPVQVKF+IPY
Sbjct: 361 KYSHGSIKYVPEQSAILWKIKSFPGGKEYAMFAEMGLPSMDSYEEPKVKRPVQVKFEIPY 420

Query: 407 FTTSGIQVRYLKINEPKMQYQSYPWVRYITQSGDDYTIRMN 447
           FTTSGIQVRYLKINEPK+QY+SYPWVRYITQSGDDYTIR+N
Sbjct: 421 FTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRVN 461

>Suva_16.45 Chr16 complement(66786..68222) [1437 bp, 478 aa] {ON}
           YPL259C (REAL)
          Length = 478

 Score =  685 bits (1767), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/477 (68%), Positives = 382/477 (80%), Gaps = 31/477 (6%)

Query: 1   MASCIYFCDSKGKKILSRRYKDDIPTNAIDKFPMLLVEREQESSVIPPCLAHNGIQYLFV 60
           MAS +YFCD  GK +LSRRY+DDIP +AIDKFP LL + E++S++IPPCL HNG++YLF+
Sbjct: 1   MASAVYFCDHDGKPLLSRRYRDDIPLSAIDKFPTLLSDLEEQSNLIPPCLNHNGLEYLFI 60

Query: 61  QHNDLYVLTMTRSLSTNVAQLFAFXXXXXXXXXXXXXXXXXXSIRDNFVIIYELLDEMMD 120
           QHNDLY++ +  SLS N A +F F                  SIRDNFVIIYELLDE+MD
Sbjct: 61  QHNDLYLVAIATSLSANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120

Query: 121 YGIPQITETKMLKQYITQKSFKLMKSAKKSKNVIRPPIALTNSVSWRPEGIMYKKNEAFL 180
           YGIPQITETKMLKQYITQKSFKL+KSAKK +N  RPP+ALTNSVSWRPEGI +KKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLVKSAKKKRNATRPPVALTNSVSWRPEGISHKKNEAFL 180

Query: 181 DVVESINMLITQQGQVLRSEILGKVKVKSHLSGMPDLKLGLNDKGIFSNHV--------- 231
           D+VESINML+TQ+GQVLRSEI+G VKV S LSGMPDLKLG+NDKGIFS ++         
Sbjct: 181 DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDDSSNLPPA 240

Query: 232 -SGGVEDEADDL-----------SATGKKKANIELEDLKFHQCVRLSKFENEKIITFIPP 279
            S    D   D+           S   K+K NIELEDLKFHQCVRLSKFENEKIITFIPP
Sbjct: 241 ASTTTSDNKTDVDTDKKPSITSSSTASKRKVNIELEDLKFHQCVRLSKFENEKIITFIPP 300

Query: 280 DGDFELMSYRLTTPIKPLIWCDIKIQVHSKSRIEVHCRAKAQIKKKSTANNVEILIPVPE 339
           DG F+LM+YRL+T IKPLIWCD+ +QVHS SRIE+HC+AKAQIK+KSTA NVEILIPVP+
Sbjct: 301 DGKFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEILIPVPD 360

Query: 340 DADSPKFRYSHGSIKWAPEKNAILWKIKSFPGGKEYSMAAQLGLPSVSDFEE-------- 391
           DAD+P F+YSHGS+K+ PEK+AILWK++SFPGGKEYSM+A+LGLPS+S+  +        
Sbjct: 361 DADTPTFKYSHGSLKYVPEKSAILWKLRSFPGGKEYSMSAELGLPSISNGNDGSKTIPKN 420

Query: 392 --PVMKRPVQVKFQIPYFTTSGIQVRYLKINEPKMQYQSYPWVRYITQSGDDYTIRM 446
              ++K PVQ+KFQIPYFTTSGIQVRYLKINEPK+QY+SYPWVRYITQSGDDYTIR+
Sbjct: 421 NAEILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRL 477

>TPHA0C04320 Chr3 (932871..934235) [1365 bp, 454 aa] {ON} Anc_7.127
           YPL259C
          Length = 454

 Score =  681 bits (1757), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/456 (71%), Positives = 378/456 (82%), Gaps = 12/456 (2%)

Query: 1   MASCIYFCDSKGKKILSRRYKDDIPTNAIDKFPMLLVEREQESSVIPPCLAHNGIQYLFV 60
           M S IYFCD+ GK IL+RRY+DDI  NAID F  LL++ E+E+ VIPPC+ H GI YLF+
Sbjct: 1   MVSGIYFCDNAGKPILARRYRDDISINAIDNFSQLLLQLEEETGVIPPCIMHKGIHYLFI 60

Query: 61  QHNDLYVLTMTRSLSTNVAQLFAFXXXXXXXXXXXXXXXXXXSIRDNFVIIYELLDEMMD 120
           +H+D+YV+ +T S  TNVAQ+F F                  S+RDNFVIIYELLDEMMD
Sbjct: 61  KHSDIYVVALTTSYQTNVAQIFMFLHQLVEVLEEYVKIVVEESVRDNFVIIYELLDEMMD 120

Query: 121 YGIPQITETKMLKQYITQKSFKLMKSAKKSK--NVIRPPIALTNSVSWRPEGIMYKKNEA 178
           +GIPQITETKMLK+YITQKSFKL+K++   K  N  RPP  LTNSVSWRPEGI YKKNEA
Sbjct: 121 FGIPQITETKMLKKYITQKSFKLIKTSTSKKKKNAARPPAELTNSVSWRPEGITYKKNEA 180

Query: 179 FLDVVESINMLITQQGQVLRSEILGKVKVKSHLSGMPDLKLGLNDKGIFSNHVSGGVEDE 238
           FLD++ESINML+TQQGQVLRSEI+G V+V+S LSGMPDLKLG+ND+GIFSN++    E+ 
Sbjct: 181 FLDIIESINMLVTQQGQVLRSEIVGAVRVRSRLSGMPDLKLGINDRGIFSNYLE---ENN 237

Query: 239 ADDLSATG-------KKKANIELEDLKFHQCVRLSKFENEKIITFIPPDGDFELMSYRLT 291
            D  S++         KK  IELEDLKFHQCVRLSKFENEKIITFIPPDG+F+LM+YRLT
Sbjct: 238 VDGSSSSTPIPEGVEDKKPQIELEDLKFHQCVRLSKFENEKIITFIPPDGEFDLMNYRLT 297

Query: 292 TPIKPLIWCDIKIQVHSKSRIEVHCRAKAQIKKKSTANNVEILIPVPEDADSPKFRYSHG 351
           TPIKPLIWCD+ IQVHSKSRIE+HCRAKAQIKKKS ANNVEILIPVP+DAD+P+FRYSHG
Sbjct: 298 TPIKPLIWCDVNIQVHSKSRIEIHCRAKAQIKKKSIANNVEILIPVPDDADTPQFRYSHG 357

Query: 352 SIKWAPEKNAILWKIKSFPGGKEYSMAAQLGLPSVSDFEEPVMKRPVQVKFQIPYFTTSG 411
           SIKW PEKNAILWK++SF GGKEYSM+AQL LPSV   E P ++RPVQVKFQIPYFTTSG
Sbjct: 358 SIKWLPEKNAILWKLRSFAGGKEYSMSAQLHLPSVDGVEPPKVRRPVQVKFQIPYFTTSG 417

Query: 412 IQVRYLKINEPKMQYQSYPWVRYITQSGDDYTIRMN 447
           IQVRYLK+NEPK+QY+SYPWVRYITQSG+DYTIR+N
Sbjct: 418 IQVRYLKVNEPKLQYKSYPWVRYITQSGEDYTIRLN 453

>NDAI0E03680 Chr5 complement(794613..795947) [1335 bp, 444 aa] {ON}
           Anc_7.127
          Length = 444

 Score =  679 bits (1751), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/447 (74%), Positives = 380/447 (85%), Gaps = 5/447 (1%)

Query: 1   MASCIYFCDSKGKKILSRRYKDDIPTNAIDKFPMLLVEREQESSVIPPCLAHNGIQYLFV 60
           MAS IYFCD KG+ +LSR+Y+DDIP  AIDKF  LL + E+ESSVIPPCL +N  QYLF+
Sbjct: 1   MASAIYFCDIKGRPLLSRKYRDDIPLTAIDKFASLLADLEEESSVIPPCLTYNNTQYLFI 60

Query: 61  QHNDLYVLTMTRSLSTNVAQLFAFXXXXXXXXXXXXXXXXXXSIRDNFVIIYELLDEMMD 120
           QH+D+Y++ +T  L TN+A++FAF                  SIRDN+VIIYELLDE+MD
Sbjct: 61  QHSDIYLVAITNLLRTNIAEVFAFLYKIIDVLGDYLKTVEEESIRDNYVIIYELLDELMD 120

Query: 121 YGIPQITETKMLKQYITQKSFKLMKSAKKSKNVIRPPIALTNSVSWRPEGIMYKKNEAFL 180
           YGIPQITETKMLKQYITQKSFKL+K+AKK +N  RPP ALT+SVSWR EGI YKKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLVKAAKKKQNAARPPSALTDSVSWRSEGIKYKKNEAFL 180

Query: 181 DVVESINMLITQQGQVLRSEILGKVKVKSHLSGMPDLKLGLNDKGIFSNHVSGGVEDEAD 240
           D+VESINML+TQ+GQ+LRSEILG VK+KS LSGMPDLKLG+NDKGIFS  ++   ED+ +
Sbjct: 181 DIVESINMLMTQKGQILRSEILGVVKIKSRLSGMPDLKLGINDKGIFSKQLT---EDDTN 237

Query: 241 DLSATGKKKANIELEDLKFHQCVRLSKFENEKIITFIPPDGDFELMSYRLTTPIKPLIWC 300
           + +AT KK+  IELEDLKFHQCVRLSKFE EKIITFIPPDGDFELM+YRL+T IKPLIWC
Sbjct: 238 N-NATSKKQNKIELEDLKFHQCVRLSKFETEKIITFIPPDGDFELMNYRLSTSIKPLIWC 296

Query: 301 DIKIQVHSKSRIEVHCRAKAQIKKKSTANNVEILIPVPEDADSPKFRYSHGSIKWAPEKN 360
           D+ +QVHS SRIE+HCRAKAQIKKKSTA NVEILIPVPEDAD+P F+YSHGSIKW PEK+
Sbjct: 297 DMNVQVHSNSRIEIHCRAKAQIKKKSTATNVEILIPVPEDADTPNFKYSHGSIKWVPEKS 356

Query: 361 AILWKIKSFPGGKEYSMAAQLGLPSVSDFEEPVM-KRPVQVKFQIPYFTTSGIQVRYLKI 419
           AILWKI+SFPGGKEYSMAA+L LPS S   E V  K+PVQVKFQIPYFTTSGIQVRYLKI
Sbjct: 357 AILWKIRSFPGGKEYSMAAELCLPSTSSKSEEVQNKKPVQVKFQIPYFTTSGIQVRYLKI 416

Query: 420 NEPKMQYQSYPWVRYITQSGDDYTIRM 446
           NEPK+QY+SYPWVRYITQSGDDYTIR+
Sbjct: 417 NEPKLQYKSYPWVRYITQSGDDYTIRL 443

>Smik_6.466 Chr6 (768507..769937) [1431 bp, 476 aa] {ON} YPL259C
           (REAL)
          Length = 476

 Score =  679 bits (1752), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/475 (68%), Positives = 380/475 (80%), Gaps = 29/475 (6%)

Query: 1   MASCIYFCDSKGKKILSRRYKDDIPTNAIDKFPMLLVEREQESSVIPPCLAHNGIQYLFV 60
           MAS +YFCD  GK +LSRRY+DD+P +AIDKF  LL + E++S++IPPCL HNG++YLF+
Sbjct: 1   MASAVYFCDHNGKPLLSRRYRDDVPLSAIDKFSTLLSDLEEQSNLIPPCLNHNGLEYLFI 60

Query: 61  QHNDLYVLTMTRSLSTNVAQLFAFXXXXXXXXXXXXXXXXXXSIRDNFVIIYELLDEMMD 120
           QHNDLY++ +  SL+ N A +F F                  SIRDNFVIIYELLDE+MD
Sbjct: 61  QHNDLYLVAIVTSLTANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120

Query: 121 YGIPQITETKMLKQYITQKSFKLMKSAKKSKNVIRPPIALTNSVSWRPEGIMYKKNEAFL 180
           YGIPQITETKMLKQYITQKSFKL+KSAKK +N  RPP+ALTNSVSWRPEGI +KKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLVKSAKKKRNATRPPVALTNSVSWRPEGITHKKNEAFL 180

Query: 181 DVVESINMLITQQGQVLRSEILGKVKVKSHLSGMPDLKLGLNDKGIFSNH---------- 230
           D+VESINML+TQ+GQVLRSEI+G VKV S LSGMPDLKLG+NDKGIFS +          
Sbjct: 181 DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDNDSNIPSA 240

Query: 231 VSGGVEDEADDLS---------ATGKKKANIELEDLKFHQCVRLSKFENEKIITFIPPDG 281
           VS    D   D            T K+K NIELEDLKFHQCVRLSKFENEKIITFIPPDG
Sbjct: 241 VSAATSDNNTDTDKKPSITSSSTTSKRKVNIELEDLKFHQCVRLSKFENEKIITFIPPDG 300

Query: 282 DFELMSYRLTTPIKPLIWCDIKIQVHSKSRIEVHCRAKAQIKKKSTANNVEILIPVPEDA 341
            F+LM+YRL+T IKPLIWCD+ +QVHS SRIE+HC+AKAQIK+KSTA NVEILIPVP+DA
Sbjct: 301 KFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEILIPVPDDA 360

Query: 342 DSPKFRYSHGSIKWAPEKNAILWKIKSFPGGKEYSMAAQLGLPSVSDFEE---------- 391
           D+P F+YSHGS+K+ PEK+AILWK++SFPGGKEYSM+A+LGLPS+S  ++          
Sbjct: 361 DTPTFKYSHGSLKYVPEKSAILWKLRSFPGGKEYSMSAELGLPSISTSKDGSRTIPKSNA 420

Query: 392 PVMKRPVQVKFQIPYFTTSGIQVRYLKINEPKMQYQSYPWVRYITQSGDDYTIRM 446
            ++K PVQ+KFQIPYFTTSGIQVRYLKINEPK+QY+SYPWVRYITQSGDDYTIR+
Sbjct: 421 KLLKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRL 475

>NCAS0E02140 Chr5 complement(410049..411494) [1446 bp, 481 aa] {ON}
           Anc_7.127
          Length = 481

 Score =  679 bits (1752), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/449 (72%), Positives = 382/449 (85%), Gaps = 3/449 (0%)

Query: 1   MASCIYFCDSKGKKILSRRYKDDIPTNAIDKFPMLLVEREQESSVIPPCLAHNGIQYLFV 60
           MAS +YFCDSKG  +L+RRY+DDIP +AI+KFP LL + E+E++++PPCL++NG+QYLF+
Sbjct: 32  MASAVYFCDSKGYPLLARRYRDDIPISAIEKFPTLLSDLEEETNLVPPCLSYNGMQYLFI 91

Query: 61  QHNDLYVLTMTRSLSTNVAQLFAFXXXXXXXXXXXXXXXXXXSIRDNFVIIYELLDEMMD 120
           QHND+Y++ +  S+S N AQ+FAF                  SIRDNFVIIYELLDE MD
Sbjct: 92  QHNDVYLVAIANSMSANAAQIFAFLYKLVDVLGNYLKTVEEESIRDNFVIIYELLDETMD 151

Query: 121 YGIPQITETKMLKQYITQKSFKLMKSAKKSKNVIRPPIALTNSVSWRPEGIMYKKNEAFL 180
           YGIPQITETKMLKQYITQKSFKL+K+AKK +N  RPP ALTNSVSWR   I YKKNEAFL
Sbjct: 152 YGIPQITETKMLKQYITQKSFKLVKAAKKKRNAARPPEALTNSVSWRSADIKYKKNEAFL 211

Query: 181 DVVESINMLITQQGQVLRSEILGKVKVKSHLSGMPDLKLGLNDKGIFSNHV---SGGVED 237
           D++ESINML+TQ+GQ+LRSEI+G+VKVKS LSGMPDLKLG+NDKGIFS H+   S   E 
Sbjct: 212 DIIESINMLMTQKGQILRSEIIGEVKVKSRLSGMPDLKLGINDKGIFSKHMDDDSLNNEG 271

Query: 238 EADDLSATGKKKANIELEDLKFHQCVRLSKFENEKIITFIPPDGDFELMSYRLTTPIKPL 297
            +   S T KKK NIELEDLKFHQCVRLSKFE EKIITFIPPDGDFELM+YRL+T IKPL
Sbjct: 272 ASVASSTTDKKKNNIELEDLKFHQCVRLSKFETEKIITFIPPDGDFELMNYRLSTSIKPL 331

Query: 298 IWCDIKIQVHSKSRIEVHCRAKAQIKKKSTANNVEILIPVPEDADSPKFRYSHGSIKWAP 357
           IWCD+ IQVHS+SRIE+HCRAKAQIKKKSTA NV+I+IPVPEDAD+P+F+YSHGSIK+ P
Sbjct: 332 IWCDMNIQVHSQSRIEIHCRAKAQIKKKSTATNVQIIIPVPEDADTPEFKYSHGSIKYVP 391

Query: 358 EKNAILWKIKSFPGGKEYSMAAQLGLPSVSDFEEPVMKRPVQVKFQIPYFTTSGIQVRYL 417
           EKN I+WKI+SFPGGKEYSM+AQ+ LPS+ + EE   KRPVQ+KFQIPYFTTSGIQV+YL
Sbjct: 392 EKNVIIWKIRSFPGGKEYSMSAQMQLPSIGNIEEHKAKRPVQIKFQIPYFTTSGIQVKYL 451

Query: 418 KINEPKMQYQSYPWVRYITQSGDDYTIRM 446
           KINEPK+QY+SYPWVRYITQSGDDYTIR+
Sbjct: 452 KINEPKLQYKSYPWVRYITQSGDDYTIRL 480

>Skud_16.19 Chr16 complement(30298..31728) [1431 bp, 476 aa] {ON}
           YPL259C (REAL)
          Length = 476

 Score =  676 bits (1744), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/475 (68%), Positives = 380/475 (80%), Gaps = 29/475 (6%)

Query: 1   MASCIYFCDSKGKKILSRRYKDDIPTNAIDKFPMLLVEREQESSVIPPCLAHNGIQYLFV 60
           MAS +YFCD  GK +LSRRY+DDIP +AIDKFP LL + E++S++IPPCL HNG++YLF+
Sbjct: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPTLLSDLEEQSNLIPPCLNHNGLEYLFI 60

Query: 61  QHNDLYVLTMTRSLSTNVAQLFAFXXXXXXXXXXXXXXXXXXSIRDNFVIIYELLDEMMD 120
           QHNDLY++ +  SL  N A +F F                  SIRDNFVIIYELLDE+MD
Sbjct: 61  QHNDLYLVAIVTSLRANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120

Query: 121 YGIPQITETKMLKQYITQKSFKLMKSAKKSKNVIRPPIALTNSVSWRPEGIMYKKNEAFL 180
           YGIPQI ETKMLKQYITQKSFKL+KSAKK +N  RPP+ALTNSVSWRPEGI++KKNEAFL
Sbjct: 121 YGIPQICETKMLKQYITQKSFKLVKSAKKKRNATRPPVALTNSVSWRPEGIIHKKNEAFL 180

Query: 181 DVVESINMLITQQGQVLRSEILGKVKVKSHLSGMPDLKLGLNDKGIFSNHV--------- 231
           D+VESINML+TQ+GQVLRSEI+G VKV S LSGMPDLKLG+NDKGIFS ++         
Sbjct: 181 DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDDDSNTPPP 240

Query: 232 -SGGVEDEADDLS---------ATGKKKANIELEDLKFHQCVRLSKFENEKIITFIPPDG 281
            S    D   D            T K+K NIELEDLKFHQCVRLSKFENEKIITFIPPDG
Sbjct: 241 TSAATSDNITDTDKKPSITSSSTTSKRKVNIELEDLKFHQCVRLSKFENEKIITFIPPDG 300

Query: 282 DFELMSYRLTTPIKPLIWCDIKIQVHSKSRIEVHCRAKAQIKKKSTANNVEILIPVPEDA 341
            F+LM+YRL+T IKPLIWCD+ +QVHS SRIE+HC+AKAQIK+KSTA NVEI+IPVP+DA
Sbjct: 301 KFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEIIIPVPDDA 360

Query: 342 DSPKFRYSHGSIKWAPEKNAILWKIKSFPGGKEYSMAAQLGLPSVS-DFE---------E 391
           D+P F+YSHGS+K+ PEK+AILWK++SFPGGKEYSM+A+LGLPS+S D E          
Sbjct: 361 DTPTFKYSHGSLKYVPEKSAILWKLRSFPGGKEYSMSAELGLPSISNDIEGHRAIPKSNA 420

Query: 392 PVMKRPVQVKFQIPYFTTSGIQVRYLKINEPKMQYQSYPWVRYITQSGDDYTIRM 446
            ++K PVQ+KFQIPYFTTSGIQVRYLKINEPK+QY+SYPWVRYITQSGDDYTIR+
Sbjct: 421 EILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRL 475

>KAFR0L00470 Chr12 complement(85772..87169) [1398 bp, 465 aa] {ON}
           Anc_7.127 YPL259C
          Length = 465

 Score =  662 bits (1707), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/468 (67%), Positives = 378/468 (80%), Gaps = 25/468 (5%)

Query: 1   MASCIYFCDSKGKKILSRRYKDDIPTNAIDKFPMLLVEREQESSVIPPCLAHNGIQYLFV 60
           MAS +YFCD KGK +LSR+Y+DDIP +AIDKF  LL ++E+ES+++PPC++HNGIQY+F+
Sbjct: 1   MASAVYFCDHKGKPLLSRKYRDDIPLSAIDKFSSLLSDKEEESNLLPPCISHNGIQYMFI 60

Query: 61  QHNDLYVLTMTRSLSTNVAQLFAFXXXXXXXXXXXXXXXXXXSIRDNFVIIYELLDEMMD 120
           QHNDLY+  +  S+  N++ +FAF                  SIRDNF+IIYELLDEMMD
Sbjct: 61  QHNDLYLAALATSVQANISLIFAFLHKIIDVLDGYLKTVEEESIRDNFIIIYELLDEMMD 120

Query: 121 YGIPQITETKMLKQYITQKSFKLMKSAKKSKNVIRPPIALTNSVSWRPEGIMYKKNEAFL 180
           YG+PQITETKMLK+YIT KSFKL K+ KK +N  RPP  LTNSVSWRPEGI YKKNEAFL
Sbjct: 121 YGLPQITETKMLKKYITTKSFKLEKAHKKKRNAARPPTELTNSVSWRPEGIKYKKNEAFL 180

Query: 181 DVVESINMLITQQGQVLRSEILGKVKVKSHLSGMPDLKLGLNDKGIFSNHVSG------- 233
           D++ESINMLITQ+GQVLRSEI+G V+VKS LSGMPDLKLG+ND+GIF+ ++ G       
Sbjct: 181 DIIESINMLITQKGQVLRSEIVGNVRVKSRLSGMPDLKLGINDRGIFTKYLEGNNIGIAK 240

Query: 234 -GVEDEADDLS--------ATGKKKANIELEDLKFHQCVRLSKFENEKIITFIPPDGDFE 284
            G +++ADD +         + K+K NIELEDLKFHQCVRLSKFENEKII+FIPPDG+F+
Sbjct: 241 NGDDEDADDTNNESSIVSEGSNKRKTNIELEDLKFHQCVRLSKFENEKIISFIPPDGEFD 300

Query: 285 LMSYRLTTPIKPLIWCDIKIQVHSKSRIEVHCRAKAQIKKKSTANNVEILIPVPEDADSP 344
           LM+YRL+T IKPLIWCD+ IQ +   RIE+HC+AKAQIKKKS A NVEILIPVPEDADSP
Sbjct: 301 LMNYRLSTSIKPLIWCDVSIQTY---RIEIHCKAKAQIKKKSIATNVEILIPVPEDADSP 357

Query: 345 KFRYSHGSIKWAPEKNAILWKIKSFPGGKEYSMAAQLGLPSVS---DFEEPV---MKRPV 398
            F+YSHG IK+ PEKN +LWKI SFPGGKEYSMAAQ+GLPS+S   D    V    K+PV
Sbjct: 358 IFKYSHGKIKYLPEKNLLLWKISSFPGGKEYSMAAQMGLPSISGEDDLNTRVSNQSKKPV 417

Query: 399 QVKFQIPYFTTSGIQVRYLKINEPKMQYQSYPWVRYITQSGDDYTIRM 446
           QVKF+IPYFTTSGIQVRYLK+NEPK+QY++YPWVRYITQSGDDYTIR+
Sbjct: 418 QVKFKIPYFTTSGIQVRYLKVNEPKLQYKTYPWVRYITQSGDDYTIRI 465

>CAGL0K00539g Chr11 complement(64028..65398) [1371 bp, 456 aa] {ON}
           highly similar to uniprot|Q00776 Saccharomyces
           cerevisiae YPL259c Clathrin coat assembly protein
          Length = 456

 Score =  651 bits (1680), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/456 (71%), Positives = 383/456 (83%), Gaps = 9/456 (1%)

Query: 1   MASCIYFCDSKGKKILSRRYKDDIPTNAIDKFPMLLVEREQESSVIPPCLAHNGIQYLFV 60
           MAS IYFCD+KG+ +LSR+Y+DDIP +AID+FP+LL   E+E+++IPPC+ HNGIQ+LF+
Sbjct: 1   MASAIYFCDNKGRPLLSRKYRDDIPFSAIDRFPILLSNFEEETNLIPPCIEHNGIQFLFI 60

Query: 61  QHNDLYVLTMTRSLSTNVAQLFAFXXXXXXXXXXXXXXXXXXSIRDNFVIIYELLDEMMD 120
           QHNDLY++ +  S+S N A +F+F                  SIRDNFVIIYELLDEMMD
Sbjct: 61  QHNDLYLVAIATSISCNAALIFSFLHKVIEVLSEYLKAVEEESIRDNFVIIYELLDEMMD 120

Query: 121 YGIPQITETKMLKQYITQKSFKLMKSAKKSKNVIRPPIALTNSVSWRPEGIMYKKNEAFL 180
           YGIPQITE KMLKQYITQKSFKL K+AKK +N  RPP +LTNSVSWRPEGI +KKNEAFL
Sbjct: 121 YGIPQITEPKMLKQYITQKSFKLKKAAKKKRNAARPPTSLTNSVSWRPEGIKHKKNEAFL 180

Query: 181 DVVESINMLITQQGQVLRSEILGKVKVKSHLSGMPDLKLGLNDKGIFSNHVSG---GV-- 235
           D++ESINML+TQ+GQVLRSEI+G+VKVKS LSGMPDLKLG+NDKG+FS ++ G   GV  
Sbjct: 181 DIIESINMLMTQKGQVLRSEIIGEVKVKSKLSGMPDLKLGINDKGLFSKYLEGDENGVPI 240

Query: 236 --EDEADDLSATGKKKAN-IELEDLKFHQCVRLSKFENEKIITFIPPDGDFELMSYRLTT 292
             +D + D S   KK++N +ELEDLKFHQCVRLSKFENEK ITFIPPDGDFELMSYRL+T
Sbjct: 241 APDDSSVDESKPKKKRSNNMELEDLKFHQCVRLSKFENEKQITFIPPDGDFELMSYRLST 300

Query: 293 PIKPLIWCDIKIQVHSKSRIEVHCRAKAQIKKKSTANNVEILIPVPEDADSPKFRYSHGS 352
            IKPLIWCD+ I+ HSKSRIE+ CRAKAQIKKKSTA NVEILIPVPEDAD+P F+YSHGS
Sbjct: 301 AIKPLIWCDVNIKTHSKSRIEIFCRAKAQIKKKSTATNVEILIPVPEDADTPVFKYSHGS 360

Query: 353 IKWAPEKNAILWKIKSFPGGKEYSMAAQLGLPSVSDFEEPV-MKRPVQVKFQIPYFTTSG 411
           IK+ PEKNAILWKI++FPG KEYSMAA++GLPS +  EE   +KRPVQVKFQIPYFTTSG
Sbjct: 361 IKYVPEKNAILWKIRTFPGDKEYSMAAEMGLPSTNAGEESEKLKRPVQVKFQIPYFTTSG 420

Query: 412 IQVRYLKINEPKMQYQSYPWVRYITQSGDDYTIRMN 447
           IQVRYLKI E  +QY+SYPWVRYIT+SGDDYTIR++
Sbjct: 421 IQVRYLKIEEKNLQYKSYPWVRYITKSGDDYTIRLS 456

>Ecym_5239 Chr5 complement(492091..493485) [1395 bp, 464 aa] {ON}
           similar to Ashbya gossypii ADR315W
          Length = 464

 Score =  221 bits (562), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 152/472 (32%), Positives = 244/472 (51%), Gaps = 36/472 (7%)

Query: 1   MASCIYFCDSKGKKILSRRYKDDIPTNAIDKFPMLLVEREQESSVIPPCLAHNGIQYLFV 60
           M S ++    +G  I+S+  KD+I     + F + ++      S   P L      +  +
Sbjct: 1   MISALFLYSPRGDLIISKLIKDNIKLGVSEIFRIQVINNLDVRS---PILTLGSTTFHHI 57

Query: 61  QHND-LYVLTMTRSLSTNVAQLFAFXXXXXXXXXXXXXXXXXXSIRDNFVIIYELLDEMM 119
           + N  L+++T++R  +T+ A ++ F                  S++ +F++ YE+LD ++
Sbjct: 58  RSNGGLWLVTVSRG-NTDSAGIWEFLYNFNKLLEVYDINSED-SLQGDFMLCYEILDIVL 115

Query: 120 DYGIPQITETKMLKQYITQKSFKLMKSAKKSKNVIRPPIALTNSVS-------------- 165
           D GIP+ TE   +  YI++K   L ++   S +++  P  L  + +              
Sbjct: 116 DNGIPRDTELTHIMPYISKK--PLSENLLGSDDILNTPSWLVKAGARGMSSENLGLTSKD 173

Query: 166 ---WRPEGIMYKKNEAFLDVVESINMLITQQGQVLRSEILGKVKVKSHLSGMPDLKLGLN 222
              WR EGI YKKNE +LDV E I++L+ + G +L+S + G V+  +HLSGMP  + G N
Sbjct: 174 MCLWRSEGIRYKKNEVYLDVFEHISILVNKDGAILKSYVDGSVQCVAHLSGMPVCQFGFN 233

Query: 223 DK-GIFSNHVSGGVEDEADDLSATGKKK----ANIELEDLKFHQCVRLSKFENEKIITFI 277
           D     SN  S G +  A++ + T   K     ++ LED KFHQCV+L KF+ E++I F+
Sbjct: 234 DYLSPSSNTQSSGNDGWAEEENGTKAIKNAITGSVILEDCKFHQCVQLDKFDQERVIRFV 293

Query: 278 PPDGDFELMSYRLTTPIK-PLIWCDIKIQVHSKSRIEVHCRAKAQIKKKSTANNVEILIP 336
           PPDG FELM Y +   +  P     +   +  KS +E     K+    K  A +VE+ IP
Sbjct: 294 PPDGLFELMKYHVRDNLNLPFKVTPMVTTLKGKS-VEYRITLKSLFPSKLCAKDVELYIP 352

Query: 337 VPEDADSPKFRYSHGSIKWAPEKNAILWKIKSFPGGKEYSMAA---QLGLPSVSDFEEPV 393
            P D  + K   S G  K+ PE+NAI+WKI  + G  E   +A    +G  + S   E  
Sbjct: 353 APPDTVNAKINVSSGKGKFIPEENAIVWKIHKYHGLTENVFSAVIVPMGNGNDSLNLEQW 412

Query: 394 MKRPVQVKFQIPYFTTSGIQVRYLKINEPKMQYQSYPWVRYITQSGDDYTIR 445
            + P+ V+F+I  F+ SG+ VRYLK+ E  + Y +  WV+YI++SG  Y +R
Sbjct: 413 SRPPISVRFEISMFSNSGLVVRYLKVMEKDLNYNTVKWVKYISKSG-AYEVR 463

>CAGL0C05203g Chr3 (496561..497988) [1428 bp, 475 aa] {ON} highly
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062c APM4
          Length = 475

 Score =  197 bits (501), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 144/485 (29%), Positives = 244/485 (50%), Gaps = 51/485 (10%)

Query: 1   MASCIYFCDSKGKKILSRRYKDDIPTNAIDKFPMLLVEREQESSVIPPCLAHNGIQYLFV 60
           M S +    S+G+ I+S+ +K+++  +  D F + ++      S   P L      +  +
Sbjct: 1   MISAVLVFSSRGELIVSKFFKNNLKRSISDIFRIQVINNLDVRS---PILTLGSTTFQHI 57

Query: 61  QHN----DLYVLTMTRSLSTNVAQLFAFXXXXXXXXXXXXXXXXXXSIRDNFVIIYELLD 116
           + N    DL+++++TRS + N   ++ F                   +++ F++ YELLD
Sbjct: 58  RSNVHGDDLWLVSVTRS-NINCGAVWEFLYKFDHMLELYGLNNEEF-LKEEFMVCYELLD 115

Query: 117 EMM-DYGIPQITE-TKMLKQYITQKSFKLMKS---AKKSKNVIRPPIA------------ 159
            M+ + G P  T+   ++K+   + S + +++   + ++KN   P I             
Sbjct: 116 VMLGENGTPMDTDPATVIKKMSVKPSKETIENFAISVQNKNSTLPKIPKFLRRTSSFLNQ 175

Query: 160 -----------LTNSVSWRPEGIMYKKNEAFLDVVESINMLITQQGQVLRSEILGKVKVK 208
                      +   + WRP+GI +KKNE FL V E I++L++++G +L+S + G + + 
Sbjct: 176 ESSNNSSGAFNMAGELPWRPKGISHKKNEIFLYVNEKISILVSKEGSILKSYVDGTIDLV 235

Query: 209 SHLSGMPDLKLGLNDKGIFSNHVSGGVEDEADDLSATGKKKA-NIELEDLKFHQCVRLSK 267
           +HLSG P  + GLND     N   G   D   +  A  K  A ++ LED KFHQCV L K
Sbjct: 236 THLSGTPVCQFGLNDSLSVKNDDYGDSFDYIKNKKAIPKAAAGSVLLEDCKFHQCVSLEK 295

Query: 268 FENEKIITFIPPDGDFELMSYRLTTPIK-PLIWCDIKIQVHSKSRIEVHCRAKAQIKKKS 326
           F+ ++II F+PPDG  ELM Y + + I  P     I     S + +E     K+    K 
Sbjct: 296 FDKDRIIKFVPPDGSMELMKYHVRSNINLPFKVSPIVTYSSSGTAVEYRITLKSLFPSKL 355

Query: 327 TANNVEILIPVPEDADSPKFRYSHGSIKWAPEKNAILWKIKSFPGGKEYSMAAQLGLPSV 386
           TA NV + IPVP +    K   S+GS K+APE+ A+LW    + G  E +++A     ++
Sbjct: 356 TAKNVTMKIPVPPETLDCKIDVSNGSCKFAPEEKAMLWTFNKYNGLTENTLSAV----TI 411

Query: 387 SDFEEPVM------KRPVQVKFQIPYFTTSGIQVRYLKINEPKMQYQSYPWVRYITQSGD 440
           +  + P +      K P+ + F+I  F+ SG+ VRY  I E + +Y++  W+RY+++SG 
Sbjct: 412 TSKDAPRLNIQQWQKPPISLDFEIMMFSNSGLVVRYFTIKESE-RYKTVKWIRYVSKSG- 469

Query: 441 DYTIR 445
            Y IR
Sbjct: 470 SYEIR 474

>SAKL0C07414g Chr3 complement(683859..685307) [1449 bp, 482 aa] {ON}
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062C APM4 Clathrin associated protein medium subunit
          Length = 482

 Score =  197 bits (500), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 141/492 (28%), Positives = 235/492 (47%), Gaps = 58/492 (11%)

Query: 1   MASCIYFCDSKGKKILSRRYKDDIPTNAIDKFPMLLVEREQESSVIPPCLAHNGIQYLFV 60
           M + ++    KG+ ++S+  +D I  +  + F + ++       V  P L      +  +
Sbjct: 1   MLNALFVFSQKGELVVSKLIRDTIKRSVAEIFRIQVI---NNLDVRSPVLTLGSTTFHHI 57

Query: 61  QHN-DLYVLTMTRSLSTNVAQLFAFXXXXXXXXXXXXXXXXXXSIRDNFVIIYELLDEMM 119
           + + +L+++ +TRS + + A ++ F                  S+++ F+  YELLD ++
Sbjct: 58  RSSSNLWIVAVTRS-NADSAAIWEFLYKFNALLEAYGLNSEE-SLKEEFMTCYELLDVVL 115

Query: 120 DYGIPQITETKMLKQYITQKSFK-----------LMKSAKKSKNVIRPPIALTNSVS--- 165
           + G+P  TE   +   ++++              LM +A       R P  L        
Sbjct: 116 ENGVPVDTELSSVASKMSRRPVVSLENNPLTDELLMSAAANVDLGFRMPKFLNKGSRSSS 175

Query: 166 ------------------WRPEGIMYKKNEAFLDVVESINMLITQQGQVLRSEILGKVKV 207
                             WR  GI YKKNE FLDV E IN+L+++ G +L+S + G V +
Sbjct: 176 SVSSPANGDEHGDPCAYPWRSSGIKYKKNEIFLDVNERINILVSKDGSILKSYVDGSVDL 235

Query: 208 KSHLSGMPDLKLGLNDK-----GIFSNHVSGGVEDEADDLSATGKKKA-NIELEDLKFHQ 261
            +HLSG P  + GLND      G  S  +    E E  +  A  K  A +++LED KFHQ
Sbjct: 236 TTHLSGTPLCQFGLNDSLSLDGGTLSRDLDFISEYEVKNKKAIPKAAAGSVQLEDCKFHQ 295

Query: 262 CVRLSKFENEKIITFIPPDGDFELMSYRLTTPIK-PLIWCDIKIQVHSKSRIEVHCRAKA 320
           CV+L++F  ++II F+PPDG FELM Y +   +  P     I     +   +E     K+
Sbjct: 296 CVQLNRFNTDRIIRFVPPDGSFELMRYHVRDNLNLPFKITPIFSVRSNNGAVEYRVALKS 355

Query: 321 QIKKKSTANNVEILIPVPEDADSPKFRYSHGSIKWAPEKNAILWKIKSFPGGKEYSMAAQ 380
               K TA +V + IPVP      K   S+G  ++ PE+NA+LWK   + G  E +++A 
Sbjct: 356 LFPSKLTAKDVVLRIPVPPGTVDCKINTSNGRCRFVPEENAVLWKFAKYQGLTENTLSA- 414

Query: 381 LGLP-------SVSDFEEPVMKRPVQVKFQIPYFTTSGIQVRYLKINEPKMQYQSYPWVR 433
           L +P       ++  +  P    P+ + F+I  F+ SG+ VR+ K++E    Y +  WV+
Sbjct: 415 LTVPMDNQSSLNLQQWSRP----PMSLTFEILMFSNSGLVVRFFKVSERDHSYHTVKWVK 470

Query: 434 YITQSGDDYTIR 445
           YI++SG  Y +R
Sbjct: 471 YISRSG-AYEVR 481

>KLLA0C03894g Chr3 complement(354889..356316) [1428 bp, 475 aa] {ON}
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062C APM4 Clathrin associated protein medium subunit,
          Length = 475

 Score =  196 bits (499), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 133/483 (27%), Positives = 239/483 (49%), Gaps = 47/483 (9%)

Query: 1   MASCIYFCDSKGKKILSRRYKDDIPTNAIDKFPMLLVEREQESSVIPPCLAHNGIQYLFV 60
           M S I+  ++KG  ++S+  KD +  +  D F   ++      S I   L     Q++  
Sbjct: 1   MLSAIFIYNAKGDLLISKLIKDHVKRSLADVFRTQVINDPHVRSPIL-TLGSTTFQHVIR 59

Query: 61  QHND---LYVLTMTRSLSTNVAQLFAFXXXXXXXXXXXXXXXXXXSIRDNFVIIYELLDE 117
           + +D   ++++ ++RS + + + ++ +                   ++D F+++YE+L+ 
Sbjct: 60  ESSDNLPMWLVAVSRS-NVDSSMIWEYLHKLYQLMEAFGINDEDV-LKDEFMLLYEILEL 117

Query: 118 MMDYGIPQITETKMLKQYITQKSFKLMKSAKKSK-----------NVIRPP--------- 157
            ++ GIPQ T+   L Q I + S K +++   SK           N+++ P         
Sbjct: 118 TLENGIPQTTD---LAQIIPRVSRKPIENNTISKSPDLDDFLSGSNILKAPKLSKRSSSS 174

Query: 158 --IALTNSVSWRPEGIMYKKNEAFLDVVESINMLITQQGQVLRSEILGKVKVKSHLSGMP 215
             ++  +   WRP G+ YKKNE +LD+ E I +L+ + G +++S + G V   SHLSGMP
Sbjct: 175 IALSSLSECPWRPSGLKYKKNEVYLDINEKITILVGKDGSIVKSFVDGSVDCVSHLSGMP 234

Query: 216 DLKLGLNDKGIFSNHVSGGVE----------DEADDLSATGKKKANIELEDLKFHQCVRL 265
             +LGLND   +S H +   E          D  +  +       ++ LED KFHQCV+L
Sbjct: 235 LCQLGLNDT--YSIHGNEKSELSIVEMMSEYDIKNKKAIPNAAAGSVILEDCKFHQCVQL 292

Query: 266 SKFENEKIITFIPPDGDFELMSYRLTTPIKPLIWCDIKIQVHSKSRIEVHCRAKAQIKKK 325
           +K+E   +I F+PPDG F+LM YR+   I        ++++   S +      ++     
Sbjct: 293 NKYEANHVIQFVPPDGPFQLMQYRVIDNINIPFNVIPEVEIVKNSTLNYKVTLRSLFPSN 352

Query: 326 STANNVEILIPVPEDADSPKFRYSHGSIKWAPEKNAILWKIKSFPGGKEYSMAAQLGLPS 385
            +A +V + IPVP       F  S G  K+   +  ++WK   + G  E +++ ++ +P+
Sbjct: 353 VSAKDVTVKIPVPPTTIKCDFNVSGGKCKYDAGEKCMVWKYNKYKGSTENTLSGKVAIPA 412

Query: 386 VSDFEEPVM---KRPVQVKFQIPYFTTSGIQVRYLKINEPKMQYQSYPWVRYITQSGDDY 442
            S     ++   + P+ + F+I  F+ SG+ VR+LK  EP++ YQ   W++YI+ SG  Y
Sbjct: 413 TSHDLSDLLRWSRPPISMGFEIVMFSNSGLVVRHLKCQEPQLNYQPVKWIKYISHSG-AY 471

Query: 443 TIR 445
            IR
Sbjct: 472 EIR 474

>KLTH0F06534g Chr6 complement(565211..566611) [1401 bp, 466 aa] {ON}
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062C APM4 Clathrin associated protein medium subunit
          Length = 466

 Score =  196 bits (498), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 137/486 (28%), Positives = 239/486 (49%), Gaps = 62/486 (12%)

Query: 1   MASCIYFCDSKGKKILSRRYKDDIPTNAIDKFPMLLVEREQESSVIPPCLAHNGIQYLFV 60
           M S ++    +G+ ++S+  +  +P +  + F + ++      S   P L      +  V
Sbjct: 1   MLSALFIFSLRGELLISKHVRSSVPKSMSEIFRIQVINNLDVRS---PVLTLGSTTFHHV 57

Query: 61  QH-NDLYVLTMTRSLSTNVAQLFAFXXXXXXXXXXXXXXXXXXSIRDNFVIIYELLDEMM 119
           +   +L+++ ++RS + + A ++ F                   ++++F+  YELLD ++
Sbjct: 58  KSPGNLWIVAVSRS-NADSAAIWEFLYKLSALLEAFGLHSEN-ELKEDFMTCYELLDIVL 115

Query: 120 DYGIPQITETKMLKQYITQKSFKLMKSAKKSKNVIRP---------PIA----------- 159
           + G+P  TE   L    ++ S K   SA++    I           P+A           
Sbjct: 116 EDGVPVDTE---LSSVASKMSVKPSASAERINTFIESGNGGTNRILPVAQFLRARSSSSN 172

Query: 160 -------LTNSVSWRPEGIMYKKNEAFLDVVESINMLITQQGQVLRSEILGKVKVKSHLS 212
                  + +++ WR  GI YKKNE FL+V E I++L+++ G +L+S + G V+  +HLS
Sbjct: 173 LHDSHSKVPSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEATTHLS 232

Query: 213 GMPDLKLGLNDKGIFSNHVSGGVEDEADDLSATGKKKA-------NIELEDLKFHQCVRL 265
           GMP  + GLND    S           D+ S T  KKA       ++ LED KFHQCV+L
Sbjct: 233 GMPVCRFGLNDSLSVSTPF-------GDNESPTTNKKAIPKAAAGSVMLEDCKFHQCVQL 285

Query: 266 SKFENEKIITFIPPDGDFELMSYRLTTPIKPLIWCDIKIQVHSKSRIEVHCRAKAQIKKK 325
            KF++E+ I FIPPDG FELM Y +   +         + +   + I+     K+    K
Sbjct: 286 DKFQSERTINFIPPDGSFELMKYHVRENLNLPFKITPVVTLFKANSIDYRVTIKSLFPSK 345

Query: 326 STANNVEILIPVPEDADSPKFRYSHGSIKWAPEKNAILWKIKSFPGGKEYSMAAQLGLP- 384
            TA +V++ IPVP +        S+G  K+ PE++AI+WK   + G  E S++A   +P 
Sbjct: 346 LTAKDVQLRIPVPPETVDCHISTSNGRCKFVPEESAIIWKFSKYQGLTENSLSAT-AVPM 404

Query: 385 -----SVSDFEEPVMKRPVQVKFQIPYFTTSGIQVRYLKINEPKMQYQSYPWVRYITQSG 439
                ++  + +P    P+ +KF+I  F+ SG+ VR+  ++E    Y+   W++Y+++SG
Sbjct: 405 KDSALNIDQWSKP----PMSLKFEIVMFSNSGLVVRFFDVSEGDRNYKMVKWIKYLSKSG 460

Query: 440 DDYTIR 445
             Y +R
Sbjct: 461 -AYEVR 465

>NCAS0C03580 Chr3 complement(715761..717236) [1476 bp, 491 aa] {ON}
           Anc_3.165
          Length = 491

 Score =  192 bits (489), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 120/391 (30%), Positives = 202/391 (51%), Gaps = 51/391 (13%)

Query: 104 IRDNFVIIYELLDEMM--DYGIPQITETKMLKQYITQKSFKLMKSA-------------- 147
           +++ F+I++ELLD MM    GIP +TE  ++   ++ K  K +  A              
Sbjct: 102 LKEEFMIVHELLDVMMCGSGGIPMLTENSLVISRMSVKPSKSILEAQNSGNGSSNTNSNN 161

Query: 148 ----------------KKSKNVIRPPIALTNSVSWRPEGIMYKKNEAFLDVVESINMLIT 191
                           +++   +   +++     WRP+GI++KKNE  L V E IN+L++
Sbjct: 162 NNNNVPDLLMSGPKLLRRNSASLSQDLSILTDFKWRPKGIVHKKNEVILHVNERINILVS 221

Query: 192 QQGQVLRSEILGKVKVKSHLSGMPDLKLGLND----KGIFS--------NHVSGGVE-DE 238
           + G VL++ + G + +++HLSG P  + GLND     G+ S        NH  G V  D+
Sbjct: 222 KDGSVLKAYVDGSIDLETHLSGTPICQFGLNDSLSVSGVDSDMYGSHNHNHHFGDVNFDK 281

Query: 239 ADDLSATGKKKANIELEDLKFHQCVRLSKFENEKIITFIPPDGDFELMSYRLTTPIK-PL 297
            D    +     ++ LED KFHQCV L KF+ ++II F+PPDG  ELM Y +   +  P 
Sbjct: 282 TDKKQLSMASVGSVILEDCKFHQCVSLDKFDKDRIIKFVPPDGSMELMKYHVRDNLNLPF 341

Query: 298 IWCDIKIQVHSKSRIEVHCRAKAQIKKKSTANNVEILIPVPEDADSPKFRYSHGSIKWAP 357
               I     + + +E     K+    + +A NV + IPVP +    K   ++GS K+ P
Sbjct: 342 KVSPIVTNTRNGTALEYRITMKSLFPGRLSAKNVALHIPVPPNTMDCKINVTNGSCKFIP 401

Query: 358 EKNAILWKIKSFPGGKEYSMAAQLGLPSVSDFEEPVM---KRPVQVKFQIPYFTTSGIQV 414
           E++A++W+   F G  E +++A + +P+  + +  +    K P+ + F+I  F+ SG+ V
Sbjct: 402 EESAMIWRFNKFNGLTENTLSA-VTIPTKDNTQLSLQQWSKPPMSLDFEILMFSNSGLVV 460

Query: 415 RYLKINEPKMQYQSYPWVRYITQSGDDYTIR 445
           RY  I E   +Y++  W++YI++SG  Y IR
Sbjct: 461 RYFTITERDQKYKAVKWIKYISRSG-SYEIR 490

>Kwal_33.14182 s33 complement(560456..561859) [1404 bp, 467 aa] {ON}
           YOL062C (APM4) - Clathrin associated protein, medium
           subunit [contig 105] FULL
          Length = 467

 Score =  190 bits (482), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 127/372 (34%), Positives = 200/372 (53%), Gaps = 35/372 (9%)

Query: 104 IRDNFVIIYELLDEMMDYGIPQITETKMLKQYITQK------SFKLM-KSAKKSKNVIRP 156
           +++ F+I YELLD +++ G+P  TE   +   ++ K      +F +  ++     N I P
Sbjct: 100 LKERFMICYELLDIVLEDGLPVDTELSSVASKMSVKPNAGVDNFNMFAENGHGGTNRILP 159

Query: 157 --------PIA---------LTNSVSWRPEGIMYKKNEAFLDVVESINMLITQQGQVLRS 199
                   P A           +++ WR  GI YKKNE FL+V E I++L+++ G +L+S
Sbjct: 160 VSQFLRGRPSAGNLQDIASEAPSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKS 219

Query: 200 EILGKVKVKSHLSGMPDLKLGLNDKGIFSNHVSGGVEDEADDLSATGKKKA-NIELEDLK 258
            + G V+  +HLSGMP  + GLND    S       E +  +  A  K  A ++ LED K
Sbjct: 220 YVDGTVEATTHLSGMPVCRFGLNDALSVSTPFGDDDEYQVTNKKAIPKAAAGSVMLEDCK 279

Query: 259 FHQCVRLSKFENEKIITFIPPDGDFELMSYRLTTPIK-PLIWCDIKIQVHSKSRIEVHCR 317
           FHQCV+L KF++E+ I FI PDG FELM Y +   +  P     I   V S S I+    
Sbjct: 280 FHQCVQLDKFQSERTINFIAPDGSFELMKYHVRENLNLPFKVTPIVTVVRSNS-IDYQIT 338

Query: 318 AKAQIKKKSTANNVEILIPVPEDADSPKFRYSHGSIKWAPEKNAILWKIKSFPGGKEYSM 377
            K+    K TA +V++ IPVP +  S     S+G  K+ PE++AI+WK   + G  E S+
Sbjct: 339 IKSLFPSKLTAKDVQLRIPVPPETVSCHISTSNGKCKFVPEESAIVWKFSKYQGLTENSI 398

Query: 378 AAQLGLP---SVSDFEE-PVMKRPVQVKFQIPYFTTSGIQVRYLKINEPKMQYQSYPWVR 433
           +A   +P   S  + E+ P  + P+ +KF+I  F+ SG+ VR+  ++E    Y+   W++
Sbjct: 399 SAT-AVPMKDSTLNIEQWP--RPPISLKFEIVMFSNSGLVVRFFNVSERDRNYKMVKWIK 455

Query: 434 YITQSGDDYTIR 445
           Y+++SG  Y +R
Sbjct: 456 YLSKSG-AYEVR 466

>TDEL0D04580 Chr4 (840369..841817) [1449 bp, 482 aa] {ON} Anc_3.165
           YOL062C
          Length = 482

 Score =  190 bits (482), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 140/489 (28%), Positives = 238/489 (48%), Gaps = 52/489 (10%)

Query: 1   MASCIYFCDSKGKKILSRRYKDDIPTNAIDKFPMLLVEREQESSVIPPCLAHNGIQYLFV 60
           M S I    S+G+ I+++  K  +  +  D F + ++      S   P L      +  +
Sbjct: 1   MISAILIFSSRGELIVAKTMKSSLKKSISDIFRIQVINNLDVRS---PILTLGSTTFHHI 57

Query: 61  QHN---DLYVLTMTRSLSTNVAQLFAFXXXXXXXXXXXXXXXXXXSIRDNFVIIYELLDE 117
           + +    L+++ ++RS + N   ++ F                  ++++NF+  YE+LD 
Sbjct: 58  RSDGSDSLWLVAVSRS-NANSGAIWEFLYKLNVIMDVYGLTKEG-TLKENFMNCYEILDT 115

Query: 118 MMDYG-IPQITE-----TKML----KQ----------YITQKSFKLMKSAKKSKNVIRPP 157
           +++ G IP  TE     +KM     KQ           +T  S  L      S  +  P 
Sbjct: 116 VLEEGGIPVDTELNSVISKMTVKPPKQISGNLLDRPDLLTMSSLNLSTPGDSSSTLSMPK 175

Query: 158 IALTNS--------------VSWRPEGIMYKKNEAFLDVVESINMLITQQGQVLRSEILG 203
               N+              +SWRP GI YKKNE  L+V E I++L+++ G +L+S + G
Sbjct: 176 FLTRNNRSMSQDLGSNYPSNLSWRPHGIKYKKNEVLLNVNEKISILVSRDGSILKSYVDG 235

Query: 204 KVKVKSHLSGMPDLKLGLNDKGI--FSNHVSGGVEDEADDLSATGKKKANIELEDLKFHQ 261
            + + +HLSGMP  + GLND     F +     VED A+  +        + LED KFHQ
Sbjct: 236 TIDLTTHLSGMPICQFGLNDSLSVEFGDDSISEVEDFANKKAIPKAAAGRVMLEDCKFHQ 295

Query: 262 CVRLSKFENEKIITFIPPDGDFELMSYRLTTPIK-PLIWCDIKIQVHSKSRIEVHCRAKA 320
           CV L KF  +++I F+PPDG  ELM Y +   +  P     I   +   + I+     K+
Sbjct: 296 CVSLDKFNKDRVIKFVPPDGSMELMKYCVRDNLNLPFKVTPIVTSIGRGNTIDYRVTLKS 355

Query: 321 QIKKKSTANNVEILIPVPEDADSPKFRYSHGSIKWAPEKNAILWKIKSFPGGKEYSMAAQ 380
               K +A +V + IPVP      +   S+G  K+ PE++A++WK   + G  E +++A 
Sbjct: 356 LFPGKLSAKDVSLRIPVPPGTVDCEINVSNGKCKFVPEESAMIWKFTKYTGLTENTLSA- 414

Query: 381 LGLPSVSDFEEPVMKR----PVQVKFQIPYFTTSGIQVRYLKINEPKMQYQSYPWVRYIT 436
           + +PS SD  +  +++    P+ + F+I  F+ SG+ VRY K+++   +Y++  W++YI+
Sbjct: 415 VTVPS-SDTTQLTVQQWPRPPMSLNFEIMMFSNSGLVVRYFKVSDKDERYRTAKWIKYIS 473

Query: 437 QSGDDYTIR 445
           +SG  Y IR
Sbjct: 474 KSG-SYEIR 481

>SAKL0D13090g Chr4 (1093315..1094814) [1500 bp, 499 aa] {ON} weakly
           similar to uniprot|P38700 Saccharomyces cerevisiae
           YHL019C APM2 homologous to the medium chain of mammalian
           clathrin-associated protein complex Similar to clathrin
           coat proteins
          Length = 499

 Score =  190 bits (482), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 135/522 (25%), Positives = 248/522 (47%), Gaps = 99/522 (18%)

Query: 1   MASCIYFCDSKGKKILSRRYKDDIPTNAIDKFPMLLVEREQESSVIPPCLAHNGIQYLFV 60
           M+SCIY  D   + ++ + +K    +N  +     L ++      + P   + GI ++++
Sbjct: 1   MSSCIYILDETLQPLIYKNFK--AISNGEESIE--LFQQAHSKHPMVPVFHYKGIHFVYI 56

Query: 61  QHNDLYVLTMTRSLST--------NVAQLFAFXXXXXXXXXXXXXXXXXXS--IRDNFVI 110
           + +  Y ++    ++         NV  +  +                     I DNF +
Sbjct: 57  RRDGFYFISAVELVAEASNKKSHFNVMAILTYLENFYTLLKRYFNSQKLNRWLIVDNFHL 116

Query: 111 IYELLDEMMDYGIPQITETKMLKQYITQK---SFKLMKSAKK------------SKNVIR 155
           IYELLDE +D+G+PQ+T+  +++ YI  +     +L  S+KK             ++ + 
Sbjct: 117 IYELLDESLDFGVPQLTDYNIIQDYIKVQVNLHDELADSSKKISKKEDLHGFEDDESYMN 176

Query: 156 PPIA--LTNSVSWRPEGIMYKKNEAFLDVVESINMLIT-QQGQVLRSEILGKVKVKSHLS 212
             IA   T+++SWRP+GI Y KNE FLDV+E I   +   + ++ ++ + G+++ +S+LS
Sbjct: 177 SFIARTTTSAISWRPKGIHYTKNEFFLDVIEEIEYCMDFNKSKIRKNFVHGRIRCRSYLS 236

Query: 213 GMPDLKLGLNDKGIFSNHVSGGVEDEADDLSATGKKKANIELEDLKFHQCVRLSKFENEK 272
           GMP LK+GL+                   ++++  K+    + + KFHQCV L   + + 
Sbjct: 237 GMPKLKIGLS------------------KITSSLPKEREQFMNNAKFHQCVSLEDLQ-KN 277

Query: 273 IITFIPPDGDFELMSYRLTT-----PIKPLIWCDIKIQVHSKSRIEVHCRAKAQIKKKST 327
           I++FIPPDG+F+L  Y+L       P+  L+  D+K +   + +I +        K +++
Sbjct: 278 IVSFIPPDGEFQLCEYKLKRHVRDPPVIKLVKFDVKKEEKKRPKILISLTITTDFKSQNS 337

Query: 328 ANNVEILIPVP--------EDADSPKFRYSHGSIKWAPEKNAILWKIKSFPGGK---EYS 376
            + + I IP+         + A  P+F+   G++ +    + +LW++ S  GG    E+S
Sbjct: 338 TSVLNIRIPLTKIFSEYQIDLAKPPRFKCDQGNVLFNLTDDLLLWEVGSIKGGHAQTEHS 397

Query: 377 MAAQLGL--------------------------------PSVSDFEEPVMKRPVQVKFQI 404
           M  +  L                                  V + E     R V ++F+I
Sbjct: 398 MYCEFRLYDEEEYKKQLEELKNSMDPPPLRQGPKLEELYKQVHENENTNRSRLVSMEFEI 457

Query: 405 PYFTTSGIQVRYLKINEPKMQYQSYPWVRYITQSGDDYTIRM 446
           PY+T SG++V+YLKI E ++QY S+PWVRY T + ++Y  ++
Sbjct: 458 PYYTCSGLKVQYLKIEEDQLQYHSFPWVRYKTVNDEEYAYQI 499

>Kpol_1045.44 s1045 complement(103089..104498) [1410 bp, 469 aa]
           {ON} complement(103091..104500) [1410 nt, 470 aa]
          Length = 469

 Score =  183 bits (464), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 135/480 (28%), Positives = 230/480 (47%), Gaps = 47/480 (9%)

Query: 1   MASCIYFCDSKGKKILSRRYKDDIPTNAIDKFPMLLVEREQESSVIPPCLAHNGIQYLFV 60
           M + +     KG+ I+S+  K +   +  D F + ++       V  P L      +  +
Sbjct: 1   MINGVLVYTGKGELIVSKFSKSNAKRSISDIFRVQVI---NNLDVRSPILTLGSTTFHHI 57

Query: 61  QHND---LYVLTMTRSLSTNVAQLFAFXXXXXXXXXXXXXXXXXXSIRDNFVIIYELLDE 117
           + N    L+++ +TRS + N   ++ F                  ++++ F+  YELLD 
Sbjct: 58  RSNSRDHLWLVAVTRS-NANSGAIWEFLYKFDSLLNAFGLDNET-TLKEEFMTCYELLDL 115

Query: 118 MMDY-GIPQITETKMLKQYITQKSF---------------------KLMKSAKKSKNVIR 155
           M++  G+P  TE   +   ++ K                       K +    +S +V  
Sbjct: 116 MLNVDGVPLDTELSSVSAKMSTKPLHSINSPSDSSLDNSSSPLSISKFLNRNNRSMSVDT 175

Query: 156 PPIALTNSVSWRPEGIMYKKNEAFLDVVESINMLITQQGQVLRSEILGKVKVKSHLSGMP 215
                +N   WRP GI YKKNE FL++ E I++L+++   +L++ + G V + SHLSG P
Sbjct: 176 MNTEPSN-YPWRPNGIKYKKNEIFLNINEKISILVSKDETILKAYVDGTVDLTSHLSGTP 234

Query: 216 DLKLGLN-----DKGIFSNHVSGGVEDEADDLSATGKKKANIELEDLKFHQCVRLSKFEN 270
             + GLN     D+  + N    G  ++ +   AT      + LED KFH+CV L KF  
Sbjct: 235 TCQFGLNDSLSVDEPNYYNSDDNGFRNQQNIPRATA---GTVVLEDCKFHECVSLDKFNR 291

Query: 271 EKIITFIPPDGDFELMSYRLTTPIK-PLIWCDIKIQVHSKSRIEVHCRAKAQIKKKSTAN 329
           ++II F+PPDG  ELM Y +   I  P       I   S++ ++     K+    K +AN
Sbjct: 292 DRIIKFVPPDGHIELMKYHVRDNINLPFKVTPNVINSRSRTGLDYRITLKSLFPSKLSAN 351

Query: 330 NVEILIPVPEDADSPKFRYSHGSIKWAPEKNAILWKIKSFPGGKEYSMAAQLGLPSVSDF 389
           +V + IPVP      K   S+G  ++ PE++ I+WK   + G  E  ++A     S +D 
Sbjct: 352 DVVLKIPVPSSTVDCKLNVSNGKCRFVPEESCIIWKFAKYNGLTENKLSAV--TVSSNDT 409

Query: 390 EEPVMKR----PVQVKFQIPYFTTSGIQVRYLKINEPKMQYQSYPWVRYITQSGDDYTIR 445
            + ++++    P+ + F+I  F+ SG+ VRYLKI E   +Y++  W++YI++SG  Y +R
Sbjct: 410 TQLMLQQWARPPISLDFEIMMFSNSGLVVRYLKIMEKDQKYRTVKWIKYISRSG-SYEVR 468

>ZYRO0B04840g Chr2 (389669..391099) [1431 bp, 476 aa] {ON} highly
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062C APM4 Clathrin associated protein medium subunit
          Length = 476

 Score =  181 bits (460), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 134/490 (27%), Positives = 238/490 (48%), Gaps = 60/490 (12%)

Query: 1   MASCIYFCDSKGKKILSRRYKDDIPTNAIDKFPMLLVEREQESSVIPPCLAHNGIQYLFV 60
           M + I+   ++G+ I+S+ + + +  +  D F + ++      S   P L      +  +
Sbjct: 1   MINAIFIYSTRGELIVSKLFNNSLKRSISDIFRIQVINNLDVRS---PILTLGSTTFHHI 57

Query: 61  QHN---DLYVLTMTRSLSTNVAQLFAFXXXXXXXXXXXXXXXXXXSIRDNFVIIYELLDE 117
           + N    L+++T++R+ + N   ++ F                   ++++F+I YE+LD 
Sbjct: 58  RSNGSDSLWIVTVSRT-NANSGAIWEFLYKFNAILDAYDLTKEEK-LKEDFMICYEILDV 115

Query: 118 MMDYG-IPQITETKMLKQYITQKSFKLMKSAKKSK---------------NVIRPPIALT 161
           ++  G IP  TE   +   I+ K  K   ++ + K               N+  P     
Sbjct: 116 VIGAGGIPMDTELGSIASKISVKPPKSGGTSSEPKSSTVANFPGSNLSTSNLSMPKFLTR 175

Query: 162 NSVS--------------WRPEGIMYKKNEAFLDVVESINMLITQQGQVLRSEILGKVKV 207
           N+ S              WRP GI YKKNE FL V E IN+L+++ G +L++ + G + +
Sbjct: 176 NNRSMSQDLGTNYPSNFPWRPNGIKYKKNEVFLYVNEKINILVSRDGSILKAYVDGTIDM 235

Query: 208 KSHLSGMPDLKLGLNDKGI--FSNHVSGGVEDEADDLSATGKKKANIELEDLKFHQCVRL 265
            +HLSG P  + GLND     F + +    ++  +  +       ++ LED KFHQCV L
Sbjct: 236 TTHLSGTPICQFGLNDSPSVEFGDSLWLDTQEFHNKKAVPKAAAGSVMLEDCKFHQCVSL 295

Query: 266 SKFENEKIITFIPPDGDFELMSY----RLTTPIK--PLIWCDIKIQVHSKSRIEVHCRAK 319
            KF  E+II F+PPDG+ ELM Y     L  P K  P++           S +E     K
Sbjct: 296 DKFNKERIIKFVPPDGNMELMKYCVRDNLNLPFKITPVV-------TPCGSTVEYRITLK 348

Query: 320 AQIKKKSTANNVEILIPVPEDADSPKFRYSHGSIKWAPEKNAILWKIKSFPGGKEYSMAA 379
           +    K +A +V + IPVP      K   S+G  K+  E+NA++W+   + G  E +++A
Sbjct: 349 SLFPNKLSAKDVALHIPVPPGTVDCKINISNGKCKFESEENAMVWRFNKYHGLTENTLSA 408

Query: 380 QLGLPSVSDFEEPVMKR----PVQVKFQIPYFTTSGIQVRYLKINEPKMQYQSYPWVRYI 435
            + +P+ SD  +  +++    P+ + F+I  F+ SG+ VRY ++++   +Y+   W++YI
Sbjct: 409 -VTVPT-SDTTQLTLQQWPRPPMSLGFEIMMFSNSGLVVRYFRVSDKDEKYRVVKWIKYI 466

Query: 436 TQSGDDYTIR 445
           ++SG  Y +R
Sbjct: 467 SKSG-SYEVR 475

>Suva_15.103 Chr15 complement(183026..184501) [1476 bp, 491 aa] {ON}
           YOL062C (REAL)
          Length = 491

 Score =  181 bits (458), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 139/502 (27%), Positives = 240/502 (47%), Gaps = 69/502 (13%)

Query: 1   MASCIYFCDSKGKKILSRRYKDDIPTNAIDKFPMLLVEREQESSVIPPCLAHNGIQYLFV 60
           M S +    S+G+ IL++ +K+ +  +  D F + ++       V  P L      +  +
Sbjct: 1   MISGVLVYSSRGELILNKFFKNSLKRSISDIFRVQVI---NNLDVRSPVLTLGSTTFHHI 57

Query: 61  QH---NDLYVLTMTRSLSTNVAQLFAFXXXXXXXXXXXXXXXXXXSIRDNFVIIYELLDE 117
           +    ++L+++T+TRS + N A ++ F                  ++++ F+I++E+LD 
Sbjct: 58  RSMRGDNLWLVTITRS-NANSAAIWEFLYKLDSVMNAYRLDREE-ALKEEFMIVHEMLDI 115

Query: 118 MMD-YGIPQITETKMLKQYITQKSFKLMKSA----------------------------- 147
           M+   GIP  TE   L   I Q S K +++                              
Sbjct: 116 MLGGNGIPIDTE---LNSVIAQMSVKPIRNVGGLLESPDSIDMLSSTSSPSSVGGELHFP 172

Query: 148 ----KKSKNVI-----RPPIALTNSVSWRPEGIMYKKNEAFLDVVESINMLITQQGQVLR 198
               K+S + +         +  N ++WRP+GI++KK+E FL V E +N+L+++ G +L+
Sbjct: 173 KFLKKRSSSFLGQGDSHSDFSDGNKIAWRPKGIIHKKDEVFLYVNERMNILVSRDGSILK 232

Query: 199 SEILGKVKVKSHLSGMPDLKLGLNDKGIFSNHVSGGVEDEADDLSATGKKKAN------- 251
           S + G + + +HLSG P  + GLND     +        + D  S  G +  N       
Sbjct: 233 SYVDGTIDITTHLSGTPVCRFGLNDSLGMQSEDQENWLSQQDQHSHNGFENKNCFPKAAA 292

Query: 252 --IELEDLKFHQCVRLSKFENEKIITFIPPDGDFELMSYRLTTPIKPLIWCDIKIQVHSK 309
             + LED KFH+CV + KF    II F+PPDG  ELM Y +   I  L +    I  HS 
Sbjct: 293 GSVLLEDCKFHECVSIDKFNKNHIIEFVPPDGSMELMKYHVRDNIN-LPFKITPIVAHSA 351

Query: 310 SRIEVHCR--AKAQIKKKSTANNVEILIPVPEDADSPKFRYSHGSIKWAPEKNAILWKIK 367
              EV  R   K+    K +A +V + IPVP      K   S+G+ K+ PE+NA++W+  
Sbjct: 352 RDNEVDYRITLKSLFPGKLSAKDVILHIPVPPSTVDCKISVSNGNCKFVPEENAMIWRFN 411

Query: 368 SFPGGKEYSMAAQLGLPSVSDFEEPVMKR----PVQVKFQIPYFTTSGIQVRYLKINEPK 423
            F G  E +++A     S SD  +  +++    P+ + F++  F+ SG+ VRY  I+   
Sbjct: 412 KFNGLTENTLSAV--TVSTSDTTQLSLQQWTRPPMSLDFEVMMFSNSGLVVRYFTISSRD 469

Query: 424 MQYQSYPWVRYITQSGDDYTIR 445
            ++++  W++YI++SG  Y +R
Sbjct: 470 SKHRAVKWIKYISKSG-SYEVR 490

>YOL062C Chr15 complement(210520..211995) [1476 bp, 491 aa] {ON}
           APM4Mu2-like subunit of the clathrin associated protein
           complex (AP-2); involved in vesicle transport
          Length = 491

 Score =  179 bits (455), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 141/507 (27%), Positives = 244/507 (48%), Gaps = 79/507 (15%)

Query: 1   MASCIYFCDSKGKKILSRRYKDDIPTNAIDKFPMLLVER-EQESSVIPPCLAHNGIQYLF 59
           M S +    S+G+ +L++ +K+ +  +  D F + ++   +  S V+   L      ++ 
Sbjct: 1   MISGVLVYSSRGELVLNKFFKNSLKRSISDIFRVQVINNLDVRSPVL--TLGSTTFHHIR 58

Query: 60  VQHND-LYVLTMTRSLSTNVAQLFAFXXXXXXXXXXXXXXXXXXSIRDNFVIIYELLDEM 118
            +H D L+++T+TRS + N A ++ F                  ++++ F+I++E+LD M
Sbjct: 59  SRHGDNLWLVTITRS-NANSAAIWEFLYKLDAVMNAYRLDREE-ALKEEFMIVHEMLDIM 116

Query: 119 MD-YGIPQITETKMLKQYITQKSFKLMKS------------------------------- 146
           +   GIP  TE   L   I Q S K +++                               
Sbjct: 117 LGGNGIPIDTE---LNSVIAQMSVKPVRNMGGLLDSPDGNDVLSSSSSPTSSAGELHFPK 173

Query: 147 --AKKSKNVIRPPIALT-----NSVSWRPEGIMYKKNEAFLDVVESINMLITQQGQVLRS 199
              K+S + +    + +     N ++WRP+GI++KK+E FL V E IN+L+++ G +L+S
Sbjct: 174 FLTKRSSSFLGQGDSTSDFYDNNKITWRPKGIIHKKDEVFLYVNERINILVSRDGSILKS 233

Query: 200 EILGKVKVKSHLSGMPDLKLGLNDK-GIFSNHVSGGVEDEADDL--------SATGKKK- 249
            + G + + +HLSG P  + GLND  G+ S       EDE   L        S  G K  
Sbjct: 234 YVDGTIDITTHLSGTPICRFGLNDSLGMQS-------EDEKKWLAQQQRHSGSDFGNKNF 286

Query: 250 ------ANIELEDLKFHQCVRLSKFENEKIITFIPPDGDFELMSYRLTTPIK-PLIWCDI 302
                  ++ LED KFH+CV L KF    II F+PPDG  ELM Y +   I  P     I
Sbjct: 287 IPKAAAGSVLLEDCKFHECVSLDKFNRNHIIEFVPPDGSMELMKYHVRDNINLPFKVTPI 346

Query: 303 KIQVHSKSRIEVHCRAKAQIKKKSTANNVEILIPVPEDADSPKFRYSHGSIKWAPEKNAI 362
                  + I+     K+    K +A +V + IPVP      K   S+G  K+ PE+NA+
Sbjct: 347 VTHSTRDNEIDYRITLKSLFPGKLSAKDVVLHIPVPPSTVDCKISVSNGHCKFVPEENAM 406

Query: 363 LWKIKSFPGGKEYSMAAQLGLPSVSDFEEPVMKR----PVQVKFQIPYFTTSGIQVRYLK 418
           +W+   + G  E +++A     S SD  +  +++    P+ ++F++  F+ SG+ VRY  
Sbjct: 407 IWRFNKYNGLTENTLSAV--TVSTSDTTQLNLQQWTRPPISLEFEVMMFSNSGLVVRYFT 464

Query: 419 INEPKMQYQSYPWVRYITQSGDDYTIR 445
           I+    ++++  W++YI+++G  Y +R
Sbjct: 465 ISGKDSKHRAVKWIKYISKAG-SYEVR 490

>ABR047W Chr2 (479283..480779) [1497 bp, 498 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHL019C (APM2)
          Length = 498

 Score =  178 bits (451), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 125/468 (26%), Positives = 212/468 (45%), Gaps = 103/468 (22%)

Query: 48  PCLAHNGIQYLFVQHNDLYVLTMTRSLSTNV-AQLFAFXXXXXXXXXXXXXXXXXXS-IR 105
           P L+H G  Y+++Q + LY L+++  + T V   +FA+                    I 
Sbjct: 41  PVLSHRGYDYIYIQRDGLYFLSLSYGVETVVPMTVFAYLGQLYQLFKKYLGERLNRQLIM 100

Query: 106 DNFVIIYELLDEMMDYGIPQITETKMLKQYITQKSFKLMKSAKK---------------- 149
           DNF ++YEL+DE +D GIPQ+T+  +++ Y+  +  +  +  +K                
Sbjct: 101 DNFHLVYELMDESIDMGIPQLTDHNIIRDYVKVQVVRRAEDGEKHAGKHKAKRDKAGKEE 160

Query: 150 --------SKNVIRPPIA--LTNSVSWRPEGIMYKKNEAFLDVVESINMLIT-QQGQVLR 198
                    ++ +   IA   T+++SWRP GI Y KNE FLDVVE +  L+  ++ QV  
Sbjct: 161 EEADPGAADEHFMNSYIAKTTTSAISWRPRGIYYSKNEFFLDVVEELEYLMDFERAQVRL 220

Query: 199 SEILGKVKVKSHLSGMPDLKLGLNDKGIFSNHVSGGVEDEADDLSATGKKKANIELEDLK 258
           +++ G +  +S+LSGMP L +GLN                A D   T +         + 
Sbjct: 221 NQVHGAINCRSYLSGMPQLTVGLNKM-------------VAQDRDFTSQ---------VH 258

Query: 259 FHQCVRLSKFENEKIITFIPPDGDFELMSYRLT-----TPIKPLIWCDIKIQVHSK---- 309
           FHQCV L +   ++ ITF+PPDG+F+L  Y+L       P+  L  C   ++   +    
Sbjct: 259 FHQCVDLERLATDRHITFVPPDGEFQLCHYKLARGANEQPLIKLEECRAAVKPRRRPADA 318

Query: 310 SRIEVHCRAKAQIKKKSTANNVEILIPVPEDADS--------PKFRYSHGSIKWAPEKNA 361
            R+ +        K +   + +++ +P+    +         P+F+   G + +    + 
Sbjct: 319 DRLVLTVSISTNFKLQDATSVLKVRVPLARVFEQWKVDLSFPPRFKCDAGCVMFNITDDY 378

Query: 362 ILWKI---KSFPGGKEYSMAAQLGL----------PSVSDFEEPVMKRPVQ--------- 399
           +LW I   K   G + ++M +Q  L            +S   +P+   P Q         
Sbjct: 379 LLWDIGKAKGSHGDRRFTMQSQFHLYDEAYYSRRRAQLSTSMDPLPAHPGQQLEALYNQT 438

Query: 400 -------------VKFQIPYFTTSGIQVRYLKINEPKMQYQSYPWVRY 434
                        V F++PY T SG++V +LKI EP++QYQS+PW+RY
Sbjct: 439 HASAPTHASALLRVDFEVPYHTISGLKVEFLKILEPQLQYQSFPWIRY 486

>ADR315W Chr4 (1259839..1261317) [1479 bp, 492 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL062C (APM4)
          Length = 492

 Score =  177 bits (450), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 104/327 (31%), Positives = 175/327 (53%), Gaps = 20/327 (6%)

Query: 103 SIRDNFVIIYELLDEMMDYGIPQITETKMLKQYITQK--------------SFKLMKSAK 148
           ++ D+F++ YELLD ++D G+PQ TE   +   +++K              S +L ++  
Sbjct: 99  ALLDDFMLCYELLDVVLDSGLPQDTELSHIVPLLSRKPATGESASGDDFLNSARLRRTGT 158

Query: 149 KSKNVIRPPIALTNSVSWRPEGIMYKKNEAFLDVVESINMLITQQGQVLRSEILGKVKVK 208
           K+ +V        +   WR EGI YKKNE +LDV+E +++L+ + G +L++ + G V+  
Sbjct: 159 KNVSVETLDHFSRDVCPWRGEGIKYKKNEVYLDVIEKLSLLVNRDGTILKAYVDGTVQCT 218

Query: 209 SHLSGMPDLKLGLNDKGIFSNHVSGGVEDEADDLSATGKKKANIELEDLKFHQCVRLSKF 268
           +HLSGMP    G ND               A  +  T ++++ + LED KFHQCV+L+KF
Sbjct: 219 AHLSGMPLCHFGFNDSQSLRQR--SPRRQYAPRVFGTDERES-VVLEDCKFHQCVQLNKF 275

Query: 269 ENEKIITFIPPDGDFELMSYRLTTPIKPLIWCDIKIQVHSKSRIEVHCRAKAQIKKKSTA 328
           + E++I F+PPDG+FELM Y +   ++P       +   ++  IE     ++    K +A
Sbjct: 276 DQERVIRFVPPDGEFELMKYHIRDDLRPPFKVTPVVSKVNERSIEYRITLQSLFPTKLSA 335

Query: 329 NNVEILIPVPEDADSPKFRYSHGSIKWAPEKNAILWKIKSFPGGKEYSMAAQLGLPSVSD 388
            +VE+ IP P    S K   S G  K+ PE+NAI+WKI  F G  E +++A         
Sbjct: 336 KDVELYIPAPPYTISAKVNVSCGKCKFVPEENAIIWKIHKFHGLTENTLSAVTIADEQGH 395

Query: 389 FEEPV---MKRPVQVKFQIPYFTTSGI 412
           + + +    + P+ +K +I  F+T+ +
Sbjct: 396 YAQVLDQWPRPPISMKLEIMMFSTAAL 422

>Kwal_26.8146 s26 (665689..667206) [1518 bp, 505 aa] {ON} YHL019C
           (APM2) - Similiar to clathrin coat proteins [contig 55]
           FULL
          Length = 505

 Score =  177 bits (449), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 139/536 (25%), Positives = 245/536 (45%), Gaps = 121/536 (22%)

Query: 1   MASCIYFCDSKGKKILSRRYKDDIPTNAIDKFPMLLVEREQESSVIPPCLAHNGIQYLFV 60
           M+S I+  D +   ++ + +K        + F     E  + S+V  P + H GI ++ +
Sbjct: 1   MSSSIFLLDEQLNPLIVKSFKS---VQHPEAFAYRFKEVYKVSNV--PVIYHKGIVFISI 55

Query: 61  QHNDLYVLTMT-RSLSTNVAQLFAFXXXXXXXXXXXXXXXXXXSIR--DNFVIIYELLDE 117
             + LY ++M+  SL +++     +                    R  DNF +IYELLDE
Sbjct: 56  CRDGLYFVSMSVGSLRSSIMSTLVYLNDFHMLLKKYLRVNALDRTRIVDNFNLIYELLDE 115

Query: 118 MMDYGIPQITETKMLKQYI----------------------TQKSFKLMKSAKKSKN--- 152
            +D+GIPQ+T+  +++  I                       Q+   + ++ +KS     
Sbjct: 116 SLDFGIPQLTDFNIIRDSIKIQPNIPPDPKIARSNSDDDESEQEESNVAETQEKSNKHGF 175

Query: 153 ----------VIRPPIALTNSVSWRPEGIMYKKNEAFLDVVESINMLIT-QQGQVLRSEI 201
                     V+R     T ++SWRP+GI Y KNE F+DV+ES   ++  +  QV ++ I
Sbjct: 176 QDDEEYINSFVLR---TTTQAISWRPKGIYYAKNELFVDVIESQAYVMDFKHHQVRKNFI 232

Query: 202 LGKVKVKSHLSGMPDLKLGLNDKGIFSNHVSGGVEDEADDLSATGKKKANIELEDLKFHQ 261
            G++  +S+LSGMP +K+ +N            ++D    LS+             KFHQ
Sbjct: 233 FGRIICRSYLSGMPVVKICINKM----------LKDRDQFLSSA------------KFHQ 270

Query: 262 CVRLSKFENEKIITFIPPDGDFELMSYRL-----TTPIKPLIWCDIKIQVHSKSRIEVHC 316
           CV L    ++  I FIPPDGDF+L  Y++      +P+  LI   + ++   K ++++  
Sbjct: 271 CVSLESLSSQDFIEFIPPDGDFQLCEYKIKRHISDSPVIKLIEYKV-VEKPKKHKLQISM 329

Query: 317 RAKAQIKKKSTANNVEILIPVPEDADS--------PKFRYSHGSIKWAPEKNAILWKIKS 368
           + +   K +++A  ++I +P+ +  ++        P+F+   GSI +      +LWK   
Sbjct: 330 KIQPHFKAQNSATFLDIRVPIQDIFETYKIDLTKQPRFKCDFGSILFNLSDGYLLWKANG 389

Query: 369 FPGGKE---YSMAAQL-------------------------------GLPSVSDFEEPVM 394
             GG     +SM  +                                 L +++  E+  +
Sbjct: 390 MKGGHGETYHSMQVEFFLFDAEAHRKEAEELKNSMDPPPLREGVRMEELYALAHEEKGQI 449

Query: 395 KRPVQ----VKFQIPYFTTSGIQVRYLKINEPKMQYQSYPWVRYITQSGDDYTIRM 446
             PV+     +F++PYFT+SG++V YLKI E ++QYQS+PWVRY T +  +Y  +M
Sbjct: 450 NNPVRNMITAEFEVPYFTSSGLRVEYLKIEEEQLQYQSFPWVRYKTINDTEYAFQM 505

>TBLA0F00840 Chr6 (213915..215360) [1446 bp, 481 aa] {ON} Anc_3.165
           YOL062C
          Length = 481

 Score =  175 bits (444), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 113/384 (29%), Positives = 194/384 (50%), Gaps = 47/384 (12%)

Query: 104 IRDNFVIIYELLDEMMDY-GIPQITETKMLKQYITQKSFKLMKSAKKSKNVI-------- 154
           ++D F++ +ELLD  +   G+P  TE   +   +T K  +++ S+    +++        
Sbjct: 102 LKDEFIVCHELLDITLGMNGLPMDTELSSVIGKMTLKPAQVLTSSADRSDILASSVTTLG 161

Query: 155 --RPPIALT---------------------NSVSWRPEGIMYKKNEAFLDVVESINMLIT 191
               PI++                      +++ WR   I YKKNE  ++V+E IN+L+ 
Sbjct: 162 HNSTPISMPKFLSRNSNRSVTQEFESQFSPSNIPWRSRDIKYKKNEMIVNVIEKINVLVG 221

Query: 192 QQGQVLRSEILGKVKVKSHLSGMPDLKLGLND----KGIFSNHVSGGVEDEADDLSATGK 247
           +   +LR+ + G + + +HLSGMP  ++G+ND    +G  + H +   ED A +  A   
Sbjct: 222 KDDNILRAYVDGTIDITAHLSGMPMCQIGMNDLSTIQGGENAHWTN--EDRASNRDAMPD 279

Query: 248 KKAN-IELEDLKFHQCVRLSKFENEKIITFIPPDGDFELMSYRLTTPIK-PL-IWCDIKI 304
              + + LE  KFHQCV L K+  + +I FIPPDG FELM Y ++  +  P  I   + +
Sbjct: 280 VSGDRVILEGSKFHQCVALDKYNKDNVIWFIPPDGQFELMKYHVSNNLNLPFRITPQVTL 339

Query: 305 QVHSKSRIEVHCRAKAQIKKKSTANNVEILIPVPEDADSPKFRYSHGSIKWAPEKNAILW 364
             H  + +    + K+   +K +A NV + IPVP      K   S G  K+ PE+N ++W
Sbjct: 340 TSHGTA-LSYAIKLKSLFPRKLSAENVVLRIPVPPGTLDCKINASDGKCKFIPEENCMVW 398

Query: 365 KIKSFPGGKEYSMAAQLGLPSVSDFEEPV---MKRPVQVKFQIPYFTTSGIQVRYLKINE 421
               F G  E  + AQ  +P+ S   + +    + P+ + F++  F+ +G+ VRYLK+ E
Sbjct: 399 SFHRFNGSTENHLNAQT-VPTQSIASQSIKQWTRPPMSLDFKVLMFSNTGLIVRYLKVQE 457

Query: 422 PKMQYQSYPWVRYITQSGDDYTIR 445
             M Y +  W++YI+ +G  Y +R
Sbjct: 458 KNMHYNTIKWIKYISAAG-SYEVR 480

>NDAI0G02920 Chr7 complement(676413..677873) [1461 bp, 486 aa] {ON}
           Anc_3.165
          Length = 486

 Score =  175 bits (444), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 132/494 (26%), Positives = 229/494 (46%), Gaps = 56/494 (11%)

Query: 1   MASCIYFCDSKGKKILSRRYKDDIPTNAIDKFPMLLVEREQESSVIPPCLAHNGIQYLFV 60
           M + I     +G+ I+S+ +K  +  +  D F + ++       V  P L      +  +
Sbjct: 1   MINGILIYSPRGELIVSKLFKGTLKRSIADIFRIQVINNLD---VRSPILTLGSTTFHHI 57

Query: 61  QH----NDLYVLTMTRSLSTNVAQLFAFXXXXXXXXXXXXXXXXXXSIRDNFVIIYELLD 116
           +     ++L+++  TR+ + N A ++ F                   +++ F+I++ELLD
Sbjct: 58  RSSKDSDNLWLVAATRN-NANSAAIWEFLYKLDSMLIEYGLNKEEY-LKEEFMIVHELLD 115

Query: 117 EMM-DYGIPQITETKMLKQYITQKSFKLMKS----------AKKSKNVIRPPIALT---- 161
            M+   GIP  TE   +   ++ K  KL  +            K  N I  P  L     
Sbjct: 116 VMLGSCGIPLETEPSKVIAKMSVKPAKLHHNNTSSLLDGHLGSKGNNEISMPKFLKRNDS 175

Query: 162 ----------NSVSWRPEGIMYKKNEAFLDVVESINMLITQQGQVLRSEILGKVKVKSHL 211
                     N  SWRP+ I +KKNE  L V E IN+L+ + G +L++ + G + +++ L
Sbjct: 176 SQSHDSNFSFNDFSWRPKDIKHKKNEVILHVNEKINILVAKDGSILKAYVDGSIDLQTRL 235

Query: 212 SGMPDLKLGLND--------------KGIFSNHVSGGVEDEADDLSATGKKKANIELEDL 257
           SG P  + GLND               G   N+ S  ++    +   +     N+ LED 
Sbjct: 236 SGTPVCQFGLNDSLTLGSNDSEYSSRNGRTGNNKSSMLDSNLSNKVLSKASVGNVILEDC 295

Query: 258 KFHQCVRLSKFENEKIITFIPPDGDFELMSYRLTTPIK-PLIWCDIKIQVHSKSRIEVHC 316
           KFHQCV L KF+ E+II F+PPDG  ELM Y +   +  P     I     +   ++   
Sbjct: 296 KFHQCVSLDKFDRERIIKFVPPDGSVELMKYHIRNNLNLPFKITPIVTNSVTGDALDYRI 355

Query: 317 RAKAQIKKKSTANNVEILIPVPEDADSPKFRYSHGSIKWAPEKNAILWKIKSFPGGKEYS 376
             K+    + +A  V + IPVP          S+G+ K+ P +NA++WK   + G  E +
Sbjct: 356 ALKSLFPGRLSAKGVVLHIPVPPGVMDCNISVSNGTCKFVPAENAMVWKFNKYNGLTENT 415

Query: 377 MAAQLGLPSVSDFEEPVMKR----PVQVKFQIPYFTTSGIQVRYLKINEPKMQYQSYPWV 432
           ++A + +PS  +  +  +++    P+ + F+I  F+ SG+ VRY  I+E    Y++  W+
Sbjct: 416 LSA-VTVPS-KEVNQTTLQQWARPPMSLDFEILMFSNSGLVVRYFTISEGHQNYKAVKWI 473

Query: 433 RYITQSGDDYTIRM 446
           +Y+++SG  Y +R 
Sbjct: 474 KYVSKSG-SYEVRF 486

>Smik_15.96 Chr15 complement(174750..176225) [1476 bp, 491 aa] {ON}
           YOL062C (REAL)
          Length = 491

 Score =  175 bits (444), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 137/503 (27%), Positives = 238/503 (47%), Gaps = 71/503 (14%)

Query: 1   MASCIYFCDSKGKKILSRRYKDDIPTNAIDKFPMLLVER-EQESSVIPPCLAHNGIQYLF 59
           M S +    S+G+ +L++ +K+ +  +  D F + ++   +  S V+   L      ++ 
Sbjct: 1   MISGVLIYSSRGELVLNKFFKNSLKRSISDIFRVQVINNLDVRSPVL--TLGSTTFHHIR 58

Query: 60  VQHND-LYVLTMTRSLSTNVAQLFAFXXXXXXXXXXXXXXXXXXSIRDNFVIIYELLDEM 118
            +H D L+++T+TRS + N A ++ F                  ++++ F+I++E+LD M
Sbjct: 59  SRHGDNLWLVTITRS-NANSAAIWEFLYKLDFVMNAYRLDREE-ALKEEFMIVHEMLDIM 116

Query: 119 MD-YGIPQITETKMLKQYITQKSFKLMKSA------------------------------ 147
           +   GIP  TE   L   I Q S K +++                               
Sbjct: 117 LGGNGIPIDTE---LNSVIAQMSVKPVRNTGGLLDSPDGNDMLSSSSSPSSVSGELHFPK 173

Query: 148 ---KKSKNVIRPPIALT-----NSVSWRPEGIMYKKNEAFLDVVESINMLITQQGQVLRS 199
              K S + +    + +     N ++WRP+GI +KK+E FL V E +N+L+++ G +L+S
Sbjct: 174 FLKKSSSSFLGQGDSASDFYDGNKITWRPKGITHKKDEVFLYVNERMNILVSRDGSILKS 233

Query: 200 EILGKVKVKSHLSGMPDLKLGLNDK-GIFS-----------NHVSGGVEDEADDLSATGK 247
            + G + + +HLSG P  + GLND  G+ S           +H  G  E +     A   
Sbjct: 234 YVDGTIDITTHLSGTPICRFGLNDSLGMQSEDEKKWLAQQQHHSRGNFESKNFIHKAAA- 292

Query: 248 KKANIELEDLKFHQCVRLSKFENEKIITFIPPDGDFELMSYRLTTPIK-PLIWCDIKIQV 306
              ++ LED KFH+CV L KF     I F+PPDG  ELM Y +   I  P     I    
Sbjct: 293 --GSVLLEDCKFHECVSLDKFNKNHTIEFVPPDGSMELMKYHVRDNINLPFKITPIVTHS 350

Query: 307 HSKSRIEVHCRAKAQIKKKSTANNVEILIPVPEDADSPKFRYSHGSIKWAPEKNAILWKI 366
              + I+     K+    K +A +V + IPVP      K   S+G  K+ PE+NA++W+ 
Sbjct: 351 TRDNEIDYRITLKSLFPGKLSAKDVTLHIPVPPSTVDCKISVSNGHCKFVPEENAMMWRF 410

Query: 367 KSFPGGKEYSMAAQLGLPSVSDFEEPVMKR----PVQVKFQIPYFTTSGIQVRYLKINEP 422
             + G  E +++A     S SD  +  +++    P+ + F++  F+ SG+ VRY  I   
Sbjct: 411 NKYNGLTENTLSAV--TVSTSDTTQLNLQQWTRPPMSLDFEVMMFSNSGLVVRYFTIFGK 468

Query: 423 KMQYQSYPWVRYITQSGDDYTIR 445
             ++++  W++YI++SG  Y +R
Sbjct: 469 DSKHRAVKWIKYISRSG-SYEVR 490

>Skud_15.91 Chr15 complement(169608..171083) [1476 bp, 491 aa] {ON}
           YOL062C (REAL)
          Length = 491

 Score =  172 bits (435), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 140/507 (27%), Positives = 239/507 (47%), Gaps = 79/507 (15%)

Query: 1   MASCIYFCDSKGKKILSRRYKDDIPTNAIDKFPMLLVER-EQESSVIPPCLAHNGIQYLF 59
           M S +    S+G+ IL++ +K+ +  +  D F + ++   +  S V+   L      ++ 
Sbjct: 1   MISGVLVYSSRGELILNKFFKNSLKRSISDIFRVQVINNLDVRSPVL--TLGSTTFHHIR 58

Query: 60  VQHND-LYVLTMTRSLSTNVAQLFAFXXXXXXXXXXXXXXXXXXSIRDNFVIIYELLDEM 118
            +H D L+++T+TRS + N A ++ F                  ++++ F+I++E+LD M
Sbjct: 59  SKHGDNLWLVTITRS-NANSAAIWEFLYKLDAVMNAYRLDREE-ALKEEFMIVHEMLDIM 116

Query: 119 MD-YGIPQITETKMLKQYITQKSFKLMKSA------------------------------ 147
           +   GIP  TE   L   + + S K M++                               
Sbjct: 117 LGGNGIPIDTE---LNSVVARMSVKPMRNTGGLLDGADGSDILSSSSSPSSAGGELHFPK 173

Query: 148 --KKSKNVI------RPPIALTNSVSWRPEGIMYKKNEAFLDVVESINMLITQQGQVLRS 199
             KKS +              +N ++WR  GI++KK+E FL V E +N+L+++ G +L+S
Sbjct: 174 FLKKSSSSFLGQGDSTSDFYDSNKITWRATGIIHKKDEVFLYVNERMNILVSRDGSILKS 233

Query: 200 EILGKVKVKSHLSGMPDLKLGLNDK-GIFSNHVSGGVEDEADDL--------SATGKKK- 249
            + G + + +HL+G P  + GLND  G+ S       EDE + L        S  G K  
Sbjct: 234 YVDGTIDIVTHLNGTPVCRFGLNDSLGMQS-------EDEKNWLAQQHQHSRSDFGNKNF 286

Query: 250 ------ANIELEDLKFHQCVRLSKFENEKIITFIPPDGDFELMSYRLTTPIK-PLIWCDI 302
                  ++ LED KFH+CV + KF    II FIPPDG  ELM Y +   I  P     I
Sbjct: 287 LPKAAAGSVLLEDCKFHECVSIEKFNKNHIIEFIPPDGSMELMKYHVRDNINLPFKITPI 346

Query: 303 KIQVHSKSRIEVHCRAKAQIKKKSTANNVEILIPVPEDADSPKFRYSHGSIKWAPEKNAI 362
                  + I+     K+    K +A +V + IPVP      K   S+G  K+ PE+NA+
Sbjct: 347 VSHSTRDNEIDYRITLKSLFPGKLSAKDVILHIPVPPSTVDCKISVSNGHCKFVPEENAM 406

Query: 363 LWKIKSFPGGKEYSMAAQLGLPSVSDFEEPVMKR----PVQVKFQIPYFTTSGIQVRYLK 418
           +W+   + G  E +++A     S SD  +   ++    P+ + F++  F+ SG+ VRY  
Sbjct: 407 IWRFNKYNGLTENTLSA--ATVSTSDTTQLSFQQWTRPPMSLDFEVMMFSNSGLVVRYFT 464

Query: 419 INEPKMQYQSYPWVRYITQSGDDYTIR 445
           I+    ++++  W++YI++SG  Y +R
Sbjct: 465 ISGKDSKHRAVKWIKYISKSG-SYEVR 490

>KLTH0D07502g Chr4 (650799..652313) [1515 bp, 504 aa] {ON} similar
           to uniprot|P38700 Saccharomyces cerevisiae YHL019C APM2
           homologous to the medium chain of mammalian
           clathrin-associated protein complex Similar to clathrin
           coat proteins
          Length = 504

 Score =  172 bits (435), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 143/543 (26%), Positives = 239/543 (44%), Gaps = 136/543 (25%)

Query: 1   MASCIYFCDSKGKKILSRRYKDDIPTNAIDKFPMLLVEREQESSVIPPCLAHNGIQYLFV 60
           M+SC++  D +   ++ R  K    + A  ++  L  +R    S   P +   GI Y+++
Sbjct: 1   MSSCVFILDEQLNPLILRNLK----SIAHPEWYALYFKRVHPQSR-GPVIYSKGIIYIYI 55

Query: 61  QHNDLYVLTMTRS-LSTNVAQLFAFXX--XXXXXXXXXXXXXXXXSIRDNFVIIYELLDE 117
             + LY ++++   L  N+  + A+                     I DNF +IYEL DE
Sbjct: 56  LRDGLYFVSVSNGGLRFNLMGILAYLNDFHALLVKYLKVNKVDRTGIIDNFNLIYELFDE 115

Query: 118 MMDYGIPQITETKMLKQYI-----------------TQKSFKLMKSAKKSKN-------- 152
            +DYGIPQ+T+  +++  I                  ++S   +  +K++K+        
Sbjct: 116 SLDYGIPQLTDYNIIRDSIKIEANVPKVPSNSQADSDEESGPEILQSKENKDKADIHGFR 175

Query: 153 ---------VIRPPIALTNSVSWRPEGIMYKKNEAFLDVVESINMLIT-QQGQVLRSEIL 202
                    V+R     T ++SWRP+GI Y KNE F+D++E  + L+  +  QV ++ + 
Sbjct: 176 DDEQYINSFVLR---TTTQAISWRPKGIYYTKNELFVDIIERQSYLMDFKNSQVRQTFVY 232

Query: 203 GKVKVKSHLSGMPDLKLGLN----DKGIFSNHVSGGVEDEADDLSATGKKKANIELEDLK 258
           GK+  +S+LSGMP +++ +N    DK +F                          L   K
Sbjct: 233 GKINCRSYLSGMPIVRVCINKMLKDKDLF--------------------------LGSSK 266

Query: 259 FHQCVRLSKFENEKIITFIPPDGDFELMSYRL-----TTPIKPLIWCDIKI-QVHSKSRI 312
           FHQCV L    ++  I FIPPDGDF+L  Y+L      +PI  LI  D KI +   K R+
Sbjct: 267 FHQCVSLESLSSQDYIEFIPPDGDFQLCEYKLKRHINDSPIIKLI--DYKINERQKKHRL 324

Query: 313 EVHCRAKAQIKKKSTANNVEILIPVP--------EDADSPKFRYSHGSIKWAPEKNAILW 364
            +    +   K +++A  ++I IP          +   +P+F+  HGS+ +      +LW
Sbjct: 325 HLSVTIQPHFKAQNSATALKIHIPTRDLFQNYKIDLTKAPRFKCDHGSVFFNLSDELLLW 384

Query: 365 KIKSFPGGK---EYSMAAQLGLPSVSDFEEPVMK-------------------------- 395
             +   GG     YSM  +  L    D EE   K                          
Sbjct: 385 DAQGIKGGHGETSYSMHVEFAL---FDEEEHARKLEQIKKSMDPPPLREGAHLEELYAQV 441

Query: 396 ------------RPVQVKFQIPYFTTSGIQVRYLKINEPKMQYQSYPWVRYITQSGDDYT 443
                         +  +F++PY+T+SG++V YLKI+E  ++YQS+ WVRY T +  +Y 
Sbjct: 442 KSNKEGKGQFQSNAITAEFEVPYYTSSGLRVEYLKISEENLKYQSFSWVRYKTINDTEYA 501

Query: 444 IRM 446
            ++
Sbjct: 502 YQV 504

>TPHA0P00660 Chr16 (136114..137535) [1422 bp, 473 aa] {ON} Anc_3.165
           YOL062C
          Length = 473

 Score =  166 bits (419), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 111/380 (29%), Positives = 189/380 (49%), Gaps = 47/380 (12%)

Query: 104 IRDNFVIIYELLDEMM-DYGIPQITETKMLKQYITQKSFKLMKSA----KKSKNVIRPPI 158
           + + F++ YE++D M+    +P  TE   +   I+ +  K + ++    K + N +  P 
Sbjct: 102 LMEKFMVYYEMIDVMLTSNAMPINTELSSIASKISYRLPKTISNSPTNEKNNNNGLSIPK 161

Query: 159 ALT---------------NSVSWRPEGIMYKKNEAFLDVVESINMLITQQGQVLRSEILG 203
            LT               + + WRP GI YKKNE FL V E IN+L+++   +L++ + G
Sbjct: 162 FLTRNSRSMSQEFSNITQSDIPWRPTGIKYKKNEVFLYVNEKINILVSKDQTILKAYVDG 221

Query: 204 KVKVKSHLSGMPDLKLGLNDK-GIFSNHVSGGVED------EADDLSATGKKKANIELED 256
            + + SHLSG P  + GLND   +  N++S   ++      + +DLS      +++++ED
Sbjct: 222 SIDLVSHLSGTPICQFGLNDYLSMTGNNISNRGDEFRHDFMDDEDLSTGRSSSSSVKIED 281

Query: 257 LKFHQCVRLSKFENEKIITFIPPDGDFELMSYRLTTPIKPLIWCDIKIQVHSKSRIEV-- 314
             FHQCV L KF +E++I F+PPDG FELM Y +          D+ I      R+ +  
Sbjct: 282 CTFHQCVSLDKFNDERLINFVPPDGSFELMRYHVRD--------DLNIPFKVTPRVSISS 333

Query: 315 -HCRAKAQIKKKS------TANNVEILIPVPEDADSPKFRYSHGSIKWAPEKNAILWKIK 367
             C  + +I  KS      +A +  + IP+P      K   S G   ++   N  +WK  
Sbjct: 334 SRCSMRYKIILKSLFPTSLSAADAMLKIPLPPGTVDCKINASSGKCNFSTSDNCAIWKFN 393

Query: 368 SFPGGKEYSMAAQLGLPSVSDF--EEPVMKRPVQVKFQIPYFTTSGIQVRYLKINEPKMQ 425
            + G  E  +  +    S +D    +   + P+ + F+I  F+ SG+ V+YLK+ E   +
Sbjct: 394 KYKGLTENELILETVPSSSTDILSLQQWTRPPMSMNFEIIMFSNSGLVVKYLKVMERVQK 453

Query: 426 YQSYPWVRYITQSGDDYTIR 445
           Y+   W++Y+++SG  Y IR
Sbjct: 454 YRPVKWIKYVSKSG-SYEIR 472

>Ecym_4591 Chr4 complement(1154444..1155949) [1506 bp, 501 aa] {ON}
           similar to Ashbya gossypii ABR047W
          Length = 501

 Score =  165 bits (418), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 138/531 (25%), Positives = 240/531 (45%), Gaps = 115/531 (21%)

Query: 1   MASCIYFCDSKGKKILSRRYKDDIPTNAIDKFPMLLVEREQESSVIPPCLAHNGIQYLFV 60
           M SC++  D + + +  R  K   P  ++ + P+    R  + S   P L +    Y+F+
Sbjct: 1   MISCLFILDEELQLLTVRLLK---PVPSLLE-PLEWFIRHPKKS---PILQNMDYDYIFI 53

Query: 61  QHNDLYVLTMTRSLSTNVAQLFAFXXXXXXXXXXXXXXXXXXS---IRDNFVIIYELLDE 117
           Q + LY L+++  L TNV  +  F                  +   I  NF +I+EL+DE
Sbjct: 54  QRDGLYFLSLSYQL-TNVYPMVVFSYLNQLHMLFQKYLGENLNKVLITGNFHLIHELIDE 112

Query: 118 MMDYGIPQITETKMLKQYITQKSFK--------------------------LMKSAKKSK 151
            +  G PQ+T+  +++ YI  +  K                             +    +
Sbjct: 113 SIFMGTPQLTDYNIIRDYIKVQVVKDSPEPATREATVTNTKKNKKKDSKKKEEDTEATDE 172

Query: 152 NVIRPPIA--LTNSVSWRPEGIMYKKNEAFLDVVESINMLITQQGQVLRSE-ILGKVKVK 208
           N +   IA   T+++SWRP+GI Y KNE +LDV+E +  L+  Q   ++S  + G ++ +
Sbjct: 173 NYMNSYIARTTTSAISWRPKGIHYNKNEFYLDVIEHLEYLVDFQCMNIKSNTVYGYIQCR 232

Query: 209 SHLSGMPDLKLGLNDKGIFSNHVSGGVEDEADDLSATGKKKANIELEDLKFHQCVRLSKF 268
           S+LSGMP L +GLN               + +  +    ++AN       FHQCV L + 
Sbjct: 233 SYLSGMPMLTIGLN---------------KLNSENEYFMRRAN-------FHQCVNLDQL 270

Query: 269 ENEKIITFIPPDGDFELMSYRLTT-----PIKPLIWCDIKIQVHSK----SRIEVHCRAK 319
             +K+I+F PPDG+F+L +Y+LT      P+  L  C +K++         R+ +     
Sbjct: 271 TTDKLISFTPPDGEFQLCNYKLTRNMSDPPMIKLEDCKVKLKPRKTKDGLDRLILAVTIS 330

Query: 320 AQIKKKSTANNVEILIPVPE-----DAD---SPKFRYSHGSIKWAPEKNAILWKIKSFPG 371
              K + + + + I +P+ +     D D    P+F+   G + +    + +LW++    G
Sbjct: 331 TYFKLQDSTSLLNIKVPLSKVFRDWDVDLSYQPRFKCEQGKVMFNITDDYLLWEVGKVKG 390

Query: 372 G---KEYSMAAQLGLP------------SVSDFEEPVMKRP------------------- 397
           G   K   M ++  L             S S   +P+ + P                   
Sbjct: 391 GHGDKTLKMQSEFHLHNREHEARIKQQLSNSMDPKPIRRGPHLEKLYQQTHELNSPTSEA 450

Query: 398 --VQVKFQIPYFTTSGIQVRYLKINEPKMQYQSYPWVRYITQSGDDYTIRM 446
             ++V+F+IPY+T SG++V +LKI E ++Q+QS+PWVRY T + D Y  ++
Sbjct: 451 ALLKVEFEIPYYTISGLKVEFLKIEEKQLQFQSFPWVRYKTINHDIYAYQL 501

>KLLA0F25432g Chr6 complement(2365434..2366957) [1524 bp, 507 aa]
           {ON} some similarities with uniprot|P38700 Saccharomyces
           cerevisiae YHL019C APM2 homologous to the medium chain
           of mammalian clathrin-associated protein complex Similar
           to clathrin coat proteins
          Length = 507

 Score =  159 bits (402), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 136/535 (25%), Positives = 231/535 (43%), Gaps = 127/535 (23%)

Query: 1   MASCIYFCDSKGKKILSRRYKDDIPTNAIDKFPMLLVER-EQESSVIPPCLAHNGIQYLF 59
           M+SC    D   + ++ R  +   P + +D   + L    +       P    NG  Y  
Sbjct: 1   MSSCFLLLDETYEPLIRRALR---PIHFLDDAILQLQNNLKHHKGCTKPIFEGNGWHYAV 57

Query: 60  VQHNDLY---VLTMTRSLSTNVAQLFAFXXXXXXXXXXXXXXXXXXSIRDNFVIIYELLD 116
           +  ++LY   ++ +  S+S  ++ L                     ++RDNF +I+E+++
Sbjct: 58  ITRDNLYFAMIMQVNNSVSP-ISVLHYLDEIYQLCRKFMGMKLNKLNVRDNFHLIFEVIE 116

Query: 117 EMMDYGIPQITETKMLKQYITQKSFKLMKSAKKSKNVIR-----PP-------------I 158
           E  DYGI Q+T   ++  +I     +++K    S+N        PP              
Sbjct: 117 ESSDYGIIQVTNYNIIHDFI---KVEVIKPDDDSENTASEKHELPPGDQDETFINSYILR 173

Query: 159 ALTNSVSWRPEGIMYKKNEAFLDVVESINMLITQQGQVLRSEIL-GKVKVKSHLSGMPDL 217
            +T++VSWRP+GI Y KNE FLDV+E +  ++  +  V+R+ ++ G +  +S+LSGMP L
Sbjct: 174 TMTSAVSWRPKGIHYGKNEFFLDVIEKLEFIMDFEEGVVRNNVINGTIICRSYLSGMPQL 233

Query: 218 KLGLNDKGIFSNHVSGGVEDEADDLSATGKKKANIELEDLKFHQCVRLSKF--ENEKIIT 275
            +GLN     + H                       ++ LKFH+CV L     E   +I 
Sbjct: 234 SIGLNKLMQKNVHF----------------------MKRLKFHECVDLHTLIKEESPVIK 271

Query: 276 FIPPDGDFELMSYRLTTPI--KPLIWCDIKIQV-----------HSKSRIEVHCRAKAQI 322
           FIPPDG+FEL +Y+L  P+  +P+    IK+Q             ++ ++ +        
Sbjct: 272 FIPPDGEFELCNYKLNRPLLDEPV----IKLQSFGLSQKPRKNQETQDKLLLKAAITTHF 327

Query: 323 KKKSTANNVEILIPVPE-------DADSPK-FRYSHGSIKWAPEKNAILWKIKSFPGG-- 372
           K + +A  + I IP+         D + P  F+   G + +     +I+WKI +  GG  
Sbjct: 328 KAQDSAKELLIKIPIKSVIRKWNIDLEKPPLFKSDIGDVVFDITAGSIIWKINNLKGGHG 387

Query: 373 -KEYSM-------------AAQLGLPSVSDFEEPVMKRP--------------------- 397
            K Y +             A ++ L +  D   P+   P                     
Sbjct: 388 NKNYGLKCMFEIWDRQIHEALEVQLRNSMD-PPPLRTGPKLERIWDQYHGKTTEYDGNEN 446

Query: 398 ----------VQVKFQIPYFTTSGIQVRYLKINEPKMQYQSYPWVRYITQSGDDY 442
                     + + F+IPY+  SG++V Y KI EP++ YQS+PWVRY T + ++Y
Sbjct: 447 QKEDVDKFALIAMSFEIPYYAVSGLKVEYFKIEEPQLNYQSFPWVRYKTVNDNEY 501

>Kpol_1056.13 s1056 complement(30531..32156) [1626 bp, 541 aa] {ON}
           complement(30531..32156) [1626 nt, 542 aa]
          Length = 541

 Score =  152 bits (384), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 144/571 (25%), Positives = 232/571 (40%), Gaps = 161/571 (28%)

Query: 1   MASCIYFCDSKGKKILSRRYKDDIPTNAIDKFPMLLVEREQESSVIPPCLAHNGIQYLFV 60
           M+SC++  D   + ++S+  K       I +F  L  +        PP        Y+F+
Sbjct: 1   MSSCLFILDESLEPLISKNVKSVRNLTGILEFFKLNYKENG-----PPVFTVLEWHYVFI 55

Query: 61  QHNDLYVLTMTRSLSTNVAQLFAFXXXXXXXXXXXXXXXXXXS-----IRDNFVIIYELL 115
           + + L+ +T        +  L A                   S     + DN ++I EL+
Sbjct: 56  KRDSLWFMTAIHETDDRITNLMALTFYLDQLYLLLKTYFNRSSLDRNIVLDNVLLIIELI 115

Query: 116 DEMMDYGIPQITETKMLKQYITQKS--------------------------------FKL 143
           DE MD+GI Q+T+  ++K YI  K                                  KL
Sbjct: 116 DESMDFGIVQLTDPSIIKDYIRVKVNSPITHLTSDDDSDTEEKHKGLSTYIPGKTDIVKL 175

Query: 144 MK-----SAKKSK-------------NVIRPPIALTN--SVSWRPEGIMYKKNEAFLDVV 183
            K     +A + K             N I   IA T    VSWR +GI Y KNE FLDV+
Sbjct: 176 WKGQPAVTANEGKSNEQDNYDDDDDENFINSYIAKTTIMPVSWRTKGIYYAKNEFFLDVI 235

Query: 184 ESINMLIT-QQGQVLRSEILGKVKVKSHLSGMPDLKLGL-----NDKGIFSNHVSGGVED 237
           E +  L+    G++ ++ I G++K K +LSGMP LK+ L     ND+   SN        
Sbjct: 236 EKVQYLMDFSTGRIRKNLIHGEIKCKCYLSGMPTLKVALNKLIKNDEQFISNS------- 288

Query: 238 EADDLSATGKKKANIELEDLKFHQCVRLSKFE------------NEKIITFIPPDGDFEL 285
                               KFHQCV ++  +            + K I FIPPDG+F L
Sbjct: 289 --------------------KFHQCVSINSLKREINNEEEENTYHGKEIEFIPPDGEFVL 328

Query: 286 MSYRL-----TTPIKPLIWCDIKIQVHSKSRIEVHCRAKAQIKKKSTANNVEILIPVP-- 338
             Y L       P+  L   +IK ++  K +I++H   +   KK+++ + + I IP+   
Sbjct: 329 CKYELKRHVRDVPVIKLSNIEIKPKL-KKYKIQIHVTIETHFKKQNSTSVLTIKIPLRMV 387

Query: 339 ------EDADSPKFRYSHGSIKWAPEKNAILWKIKSFPGGKEYS---MAAQLGLPSVSDF 389
                 +    P+F+   G + +    + ++W++ S  GG   S   M A+  + +  ++
Sbjct: 388 FSQYKIDLTKQPRFKSDFGEVLFNISDDFLIWEVGSMKGGNGESKNNMVAEFFIFNQEEY 447

Query: 390 EE------------PVMKRP-------------------------VQVKFQIPYFTTSGI 412
           +             P+ + P                         + +KF++PY T SG+
Sbjct: 448 DRLQEEMKTSMNPPPLREGPKLEEIYEQTHDNRDEHDKNGISQQLLTMKFEVPYSTCSGL 507

Query: 413 QVRYLKINEPKMQYQSYPWVRYITQSGDDYT 443
           +V YLKI E ++ YQS+PWVRY T + D+Y 
Sbjct: 508 KVEYLKIEENQVNYQSFPWVRYKTINDDEYA 538

>TDEL0B06430 Chr2 (1137277..1138854) [1578 bp, 525 aa] {ON}
           Anc_2.555 YHL019C
          Length = 525

 Score =  144 bits (364), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 104/330 (31%), Positives = 155/330 (46%), Gaps = 75/330 (22%)

Query: 164 VSWRPEGIMYKKNEAFLDVVESINMLIT-QQGQVLRSEILGKVKVKSHLSGMPDLKLGLN 222
           VSWR +GI Y +NE FLDVVE +  L+    G + ++ I GK+  KS+LSGMP LK+  N
Sbjct: 216 VSWRAKGIHYARNEFFLDVVEQVQYLMDFNSGIIKKNLIHGKIICKSYLSGMPKLKIAFN 275

Query: 223 DKGIFSNHVSGGVEDEADDLSATGKKKANIELEDLKFHQCVRLSKFENEKIITFIPPDGD 282
                                    +K    +   KFHQCV      NEK I FIPPDGD
Sbjct: 276 KLS----------------------QKDEQFISHSKFHQCVTWPS-SNEKEIEFIPPDGD 312

Query: 283 FELMSYRL-----TTPIKPLIWCDIKIQVHSKSRIEVHCRAKAQIKKKSTANNVEILIPV 337
           F L  Y L       P+  L+   +K ++  K +I++ C  +   K +++ + + + IP+
Sbjct: 313 FVLCQYELKRHVKDQPMLKLVSFGVKPKL-KKYKIQMSCTIETHFKARNSTSTLNLKIPL 371

Query: 338 PE-------DADSP-KFRYSHGSIKWAPEKNAILWKIKSFPGGK---EYSMAAQLGL--- 383
                    D   P +F+   G + +    + +LW I+   GG    + SMAA+  L   
Sbjct: 372 ARLFQEYQIDLKKPARFKSDSGKVLFNISDDFLLWDIEVMKGGHGDTQLSMAAEFSLFNK 431

Query: 384 ----------------------PSVSDFEEPV---------MKRPVQVKFQIPYFTTSGI 412
                                 P + +  + V           R + +KF+IPY T SG+
Sbjct: 432 KEFEEEQEELKNSMNPPPLRDGPKLEELYDQVHNEKGPSKMASRLLSMKFEIPYSTCSGL 491

Query: 413 QVRYLKINEPKMQYQSYPWVRYITQSGDDY 442
           QV YLKI+E ++QYQS+PWVRY T + ++Y
Sbjct: 492 QVEYLKIDEEQLQYQSFPWVRYKTVNDEEY 521

 Score = 40.0 bits (92), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 34/146 (23%), Positives = 66/146 (45%), Gaps = 15/146 (10%)

Query: 1   MASCIYFCDSKGKKILSRRYKDDIPTNAIDKFPMLLVEREQESSVIP---PCLAHNGIQY 57
           M+SCI+  D   + ++S+  K      AI     +L  R  +S   P   P ++ +   +
Sbjct: 1   MSSCIFITDENLEPLISKNIK------AIPNLQGIL--RLFKSVYTPESQPVISASSFHF 52

Query: 58  LFVQHNDLYVLTMTRSL--STNVAQLFAFXXXXXXXXXXXXXXXXXXS--IRDNFVIIYE 113
           + ++ + L  +++  +   S NV  +  F                     + DN ++I E
Sbjct: 53  VHIKRSSLLYVSVIHAYDASANVMLIATFLDQFHSLLKKYLAVSALDKNMVLDNVLLIME 112

Query: 114 LLDEMMDYGIPQITETKMLKQYITQK 139
           L+DE +D+G+ QIT+  +++ YI  K
Sbjct: 113 LIDESIDFGVIQITDASIMRDYIRVK 138

>ZYRO0E05874g Chr5 (452910..454559) [1650 bp, 549 aa] {ON} similar
           to uniprot|P38700 Saccharomyces cerevisiae YHL019C APM2
           homologous to the medium chain of mammalian
           clathrin-associated protein complex Similar to clathrin
           coat proteins
          Length = 549

 Score =  142 bits (357), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 106/338 (31%), Positives = 164/338 (48%), Gaps = 79/338 (23%)

Query: 161 TNSVSWRPEGIMYKKNEAFLDVVESINMLITQQGQVLRSEIL-GKVKVKSHLSGMPDLKL 219
           T  VSWR +GI Y KNE FLDVVE +  L   + +V+R  ++ GK+  KS+LSGMP LK+
Sbjct: 233 TMPVSWRAKGIHYGKNEFFLDVVEKVQYLADFKEKVVRKNLIHGKIYCKSYLSGMPKLKI 292

Query: 220 GLNDKGIFSNHVSGGVEDEADDLSATGKKKANIELEDLKFHQCVRLSKFENEKIITFIPP 279
            LN            ++ +A  +S +            KFHQCV L    NEK + FIPP
Sbjct: 293 ALNKL----------LQRDAQFMSHS------------KFHQCVALETL-NEKELEFIPP 329

Query: 280 DGDFELMSYRLT-----TPIKPLIWCDIKIQVHSKSRIEVHCRAKAQIKKKSTANNVEIL 334
           DG+F L  Y L      TPI  +   +IK Q+  K ++ +    +   K +++ + + + 
Sbjct: 330 DGEFILCEYELKRHVNDTPILKITSFEIKPQL-KKFKLRILLTIETHFKTRNSTSILNVK 388

Query: 335 IPVPE-------DADSP-KFRYSHGSIKWAPEKNAILWKIKSFPGGK---EYSMAAQLGL 383
           IP+ +       D   P +F+ + G + +    + +LW+I    GG    ++SM A+  L
Sbjct: 389 IPLAKLFADYNIDLSKPTRFKSAAGQVLFNLSDDFLLWEIGQMRGGHGETQFSMVAEFSL 448

Query: 384 -------------------------PSVSDF-------EEP------VMKRPVQVKFQIP 405
                                    P + +        ++P      +  + V + F+IP
Sbjct: 449 FNKEEFEREQEERKHSMNPPPLREGPKLEELYAQTHSQKDPEVLVKSIQSQLVGMDFEIP 508

Query: 406 YFTTSGIQVRYLKINEPKMQYQSYPWVRYITQSGDDYT 443
           Y T SG++V YLKI E ++QYQS+PWVRY T S ++Y 
Sbjct: 509 YTTCSGLKVEYLKIEEEQLQYQSFPWVRYKTISDEEYA 546

>TPHA0I02390 Chr9 (528997..530676) [1680 bp, 559 aa] {ON} Anc_2.555
           YHL019C
          Length = 559

 Score =  140 bits (352), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 109/363 (30%), Positives = 166/363 (45%), Gaps = 106/363 (29%)

Query: 161 TNSVSWRPEGIMYKKNEAFLDVVESINMLITQQGQVLRSEIL-GKVKVKSHLSGMPDLKL 219
           T +VSWR +GI Y KNE FLDVVES+  L+  + +V+R  ++ G++K KS+LSGMP L++
Sbjct: 222 TMAVSWRTKGIYYAKNEFFLDVVESVQYLMNFKDKVIRRNLIHGQIKCKSYLSGMPTLRI 281

Query: 220 GLN----DKGIFSNHVSGGVEDEADDLSATGKKKANIELEDLKFHQCVRLS--------- 266
            LN    D   F  H                           KFHQCV L+         
Sbjct: 282 ALNKILQDDKQFLGHA--------------------------KFHQCVSLNSINIKDLEK 315

Query: 267 -----------KFENEKIITFIPPDGDFELMSYRLTTPIK--PLI---WCDIKIQVHSKS 310
                       F N+K I FIPPDG+F L  Y L   +K  P+I     DIK     K 
Sbjct: 316 DLEGPNDISNKNFVNKKEIEFIPPDGEFVLCQYELRRHVKDPPVINMTSFDIKPNF-KKF 374

Query: 311 RIEVHCRAKAQIKKKSTANNVEILIPVPE--------DADSPKFRYSHGSIKWAPEKNAI 362
           R+++  + +   K++++ + + I IP+ +         +  P+F+   G + +   ++ +
Sbjct: 375 RVQISLKIETHFKRQNSTSLMTIKIPLLQLFNDYKIDLSKQPRFKSDVGKVLFNISEDFL 434

Query: 363 LWKIKSFPGG---KEYSMAAQLGL-------------------------PSV-------- 386
           +W+I +  GG    E  M A+  L                         P +        
Sbjct: 435 IWEIDALKGGHGENEKGMVAEFFLFNQEEYDRLQEEAKISMNPPPLRNGPKLEELYEEMH 494

Query: 387 --SDFEEPVMKRPVQ---VKFQIPYFTTSGIQVRYLKINEPKMQYQSYPWVRYITQSGDD 441
              D E+  +K   Q   ++F+IPY T SG++V YLKI E  ++YQS+PWVRY T + D+
Sbjct: 495 ENEDAEDTALKMKTQYVFMQFEIPYSTCSGLKVEYLKIEEDLLKYQSFPWVRYKTLNDDE 554

Query: 442 YTI 444
           Y  
Sbjct: 555 YAF 557

 Score = 38.1 bits (87), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 29/145 (20%), Positives = 61/145 (42%), Gaps = 12/145 (8%)

Query: 1   MASCIYFCDSKGKKILSRRYKDDIPTNAIDKFPMLLVE-REQESSVIPPCLAHNGIQYLF 59
           M+SC++  D   + ++S+       T  +   P ++   +E  +   PP +  +   Y++
Sbjct: 1   MSSCLFILDELLEPLISKN------TKPVRNLPDIIKSFKESWTPTSPPIITVSNWHYVY 54

Query: 60  VQHNDLYVLTMTRSLSTNVAQLFAF-----XXXXXXXXXXXXXXXXXXSIRDNFVIIYEL 114
           V+ + L+ +     +      L                           I DN +++ EL
Sbjct: 55  VKRDALWFVAAIHYMDEKCMNLMMILFYLDQLYYLLKNYFKKELLTKLLIIDNALLVTEL 114

Query: 115 LDEMMDYGIPQITETKMLKQYITQK 139
           +DE +D+GI Q+T+  +++ YI  K
Sbjct: 115 MDESIDFGIIQMTDPSIIRDYIRVK 139

>CAGL0K03223g Chr11 (296371..298167) [1797 bp, 598 aa] {ON} similar
           to uniprot|P38700 Saccharomyces cerevisiae YHL019c
           involved in clathrin-independent transport
          Length = 598

 Score =  139 bits (349), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 117/393 (29%), Positives = 173/393 (44%), Gaps = 123/393 (31%)

Query: 147 AKKSKNVIRPPIALTN--SVSWRPEGIMYKKNEAFLDVVESINMLIT-QQGQVLRSEILG 203
           A +++  I   IA T    VSWR +GI Y KNE FLDV+E +  L+  + G V RS I G
Sbjct: 230 ANENETFINSYIAKTTIMPVSWRAKGIHYAKNEFFLDVIEKLQYLVDLESGMVRRSLIHG 289

Query: 204 KVKVKSHLSGMPDLKLGL-----NDKGIFSNHVSGGVEDEADDLSATGKKKANIELEDLK 258
           ++  +S+LSGMP LK+ L     NDK   S                            ++
Sbjct: 290 QIVCRSYLSGMPKLKMSLNKLLQNDKQFISQ---------------------------VQ 322

Query: 259 FHQCVRLSKFEN----------------------EKIITFIPPDGDFELMSYRLTTPIK- 295
           FHQCV L   E                       E  I FIPPDGDF L SY L   I+ 
Sbjct: 323 FHQCVSLDSIEKVIKYAEEHSDELKTLKHTEHNAESEIEFIPPDGDFTLCSYELKRHIRD 382

Query: 296 -PLI-WCDIKIQVH-SKSRIEVHCRAKAQIKKKSTANNVEILIPVPE-------DADSP- 344
            P++  C  +I     K ++++    +   K  ++ + +++ IP+ +       D   P 
Sbjct: 383 PPMVKLCSFEITPKWKKYKLKISAAVETHFKPTNSTSKLDVKIPISKVFKDYQIDLKKPI 442

Query: 345 KFRYSHGSIKWAPEKNAILWKIKSFPGGKEY-------------SMAAQLGL-------- 383
           KF+ S+G + +    + +LW+I    GGK +             +MAA+ GL        
Sbjct: 443 KFKTSNGRVVYNISDDFLLWEIGVIKGGKMHGSKEDISKFDNVATMAAEFGLFNEEEYER 502

Query: 384 -----------------PSVSDF-----EE-----PVMKRP------VQVKFQIPYFTTS 410
                            P + D      EE      V ++P      + + F+IPY T S
Sbjct: 503 ERKERETSMNPPPLRTGPKLEDIYKETHEENDGYNSVGQKPKNNLNLLSMDFEIPYCTCS 562

Query: 411 GIQVRYLKINEPKMQYQSYPWVRYITQSGDDYT 443
           G++V YLKI+E ++QYQS+PWVRY T + D+Y 
Sbjct: 563 GLKVEYLKIDEDQLQYQSFPWVRYKTINDDEYA 595

 Score = 39.7 bits (91), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 25/33 (75%)

Query: 104 IRDNFVIIYELLDEMMDYGIPQITETKMLKQYI 136
           + DN +++ EL+DE +DYGI Q+TE  ++K YI
Sbjct: 104 VLDNTLLVMELIDETLDYGIVQLTEPSIMKDYI 136

>KAFR0A02060 Chr1 (428640..430262) [1623 bp, 540 aa] {ON} Anc_2.555
           YHL019C
          Length = 540

 Score =  136 bits (343), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 102/339 (30%), Positives = 156/339 (46%), Gaps = 81/339 (23%)

Query: 163 SVSWRPEGIMYKKNEAFLDVVESINMLITQQGQVLRSEIL-GKVKVKSHLSGMPDLKLGL 221
           SVSWR +GI Y KNE FLDV+E +   +     +++  ++ G++  KS LSGMP LK+ L
Sbjct: 222 SVSWRAKGIQYAKNEFFLDVIEKVEYFMDFSNNIIKKNLIHGEIICKSFLSGMPTLKVSL 281

Query: 222 NDKGIFSNHVSGGVEDEADDLSATGKKKANIELEDLKFHQCVRLSKFENEKIITFIPPDG 281
           N K I+ +                        L   KFHQCV     +  K++ F+PPDG
Sbjct: 282 N-KIIYQDKQF---------------------LSSCKFHQCVMPDSVDEGKVLEFVPPDG 319

Query: 282 DFELMSYRL-----TTPIKPLIWCDIKIQVHSKSRIEVHCRAKAQIKKKSTANNVEILIP 336
           DF L  Y L       P+  LI  ++K ++  K ++++    ++  KK ++   + I IP
Sbjct: 320 DFVLCKYELKRHVNDLPLLKLISYEVKPKL-DKYKLKLFVTIESTFKKTNSTTKLNIKIP 378

Query: 337 V-----PEDAD---SPKFRYSHGSIKWAPEKNAILWKIKSFPGGK-EYSMAAQLGLPSVS 387
           +       D D   + K R   G I +    + +LW+I +  GG  +  M A   L +  
Sbjct: 379 LKVLLEKYDIDLSKNIKSRCDEGKILFNVSDDFLLWEIGAMKGGNSQLKMGADFALFNEE 438

Query: 388 DF----EE--------PVMKRP-------------------------------VQVKFQI 404
           ++    EE        P+   P                               +++ F+I
Sbjct: 439 EYLRQQEELKTSMNPPPLRTGPKLEELYKQIHEEKCNNFTRKGESSDETKGNLIKMDFEI 498

Query: 405 PYFTTSGIQVRYLKINEPKMQYQSYPWVRYITQSGDDYT 443
           PY T+SG++V YLKI EP +QYQ++PWVRY T S D Y 
Sbjct: 499 PYNTSSGLKVEYLKIEEPNLQYQAFPWVRYKTISDDGYA 537

 Score = 39.3 bits (90), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 34/142 (23%), Positives = 63/142 (44%), Gaps = 14/142 (9%)

Query: 1   MASCIYFCDSKGKKILSRRYKD----DIPTNAIDKFPMLLVEREQESSVIPPCLAHNGIQ 56
           M+S +Y  +   + +LS+  K     DIP +       L  ++  +  V  P + +    
Sbjct: 1   MSSILYILNEDLESLLSKSIKALESPDIPLS-------LFKKQFHKHQVTTPVIIYEDYI 53

Query: 57  YLFVQHNDLYVLTMTRSLSTNVAQLFAFXXXXXXXXXXXXXXXXXXS--IRDNFVIIYEL 114
           +  +Q + LY ++ +    TN+ +   +                     I DN V I EL
Sbjct: 54  FTCIQRDTLYFVS-SIDCKTNILETLHYLNEFYILLKNYFNVKQLDKNIIMDNLVPILEL 112

Query: 115 LDEMMDYGIPQITETKMLKQYI 136
           ++E +D+GI QIT++ ++K YI
Sbjct: 113 IEESVDFGIIQITDSNLMKDYI 134

>KNAG0K01150 Chr11 complement(225095..226519) [1425 bp, 474 aa] {ON}
           Anc_3.165 YOL062C
          Length = 474

 Score =  134 bits (338), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 113/482 (23%), Positives = 218/482 (45%), Gaps = 46/482 (9%)

Query: 1   MASCIYFCDSKGKKILSRRYKDDIPTNAIDKFPMLLVEREQESSVIPPCLAHNGIQYLFV 60
           M + +    ++G+ I+S+ +K  +  +  D F + ++      S I   L      Y+  
Sbjct: 1   MINAVLVYSARGELIVSKMFKPTLKRSVGDIFRVQVINSLDVRSPIL-TLGSTTFHYVRT 59

Query: 61  QHNDLYVLTMTRSLSTNVAQLFAFXXXXXXXXXXXXXXXXXXSIRDNFVIIYELLDEMMD 120
               L+V++++R+ + N A  + F                   +++ F++ +ELLD M++
Sbjct: 60  PGEGLWVVSVSRN-NENSAATWEFLYKFATMLAAYRLDSEEV-LKEEFMLAWELLDTMVE 117

Query: 121 YG-IPQITETKMLKQYITQKSFKLMKSAKKSKNVIRPPIALTNS---------------- 163
            G IP  T+   +   I+  S K   S    +   R     T++                
Sbjct: 118 GGGIPSETDPHRI---ISAMSVKPAMSPVDVRADARQQQTTTSTGAFGHAFPQLLHRASN 174

Query: 164 ---VSWRP----EGIMYKKNEAFLDVVESINMLITQQGQVLRSEILGKVKVKSHLSGMPD 216
              +S  P    +G   K+NE  + V ESI++L+++ G +L++ + G + + + L G   
Sbjct: 175 PGGISILPHATGDGAQLKRNEIVMVVQESISILVSKDGSILKAYVDGGIDLTTKLEGAAV 234

Query: 217 LKLGLNDKGIFSNHVSG------GVEDEADDLSATGKKKANIELEDLKFHQCVRLSKFEN 270
            + GLND     N  +         E +  +L         + L D KFHQCV L +F+ 
Sbjct: 235 CQFGLNDSLSTDNSSNSKWDPLRSKETQGTNLEMKNAHVGTVLLRDCKFHQCVSLERFDR 294

Query: 271 EKIITFIPPDGDFELMSYRLTTPIKPLIWCDIKIQVHSKSRIEVHCRAKAQIKKKSTANN 330
           ++II F PP+G  ELM Y +   +         +   + +  +     K+    K +A N
Sbjct: 295 DRIIRFTPPEGTIELMKYHVRDNLNLPFKVTSMVIPTANNETDYRVTIKSLFPGKLSAKN 354

Query: 331 VEILIPVPEDADSPKFRYSHGSIKWAPEKNAILWKIKSFPGGKEYSMAAQLGLPSVSDFE 390
           V + IPVP      K   S+G+ K+ PE+NA++WK   + G  E  ++A + +P+  D  
Sbjct: 355 VTMRIPVPPGTLDCKINVSNGNCKFLPEENAMVWKFHKYNGLTENKLSA-ITVPT-RDTT 412

Query: 391 EPVMKR----PVQVKFQIPYFTTSGIQVRYLKI---NEPKMQYQSYPWVRYITQSGDDYT 443
           +  +++    P+ + F+I  ++ +G+ VRY  +   +    ++++  W++Y++ SG  Y 
Sbjct: 413 QLALQQWSRPPISLDFEILMYSNTGLVVRYFTVLDKHNNNTKFKTVKWIKYVSHSG-SYE 471

Query: 444 IR 445
           +R
Sbjct: 472 VR 473

>NCAS0A12650 Chr1 (2492345..2494111) [1767 bp, 588 aa] {ON}
           Anc_2.555 YHL019C
          Length = 588

 Score =  126 bits (316), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 98/359 (27%), Positives = 160/359 (44%), Gaps = 102/359 (28%)

Query: 164 VSWRPEGIMYKKNEAFLDVVESINMLITQQGQVLRSEIL-GKVKVKSHLSGMPDLKLGLN 222
           +SWR +GI Y KNE FLDV+E +   +  +  V+R  ++ G++  +S+LSGMP LK+ +N
Sbjct: 250 ISWRTKGIHYGKNEFFLDVIEKVEYFMDFKSGVIRKNLIHGEIICRSYLSGMPKLKISIN 309

Query: 223 DKGIFSNHVSGGVEDEADDLSATGKKKANIELEDLKFHQCVRL---------------SK 267
              I    V                      L ++KFHQCV L                K
Sbjct: 310 --KILKQDVQF--------------------LSNVKFHQCVSLDSIRARSNPPAVEEDGK 347

Query: 268 FENEKI--------ITFIPPDGDFELMSYRLTTPIK--PLIWC---DIKIQVHSKSRIEV 314
            +NE+         I FIPPDG+F L  Y L   +K  P+I     +I  ++H K +I++
Sbjct: 348 KKNEEADTLGNKGEIEFIPPDGEFLLCKYELKRHVKDQPMIKLRNFEIIPKLH-KFKIKI 406

Query: 315 HCRAKAQIKKKSTANNVEILIPVP--------EDADSPKFRYSHGSIKWAPEKNAILWKI 366
           H   +   K  ++ + + + IP+         + +  PKF+   G++ +      +LW++
Sbjct: 407 HVIIETHFKTTNSTSKLNLRIPITNLFQSYRIDLSKQPKFKCEQGTVLFNLSDKFLLWEV 466

Query: 367 KSFPGG---KEYSMAAQLGL-------------------------PSVSDFEEPVMKRP- 397
            +  GG      SM A+  L                         P + +  + + +   
Sbjct: 467 GTMNGGHGENTLSMMAEFALFNEEEYKKMEEERKTSMNPPPLREGPKLEELYKKIHEEGD 526

Query: 398 -------------VQVKFQIPYFTTSGIQVRYLKINEPKMQYQSYPWVRYITQSGDDYT 443
                        + + F++PY T SG+++ YLKI E ++QYQS+PWVRY T S D+Y 
Sbjct: 527 SDEVSTRKKNESLLTMDFEVPYCTCSGLKIEYLKIEEDQLQYQSFPWVRYKTISDDEYA 585

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 33/146 (22%), Positives = 69/146 (47%), Gaps = 13/146 (8%)

Query: 1   MASCIYFCDSKGKKILSRRYKDDIPTNAIDKFPMLLVEREQ--ESSVIPPCLAHNGI--Q 56
           M+S I+  D   + I+ +  +      A+   P L+ + ++   S+ + P    N I  Q
Sbjct: 1   MSSSIFILDETLEPIICKNIR------ALPNLPSLVTKFQELYRSNGVSPLPILNDIDWQ 54

Query: 57  YLFVQHNDLYVLTMTRSLS-TNVAQLFAFXXXXXXXXXXXXXXXXXXS--IRDNFVIIYE 113
           +L ++ + L  L++  + S  N+  +F +                     + DNF+++ E
Sbjct: 55  FLHIKRDSLVFLSVVENNSRCNLLGVFTYLEEFYKLLKDYLHVGILNRNLLIDNFLVVIE 114

Query: 114 LLDEMMDYGIPQITETKMLKQYITQK 139
           L+DE +D+G+ Q T++ ++K Y+  K
Sbjct: 115 LIDESLDFGVVQFTDSSLIKDYVRVK 140

>Smik_8.23 Chr8 complement(51372..53183) [1812 bp, 603 aa] {ON}
           YHL019C (REAL)
          Length = 603

 Score =  124 bits (310), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 97/363 (26%), Positives = 168/363 (46%), Gaps = 84/363 (23%)

Query: 150 SKNVIRPPIALTNSVSWRPEGIMYKKNEAFLDVVESINMLIT-QQGQVLRSEILGKVKVK 208
           +K +I P       +SWR +GI Y KNE FLDV+E +  L+  ++G + ++ I G++  +
Sbjct: 253 AKTIIMP-------ISWRTKGIHYAKNEFFLDVIERVQYLMDFEKGIIRKNLIHGEIVCR 305

Query: 209 SHLSGMPDLKLGLN-----DKGIFSNHVSGGVEDEADDLSATGKKKANIELEDLKFHQCV 263
            +LSGMP LK+ +N     D    SN  S   +  + D   T +K+   E +D       
Sbjct: 306 CYLSGMPKLKISINKILNRDAQFLSN--SSFHQCVSLDSIKTIEKREEKEDDDTGLQAAA 363

Query: 264 RLSKFENEKIITFIPPDGDFELMSYRLTTPIK--PLIWC-DIKIQVH-SKSRIEVHCRAK 319
              + E      F+PPDG+F L  Y L   +K  P+I   D +I+    K +I++  + +
Sbjct: 364 DAKELE------FVPPDGEFVLCQYELKRHVKDAPMIKLKDFQIKPKLKKFKIQIETKIQ 417

Query: 320 AQIKKKSTANNVEILIPVP--------EDADSPKFRYSHGSIKWAPEKNAILWKIKSFPG 371
              K  ++ + + + IP+         + +   +F+ + G + +    + +LW+I++  G
Sbjct: 418 TNFKPTNSTSKLNVKIPLTKVFQEYRIDLSKQIRFKSNIGKVVFNLSDDFLLWEIQAMKG 477

Query: 372 GKEY----------------SMAAQLGLPSVSDFEE------------PVMKRP------ 397
            +E+                SM A+  L +  +++             P+   P      
Sbjct: 478 HREHNTNKTSQDDNDPDACASMVAEFPLFNQEEYDRLQEEKKTSMNPPPLRTGPRLEELY 537

Query: 398 -----------------VQVKFQIPYFTTSGIQVRYLKINEPKMQYQSYPWVRYITQSGD 440
                            V + F+IPY T SG+++ YLK+ EP++QYQS+PWVRY T S D
Sbjct: 538 RQVHDQQIAHVTPRDKLVAIDFEIPYCTCSGLKIEYLKVEEPQLQYQSFPWVRYKTTSDD 597

Query: 441 DYT 443
           +Y 
Sbjct: 598 EYA 600

 Score = 38.1 bits (87), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 26/36 (72%)

Query: 104 IRDNFVIIYELLDEMMDYGIPQITETKMLKQYITQK 139
           I DN +++ EL+DE +D+GI Q+T+  ++K YI  K
Sbjct: 104 ILDNVLLVLELMDECIDFGIVQVTDPSIIKDYIRVK 139

>Skud_8.26 Chr8 complement(55759..57549) [1791 bp, 596 aa] {ON}
           YHL019C (REAL)
          Length = 596

 Score =  122 bits (305), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 95/368 (25%), Positives = 162/368 (44%), Gaps = 115/368 (31%)

Query: 164 VSWRPEGIMYKKNEAFLDVVESINMLIT-QQGQVLRSEILGKVKVKSHLSGMPDLKLGLN 222
           +SWR +GI Y KNE FLDV+E +  L+  ++G + ++ I G++  +S+LSGMP LK+ +N
Sbjct: 253 ISWRTKGIHYAKNEFFLDVIERVQYLMDFEKGIIRKNLIHGEIVCRSYLSGMPKLKISIN 312

Query: 223 -----DKGIFSNHVSGGVEDEADDLSATGKKKANIELEDLKFHQCVRLSKFE-------- 269
                D    SN                             FHQCV L            
Sbjct: 313 KILNRDPQFMSNS---------------------------NFHQCVSLDSINTIEKGQEK 345

Query: 270 -----------NEKIITFIPPDGDFELMSYRLTTPIK--PLIWC-DIKIQVH-SKSRIEV 314
                      + + I F+PPDG+F L  Y L   +K  P+I   D +I+    KS+I++
Sbjct: 346 EQNTGDSQAAADAREIEFVPPDGEFVLCQYELKRHVKDAPMIKLKDFEIKPKLKKSKIQI 405

Query: 315 HCRAKAQIKKKSTANNVEILIPVP--------EDADSPKFRYSHGSIKWAPEKNAILWKI 366
             + +   K  ++ + + + IP+         + +   +F+ ++G + +    + +LW+I
Sbjct: 406 LTKIQTNFKPTNSTSKLNVKIPLTRVFQDYKIDLSKQIRFKANNGKVVFNLSDDFLLWEI 465

Query: 367 KSFPGGKE----------------YSMAAQLGLPSVSDFEE-----------PVMK---- 395
           ++  G +E                 SM A+  L +  +++            P ++    
Sbjct: 466 QTMKGHRERNASNAPQDDGDPSTCASMVAEFSLFNQEEYDRLQEEMKTSMNPPPLRTGPK 525

Query: 396 --------------------RPVQVKFQIPYFTTSGIQVRYLKINEPKMQYQSYPWVRYI 435
                               R V + F+IPY T SG++V YLK+ EP++QYQS+PWVRY 
Sbjct: 526 LEELYNQVHDKHTPHVTPRDRLVSIDFEIPYCTCSGLKVEYLKVEEPQLQYQSFPWVRYK 585

Query: 436 TQSGDDYT 443
           T + ++Y 
Sbjct: 586 TVNDEEYA 593

 Score = 38.5 bits (88), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 26/36 (72%)

Query: 104 IRDNFVIIYELLDEMMDYGIPQITETKMLKQYITQK 139
           I DN +++ EL+DE +D+GI Q+T+  ++K YI  K
Sbjct: 104 ILDNVLLVLELMDECIDFGIVQVTDPSIIKDYIRVK 139

>KNAG0C05550 Chr3 complement(1076437..1078185) [1749 bp, 582 aa]
           {ON} Anc_2.555 YHL019C
          Length = 582

 Score =  121 bits (303), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 96/373 (25%), Positives = 160/373 (42%), Gaps = 114/373 (30%)

Query: 152 NVIRPPIALTN--SVSWRPEGIMYKKNEAFLDVVESINMLITQQGQVLRSEIL-GKVKVK 208
           N +   IA T    +SWR +GI Y KNE FL+V+E +   +     V++  ++ G+++ K
Sbjct: 239 NFLNSDIAKTTIMPISWRTKGIHYAKNEFFLNVIEKVEYFMDFTQNVIKKNLIHGEIRCK 298

Query: 209 SHLSGMPDLKLGLN-----DKGIFSNHVSGGVEDEADDLSATGKKKANIELEDLKFHQCV 263
             LSGMP+LK+ +N     DK   +N                            KFHQCV
Sbjct: 299 CFLSGMPNLKVSINKIVNEDKQFLAN---------------------------CKFHQCV 331

Query: 264 RLSKFE--NEKIITFIPPDGDFELMSYRL-----TTPIKPLIWCDIK-----IQVHSKSR 311
            L+  E  + K + F+PPDG+F L  Y L       P+  L+  ++K      ++     
Sbjct: 332 SLASLESSDHKDVEFVPPDGEFTLCRYELKRHVRDEPMVKLVNFEVKPKLKKFKLKLLLT 391

Query: 312 IEVHCRAKAQIKKKSTANNVEILIPVPE--------DADSPKFRYSHGSIKWAPEKNAIL 363
           IE H       K  +  + + + +P+ +         + + K +   G+I +    + +L
Sbjct: 392 IETH------FKTTNATSKLALRVPIKQLFREYRVDLSKNLKSKCDRGAILFNISDDFLL 445

Query: 364 WKIKSFPGGK---EYSMAAQLGLPSVSDFE------------------------------ 390
           W++ S  GG    + SM  +  L +  +++                              
Sbjct: 446 WEVGSMSGGHGETQLSMGVEFALFNQEEYDREQEMLKTSMNPPPLREGPKLEELYKQIHE 505

Query: 391 ---------EPVMKRPVQ-----------VKFQIPYFTTSGIQVRYLKINEPKMQYQSYP 430
                    EPV +  +Q           + F++PY T+SG++V YLKI EP+++YQS+P
Sbjct: 506 DDDDDDGNTEPVAEHRLQPRTREIDKLLTMDFEVPYCTSSGLRVEYLKIEEPQLEYQSFP 565

Query: 431 WVRYITQSGDDYT 443
           WVRY T S  +Y 
Sbjct: 566 WVRYTTLSDAEYA 578

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 29/141 (20%), Positives = 65/141 (46%), Gaps = 6/141 (4%)

Query: 1   MASCIYFCDSKGKKILSRRYKDDIPTNAIDKFPMLLVEREQESSVIPPCLAHNGIQYLFV 60
           M+S +Y  D   + ++S+  K  +P+    ++P+   ++   S+  P    H+   + ++
Sbjct: 1   MSSVLYILDENLETLISKNIKA-VPSL---EYPIAQFKKLYGSNAPPVIDYHDLFTFTYI 56

Query: 61  QHNDLYVLTMTRSLSTNVAQLFAFXXXXXXXXXXXXXXXXXXS--IRDNFVIIYELLDEM 118
           Q + L  +++   + T + +   +                     + DN V+I EL++E 
Sbjct: 57  QRDSLLFVSVVDRVDTGLVETLVYLEHFYEVLKNYLGVKVLDKNIVTDNSVLISELIEET 116

Query: 119 MDYGIPQITETKMLKQYITQK 139
           +D+G  Q+T++ +L  YI  K
Sbjct: 117 IDFGAIQVTDSGLLADYIKMK 137

>KAFR0C01020 Chr3 (208272..209558) [1287 bp, 428 aa] {ON} Anc_3.165
           YOL062C
          Length = 428

 Score =  117 bits (294), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 105/457 (22%), Positives = 206/457 (45%), Gaps = 53/457 (11%)

Query: 1   MASCIYFCDSKGKKILSRRYKDDIPTNAIDKFPMLLVEREQESSVIPPCLAHNGIQYLFV 60
           M S I     +G+ I+S+ Y+++I  +  + F + ++      S I   L      ++  
Sbjct: 1   MISAILIYTPRGELIVSKLYRNNIKRSISEIFRIQVINNFNVRSPIL-TLGSTTFHHIRS 59

Query: 61  QHND-----LYVLTMTRSLSTNVAQLFAFXXXXXXXXXXXXXXXXXXSIRDNFVIIYELL 115
             ND     L+++ + R+ + N A ++ F                   ++D F+ ++E+L
Sbjct: 60  TANDPTDDELWLVCVNRN-NANSAAIWEFLQKLNLILQQYGITSES-KLKDEFMTVHEIL 117

Query: 116 DEMM-DYGIPQITETKMLKQYITQKSFKLMKSAKKSKNVIRPPIALTNSVSWRPEGIM-- 172
           D M+   GI Q T+   LK  + + S K +    ++ +     +   N++   P      
Sbjct: 118 DNMLLGTGIIQNTD---LKSIVDKMSVKPISRTNETTSTQTGFLKRRNTILTTPGANFSL 174

Query: 173 --------YKKNEAFLDVVESINMLITQQGQVLRSEILGKVKVKSHLSGMPDLKLGLNDK 224
                   +KKNE F  V ES+N+L+++ G +L++ + GK+++KSHL+G P  +  L   
Sbjct: 175 IPTNRHDAHKKNEIFFFVNESMNLLVSKDGSILKNYVDGKIEIKSHLNGNPTCQFEL--- 231

Query: 225 GIFSNHVSGGVEDEADDLSATGKKKANIELEDLKFHQCVRLSKFENEKIITFIPPDGDFE 284
                     V+D+              ++ D KF QC+   +    + +     DG+ E
Sbjct: 232 ----------VDDQT-------------KITDFKFDQCIEKVQ---SRTVRVAATDGELE 265

Query: 285 LMSYRLTTPIKPLIWCDIKIQVHSKSRIEVHCRAKAQIKKKSTANNVEILIPVPEDADSP 344
           +++Y +      + +    I    K  ++     K+   K  +A +V + IPVP +    
Sbjct: 266 IVNYHVRDDKINIPFKITPIVSTVKDTVDYRISLKSLFPKNLSATDVVLTIPVPPNTIDC 325

Query: 345 KFRYSHGSIKWAPEKNAILWKIKSFPGGKEYSMAAQLGLPSVSDFEEPVMKRP-VQVKFQ 403
           K   S+G  K+  E+NA++W    F G  E +++A                RP +Q+ F+
Sbjct: 326 KINVSNGHCKFKAEQNAVIWTFNKFNGSTENTLSAITIADGRQIMNLESWTRPSIQLTFE 385

Query: 404 IPYFTTSGIQVRYLKI-NEPKMQYQSYPWVRYITQSG 439
           I  ++ SG+ +R L I ++ K +Y++  W++YI+++G
Sbjct: 386 ITMYSISGLLLRNLMITDKDKRRYKASRWIKYISRAG 422

>Suva_8.33 Chr8 complement(69735..71525) [1791 bp, 596 aa] {ON}
           YHL019C (REAL)
          Length = 596

 Score =  119 bits (298), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 98/370 (26%), Positives = 158/370 (42%), Gaps = 118/370 (31%)

Query: 164 VSWRPEGIMYKKNEAFLDVVESINMLITQQGQVLRSEIL-GKVKVKSHLSGMPDLKLGLN 222
           +SWR +GI Y KNE FLDV+E +  L+  +  ++R  ++ G++  + +LSGMP LK+ +N
Sbjct: 252 ISWRTKGIHYSKNEFFLDVIERVQYLMDFEKGIIRKNLIHGEIVCRCYLSGMPKLKISIN 311

Query: 223 -----DKGIFSNHVSGGVEDEADDLSATGKKKANIELEDLKFHQCVRLSKFE-------- 269
                D    SN                            KFHQCV L            
Sbjct: 312 KLLNRDPQFMSNS---------------------------KFHQCVSLDSINIIEEEGRD 344

Query: 270 ----------NEKIITFIPPDGDFELMSYRLTTPIK--PLI---WCDIKIQVHSKSRIEV 314
                     + K I FIPPDG+F L  Y L   +K  P+I     +IK ++  K +I++
Sbjct: 345 TDDAGSQTATDTKEIEFIPPDGEFVLCQYELKRHVKDAPMIKLQGFEIKPKL-KKFKIQI 403

Query: 315 HCRAKAQIKKKSTANNVEILIPVP--------EDADSPKFRYSHGSIKWAPEKNAILWKI 366
             + +   K  ++ + + + IP+         + +   +F+ + G + +    + +LW+I
Sbjct: 404 ITKIQTNFKPTNSTSKLNVKIPLTKVFQDYKIDLSKQIRFKANLGKVVFNLSDDFLLWEI 463

Query: 367 KSFPGGKE---------------YSMAAQLGLPSVSDFEE------------PVMKRP-- 397
            +  G +E                SM A+  L +  +++             P+   P  
Sbjct: 464 GTMKGHRERNTGTVPQEDDASTLASMVAEFPLFNQEEYDRLQEELKTSMNPPPLRTGPKL 523

Query: 398 ------------------------VQVKFQIPYFTTSGIQVRYLKINEPKMQYQSYPWVR 433
                                   V V F+IPY T SG++V YLK+ EP++QYQS+PWVR
Sbjct: 524 EELYKQVHEERVLHTHDVAPRDKLVSVDFEIPYCTCSGLKVEYLKVEEPQLQYQSFPWVR 583

Query: 434 YITQSGDDYT 443
           Y T S D+Y 
Sbjct: 584 YKTISDDEYA 593

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 26/98 (26%), Positives = 48/98 (48%), Gaps = 5/98 (5%)

Query: 47  PPCLAHNGIQYLFVQHNDLY---VLTMTRSLSTNVAQLFAFXXXXXXXXXXXXXXXXXXS 103
           PP L+ NG  ++ ++ + L+   V+  T   + ++  + AF                   
Sbjct: 42  PPILSQNGWFFIHLKRDFLHFISVIHATDKPNIDLMSILAFLEQFYHLLKKYFEINVLSK 101

Query: 104 --IRDNFVIIYELLDEMMDYGIPQITETKMLKQYITQK 139
             I DN +++ EL+DE +D+GI Q+T+  ++K YI  K
Sbjct: 102 NIILDNVLLVLELVDECIDFGIVQVTDPSIIKDYIRVK 139

>YHL019C Chr8 complement(67731..69548) [1818 bp, 605 aa] {ON}
           APM2Protein of unknown function, homologous to the
           medium chain of mammalian clathrin-associated protein
           complex; involved in vesicular transport
          Length = 605

 Score =  117 bits (294), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 94/372 (25%), Positives = 158/372 (42%), Gaps = 119/372 (31%)

Query: 164 VSWRPEGIMYKKNEAFLDVVESINMLITQQGQVLRSEIL-GKVKVKSHLSGMPDLKLGLN 222
           +SWR +GI Y KNE FLDV+E +  L+  +  V+R  ++ G++  + +LSGMP LK+ +N
Sbjct: 258 ISWRTKGIHYAKNEFFLDVIERVQYLMDFEKGVIRKNLIHGEIVCRCYLSGMPKLKISIN 317

Query: 223 -----DKGIFSNHVSGGVEDEADDLSATGKKKANIELEDLKFHQCVRLSKFE-------- 269
                D    SN                             FHQCV L            
Sbjct: 318 KILNRDPQFMSNS---------------------------SFHQCVSLDSINTIEKDEEK 350

Query: 270 ------------NEKIITFIPPDGDFELMSYRLTTPIK--PLIWC-DIKIQVH-SKSRIE 313
                       + + I FIPPDG+F L  Y L   +K  P++   D +I+    K +I+
Sbjct: 351 NSDDDAGLQAATDAREIEFIPPDGEFVLCQYELKRHVKDAPMVRLKDFEIKPKLKKFKIQ 410

Query: 314 VHCRAKAQIKKKSTANNVEILIPVP--------EDADSPKFRYSHGSIKWAPEKNAILWK 365
           +  + +   K  ++ + + + IP+         + +   +F+ + G + +    + +LW+
Sbjct: 411 IVTKIQTNFKPTNSTSKLNVRIPLTKVFQEYKIDLSKQIRFKANIGKVVFNLSDDFLLWE 470

Query: 366 IKSFPGGKEY-------------------SMAAQLGLPSVSDFEE------------PVM 394
           I++  G +E+                   SM A+  L +  +++             P+ 
Sbjct: 471 IQTMKGHREHSTNKSSQYNSDEDDPNTCASMVAEFPLFNQEEYDRLQEEMKTSMNPPPLR 530

Query: 395 KRP-----------------------VQVKFQIPYFTTSGIQVRYLKINEPKMQYQSYPW 431
             P                       V + F+IPY T SG++V YLK+ EP++QYQS+PW
Sbjct: 531 TGPRLEELYRQVHDQQTSHVTPRDKLVNIDFEIPYCTCSGLKVEYLKVEEPQLQYQSFPW 590

Query: 432 VRYITQSGDDYT 443
           VRY T S ++Y 
Sbjct: 591 VRYKTVSDEEYA 602

 Score = 38.5 bits (88), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 26/36 (72%)

Query: 104 IRDNFVIIYELLDEMMDYGIPQITETKMLKQYITQK 139
           I DN +++ EL+DE +D+GI Q+T+  ++K YI  K
Sbjct: 104 ILDNILLVLELIDECIDFGIVQVTDPSIIKDYIRVK 139

>TBLA0B06760 Chr2 (1594957..1596930) [1974 bp, 657 aa] {ON}
           Anc_2.555 YHL019C
          Length = 657

 Score = 99.0 bits (245), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 80/282 (28%), Positives = 138/282 (48%), Gaps = 41/282 (14%)

Query: 114 LLDEMMDYGIPQITETKMLKQYITQKSFKLMKSAKKSKNVIRPPIALTN--SVSWRPEGI 171
           +L  + +  + +I E +     + ++  KL+  A+  +N I   IA T    +SWR +GI
Sbjct: 236 MLQTITNPDVSKILELRKHVNILNKEDMKLV-DAENDENYINSYIAKTTIMPISWRTKGI 294

Query: 172 MYKKNEAFLDVVESINMLITQQGQVLRSEIL-GKVKVKSHLSGMPDLKLGLNDKGIFSNH 230
            Y KNE FLDV+E    ++  +  ++R  ++ GK+  +  LSGMP LK+ LN        
Sbjct: 295 YYAKNEFFLDVLEKQEYIMDFKNDLIRKNLIQGKIICRCFLSGMPKLKIALN-------- 346

Query: 231 VSGGVEDEADDLSATGKKKANIELEDLKFHQCVRLSKFENEKIITFIPPDGDFELMSYRL 290
                            +K    L  L+FHQCV L   +N++I  FIPPDG+F L  Y L
Sbjct: 347 --------------KLLQKDQQFLSQLRFHQCVSLETIQNKEI-EFIPPDGEFILCEYEL 391

Query: 291 TTPIK-----PLIWCDIKIQVHSKSRIEVHCRAKAQIKKKSTANNVEILIPVPEDAD--- 342
              +K      LI  +IK ++  K +I+++       K +++ + + + IP+ +  +   
Sbjct: 392 KRHVKDPPNIKLISFEIKPKL-KKFKIQINLSITTFFKVQNSTSILNLKIPLEKLFNDYK 450

Query: 343 -----SPKFRYSHGSIKWAPEKNAILWKIKSFPGGKEYSMAA 379
                SP+F+ + G +K+    + +LW+I S  GG   ++ A
Sbjct: 451 IDLKKSPRFKSNIGQVKFNLSDDFLLWEIGSMKGGHGENIKA 492

 Score = 59.7 bits (143), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 24/45 (53%), Positives = 33/45 (73%)

Query: 398 VQVKFQIPYFTTSGIQVRYLKINEPKMQYQSYPWVRYITQSGDDY 442
           + V F+IPY+  SG++V YLKI E ++ YQS+PWVRY T +  DY
Sbjct: 609 LTVDFEIPYYACSGLKVEYLKIEEEQLLYQSFPWVRYKTTNDKDY 653

 Score = 37.4 bits (85), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 26/36 (72%)

Query: 104 IRDNFVIIYELLDEMMDYGIPQITETKMLKQYITQK 139
           I DN ++I EL+DE +D+GI Q+T+  ++K Y+  K
Sbjct: 105 ILDNILLIMELIDESIDFGIIQMTDPNIIKDYVRVK 140

>NDAI0B01610 Chr2 complement(384287..386305) [2019 bp, 672 aa] {ON}
           Anc_2.555 YHL019C
          Length = 672

 Score = 93.6 bits (231), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 73/253 (28%), Positives = 117/253 (46%), Gaps = 47/253 (18%)

Query: 164 VSWRPEGIMYKKNEAFLDVVESINMLIT-QQGQVLRSEILGKVKVKSHLSGMPDLKLGL- 221
           +SWR +GI Y KNE FLDV+E +   +  ++G + ++ I G++  K +LSGMP LK+ + 
Sbjct: 295 ISWRTKGIHYAKNEFFLDVIEKVEYFMDFEKGLIRKNLIHGEIVCKCYLSGMPKLKISIN 354

Query: 222 ----NDKGIFSN------------HVSGGVEDEADDLSATGKKKANIELEDLKFHQCVRL 265
               ND    SN            H+    +D+ DD +A   +  N +  D K       
Sbjct: 355 KILQNDSQFLSNAHFHQCVSLDSLHLQSAEDDDGDD-NANVNENENHDERDRK------- 406

Query: 266 SKFENEKIITFIPPDGDFELMSYRL-----TTPIKPLIWCDIKIQVHSKSRIEVHCRAKA 320
                 K I FIPPDGDF L  Y L       P+  L   DIK ++ SK ++++H   + 
Sbjct: 407 ------KEIEFIPPDGDFLLCKYELKRHVKDLPVIKLKLFDIKPKL-SKYKLKIHVIIET 459

Query: 321 QIKKKSTANNVEILIPVP--------EDADSPKFRYSHGSIKWAPEKNAILWKIKSFPGG 372
             K  +  + + + IP+         + +   KF+   G + +    N ++W+I S  GG
Sbjct: 460 HFKTTNNTSKLNLKIPIERLFQEYRIDLSKQIKFKCDQGKVLFNLSDNFLIWEIGSMKGG 519

Query: 373 K-EYSMAAQLGLP 384
             E +M+     P
Sbjct: 520 HGEVTMSMMAEFP 532

 Score = 67.0 bits (162), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 38/46 (82%)

Query: 398 VQVKFQIPYFTTSGIQVRYLKINEPKMQYQSYPWVRYITQSGDDYT 443
           +++ F+IPY+T SG+++ YLKI EP++QYQS+PWVRY T S ++Y 
Sbjct: 624 LKIDFEIPYYTCSGLKIEYLKIEEPQLQYQSFPWVRYKTISDEEYA 669

 Score = 43.5 bits (101), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 41/168 (24%), Positives = 76/168 (45%), Gaps = 34/168 (20%)

Query: 1   MASCIYFCDSKGKKILSRRYKDDIPTNAIDKFPMLL----VEREQESSV-------IPPC 49
           M+SCI+  D   + IL++  +  I  N    F +LL    + R+Q++ +       + P 
Sbjct: 1   MSSCIFILDENLEPILNKNIRS-IGNN----FELLLKFQEIYRKQQNEIHNNDDSKVLPI 55

Query: 50  LAHN---------------GIQYLFVQHNDLYVLTMTRSLSTN-VAQLFAFXXXXXXXXX 93
           L  N               G Q+L ++ + L  +++  + S N +  +F++         
Sbjct: 56  LNTNDYGMSNSTNGGGGNCGWQFLHIKRDSLIFVSIIENNSMNSLMIIFSYLEEFYKLLK 115

Query: 94  XXXXXXXXXS--IRDNFVIIYELLDEMMDYGIPQITETKMLKQYITQK 139
                       + DNF+++ ELLDE +D+GI Q T++ ++K YI  K
Sbjct: 116 SYLNVTKLDKGLLIDNFLLVMELLDESLDFGIVQFTDSSLIKDYIRVK 163

>AGL061W Chr7 (593647..594882) [1236 bp, 411 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBR288C (APM3)
          Length = 411

 Score = 73.9 bits (180), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 85/376 (22%), Positives = 154/376 (40%), Gaps = 82/376 (21%)

Query: 114 LLDEMMDYGIPQITETKMLKQYITQKS--FKLMKSAKK----------SKNVIRPPIALT 161
           LL  M+D G   +T++  L+Q +  ++    ++ SA K          SK +   P+A  
Sbjct: 73  LLHAMLDAGEVAVTDSNRLRQLVPLRNDLSTILNSATKTLANTVKYADSKQLFGAPVATG 132

Query: 162 -----NSVSWRPEGIMYKKNEAFLDVVESINMLITQQGQ---VLRSEILGKVKVKSHLSG 213
                 +V WR     Y  NE ++D+VE++N  + Q+G    ++   + GK+ VK +LSG
Sbjct: 133 KVEAGQTVPWRTADCRYVNNEIYVDLVETVNATLRQKGSSLTLINGSLSGKIDVKCYLSG 192

Query: 214 MPDLKLGLNDKGIFSNHVSGGVEDEADDLSATGKKKANIELEDLKFHQCVRLSKFENEKI 273
            P ++L L   G    H                       L++   H+CV L +      
Sbjct: 193 NPTVQLKLRTSG----H----------------------PLDNSALHRCVELGE-AGVAT 225

Query: 274 ITFIPPDGDFELMSYRL-----TTPIKPLIWCDIKIQVHSKSRIEVHCRAKAQIK----- 323
           + F+PPDG F L  Y +     +   + L    + + V   S +  H R + +IK     
Sbjct: 226 MNFVPPDGRFTLAEYAIDLSAISQAARRLTNLGL-VTVSLASGLGQH-RDEFEIKVIIGN 283

Query: 324 --KKSTANNVEILIPVPEDADSPK---FRYSHGSIK---------WAPEKNAILWKIKSF 369
             + +   ++ I +  P+ +D+ K    R +HG  +         WA +K   +  +   
Sbjct: 284 STQVAAIEDLRITVYFPDISDAAKIKILRTTHGGWESDLSRVRGVWAFDKQTAVGSVPVL 343

Query: 370 PGGKEYSMAAQLGLPSVSDFEEPVMKRPVQVKFQIPYFTTSGIQVRYLKINEPKMQYQSY 429
            G  E         P  +    PV    + V +       SGI+V  + +++     + +
Sbjct: 344 RGCVEN--------PESTPHAPPVFPSHLAVSYSHVGQLPSGIRVDTIALSDLPPGSKPF 395

Query: 430 PWVRYITQSGDDYTIR 445
             V+Y +++G DY +R
Sbjct: 396 KGVKYTSRAG-DYIVR 410

>SAKL0A09218g Chr1 complement(802348..803734,803809..803843) [1422
           bp, 473 aa] {ON} similar to uniprot|P38153 Saccharomyces
           cerevisiae YBR288C APM3 Mu3-like subunit of the yeast
           AP-3 complex which functions in transport of alkaline
           phosphatase to the vacuole via the alternate pathway
           clathrin associated protein medium chain
          Length = 473

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 56/217 (25%), Positives = 87/217 (40%), Gaps = 56/217 (25%)

Query: 104 IRDNFVIIYELLDEMMDYGIPQITETKMLKQY---------------------ITQKSFK 142
           I  N+  +  L + M+D G P IT+   LK+                      I+     
Sbjct: 120 ITKNYDRVTLLFNSMVDAGEPDITDLNRLKEIVPLKNNFARVINSTASSIGKTISNAEGN 179

Query: 143 LMKSAKKSKNVIRPPIALTN---SVSWRPEGIMYKKNEAFLDVVESINMLITQQGQV--- 196
            M S   S + I   ++  N   +V WR  G+ Y  NE ++D+ E++N+++ +       
Sbjct: 180 QMFSKHSSNSRIGSSVSYANRDRTVPWRSAGVKYTNNELYVDMAETVNIILAKTRNSTSL 239

Query: 197 --LRSEILGKVKVKSHLSGMPDLKLGLNDKGIFSNHVSGGVEDEADDLSATGKKKANIEL 254
             +   I G+V  K +LS  P ++L LN  G               DL            
Sbjct: 240 VPISGSIDGEVGFKCYLSENPLVELDLNTNG--------------HDLGIPA-------- 277

Query: 255 EDLKFHQCVRLSKFE-NEKIITFIPPDGDFELMSYRL 290
               FH+CVR    + +   + FIPPDGDF LM Y +
Sbjct: 278 ----FHRCVRTEGSDFHPGTLRFIPPDGDFCLMEYNI 310

>KLTH0D06556g Chr4 complement(570972..572342) [1371 bp, 456 aa] {ON}
           similar to uniprot|P38153 Saccharomyces cerevisiae
           YBR288C APM3 Mu3-like subunit of the yeast AP-3 complex
           which functions in transport of alkaline phosphatase to
           the vacuole via the alternate pathway clathrin
           associated protein medium chain
          Length = 456

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 87/374 (23%), Positives = 142/374 (37%), Gaps = 80/374 (21%)

Query: 111 IYELLDEMMDYGIPQITETKMLKQYI------------TQKSFKLMKSAKKSKNVI---- 154
           I  LL+ M+D   P +T+   L+  +            T  S     S + +  V+    
Sbjct: 115 IALLLNCMVDANEPAVTDFNHLRDMVPSREDLSKVINSTASSLSNRISQRNTSQVLNIGD 174

Query: 155 --RPPIALTNSVSWRPEGIMYKKNEAFLDVVESINMLI-----TQQGQVLRSEILGKVKV 207
             + P A    V WR  G+ Y  NE ++DVVE++++++     T +   +R  + G V  
Sbjct: 175 PAKGPAAKEKLVPWRSAGVKYSNNELYVDVVETVHVILRKNEKTGELTSVRGVLDGVVDF 234

Query: 208 KSHLSGMPDLKLGLNDKGIFSNHVSGGVEDEADDLSATGKKKANIELEDLKFHQCVRLSK 267
           +SHLSG P + L L  +G               DL                 HQC   S 
Sbjct: 235 RSHLSGNPVIALNLRLRG--------------HDLGMPA------------LHQCCLDSY 268

Query: 268 FENEKIITFIPPDGDFELMSYRL---TTPIKPLIWCDIKIQVHSKSRIEV-----HCRAK 319
                 + F+PPDG F+LM Y +   +   K  ++ +I + V    R E+          
Sbjct: 269 QGRPDQLRFVPPDGKFQLMHYSIDLDSLQSKSKLFSNIGL-VSPDYRTELGDLGDEFEVN 327

Query: 320 AQIKKKSTANNVEILI------PVPEDADSPKFRYSHGSIKWAPEKNAILWKI-KSFPGG 372
             I     A  V+ L+      P+P +      R +HG  +     N   W   K  P G
Sbjct: 328 LNIAGSQHAKVVDDLVITLSFGPLPSECKIKVLRSTHGHFENCASNNIGKWVFDKETPTG 387

Query: 373 KEYSMAAQLGLPSVSDFEEPVMKRPVQ-VKFQIPYFTT----SGIQVRYLKI-NEPKMQY 426
                     LP +    E   +  V+ ++  + Y       SGI+V  + I +      
Sbjct: 388 T---------LPVLRGCLENATREQVRALQLSVSYTNRGELPSGIKVDSVDILSGLSKNI 438

Query: 427 QSYPWVRYITQSGD 440
           + +  V+YI ++GD
Sbjct: 439 KPFKGVKYIAKTGD 452

>TDEL0A02970 Chr1 complement(532395..533885) [1491 bp, 496 aa] {ON}
           Anc_2.522 YBR288C
          Length = 496

 Score = 62.0 bits (149), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 75/312 (24%), Positives = 126/312 (40%), Gaps = 66/312 (21%)

Query: 164 VSWRPEGIMYKKNEAFLDVVESINMLITQQGQVLR----------SEILGKVKVKSHLSG 213
           V WR  G+ Y  NE ++D+ ESI+++  + G+  R            I G+  VK +LSG
Sbjct: 211 VPWRTAGLKYSNNELYVDLTESIHVVYQKAGKRSRRTSSKLEMICGTINGQASVKCYLSG 270

Query: 214 MPDLKLGLNDKGIFSNHVSGGVEDEADDLSATGKKKANIELEDLKFHQCVRLSKFENEK- 272
            P + L L+  G              +DL                FH+CV L   +N   
Sbjct: 271 NPTVDLQLDLAG--------------NDLGVPA------------FHECVELDNHQNPSN 304

Query: 273 -IITFIPPDGDFELMSYR--LTTP----------IKPLIWCDIKIQVHSKS---RIEVHC 316
             + FIPPDG F LM Y   L TP             L+  D   Q+ +K+    I V+ 
Sbjct: 305 CDLRFIPPDGRFNLMQYSIDLDTPRIQQTRRFNHTVGLVTIDFADQLGNKTDEFEITVNI 364

Query: 317 RAKAQIKK-KSTANNVEILIPVPEDADSP----KFRYSHGSIKWAPEKNAILWKIKSFPG 371
               ++   +    +V++     ED+++       R +HG        N+++    S+  
Sbjct: 365 SNSREVANIEDLRIDVQLQSNTDEDSETDFKIKVLRNTHGRF-----DNSVVPGQGSWIF 419

Query: 372 GKEYSMAAQLGLPSVSDFEEPVMKR--PVQVKFQIPYFTTSGIQVRYLKINEPKMQY-QS 428
            K+        L    +  EP + R   V   + +     SGI+V+ + I +   +  + 
Sbjct: 420 DKDTPTGTLPVLRGCVESTEPRLLRVQRVTASYSLSGQLASGIRVKAINIGQLTTKSNRP 479

Query: 429 YPWVRYITQSGD 440
           +  V+Y T++GD
Sbjct: 480 FKGVKYATKTGD 491

>KLLA0E18789g Chr5 (1669103..1670596) [1494 bp, 497 aa] {ON} similar
           to uniprot|P38153 Saccharomyces cerevisiae YBR288C APM3
           Mu3-like subunit of the yeast AP-3 complex which
           functions in transport of alkaline phosphatase to the
           vacuole via the alternate pathway clathrin associated
           protein medium chain
          Length = 497

 Score = 60.1 bits (144), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 43/139 (30%), Positives = 66/139 (47%), Gaps = 37/139 (26%)

Query: 162 NSVSWRPEGIMYKKNEAFLDVVESINMLITQQGQVLRSEILGKVKVKSHLSGMP--DLKL 219
           + V WR  GI Y  NE F+D+ E IN ++ ++G++L   I G + + +HLSG P  ++KL
Sbjct: 208 SGVPWRMSGINYANNEIFIDMSEEINAIV-EKGKLLTGHIKGCIDLNNHLSGQPLVEMKL 266

Query: 220 GLNDKGIFSNHVSGGVEDEADDLSATGKKKANIELEDLKFHQCVRLSKFE--NEKI---- 273
           GL D  +  +H+                        +  FH+C+   K    N+ I    
Sbjct: 267 GLLDHKL--SHL------------------------NTTFHRCILEDKANSINDLIAGKF 300

Query: 274 --ITFIPPDGDFELMSYRL 290
             +TF+PPDG   L  Y L
Sbjct: 301 TKLTFVPPDGRTRLCQYTL 319

>TPHA0C04130 Chr3 complement(886804..888405) [1602 bp, 533 aa] {ON}
           Anc_2.522 YBR288C
          Length = 533

 Score = 60.1 bits (144), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 44/167 (26%), Positives = 78/167 (46%), Gaps = 44/167 (26%)

Query: 143 LMKSAKKSKNVIRPPIALTNSVS--WRPEGIMYKKNEAFLDVVESINMLITQQGQ----- 195
           L KS K+  N     +   ++V+  WR   + +  NE +LD+VESI++++  + +     
Sbjct: 179 LQKSQKQQSNFPYQDMNFDSNVAVPWRMRNVDHVNNELYLDLVESIHVVLETKKRKSSYA 238

Query: 196 -----VLRSEILGKVKVKSHLSGMPDLKLGLNDKGIFSNHVSGGVEDEADDLSATGKKKA 250
                ++   I+GK  VKS L+G P +++ +                   D++       
Sbjct: 239 NSTMKIVTGNIIGKALVKSVLNGNPIVEMKI-------------------DMAGN----- 274

Query: 251 NIELEDLKFHQCVRL------SKFENEKIITFIPPDGDFELMSYRLT 291
             +LE +  H+CV+        +FEN K+I F+PPDG F+L  Y + 
Sbjct: 275 --DLESIFLHECVKSKDVDKDQEFENTKLIKFLPPDGSFKLFDYNIN 319

>TBLA0I00620 Chr9 complement(110231..112060) [1830 bp, 609 aa] {ON}
           Anc_2.522 YBR288C
          Length = 609

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 43/149 (28%), Positives = 76/149 (51%), Gaps = 32/149 (21%)

Query: 164 VSWRPEGIMYKKNEAFLDVVESINMLITQQG------------------QVLRSEILGKV 205
           V WR   + Y  NE ++DV+E I+++  ++                   +++R++I+G++
Sbjct: 256 VPWRSGNVKYTNNEIYIDVIEEIHVVYQRRNSKRYHKINQFNRNDNSPMKLIRADIIGEL 315

Query: 206 KVKSHLSGMPDLKLGLNDKGIFSNHVSGGVEDEADDLSATGKKKANIELEDLKFHQCVRL 265
            V+S+LS  P +++ L D+  +S+  +G  E++         K+ N+ L    FH CV +
Sbjct: 316 NVRSYLSDNPMVEVTLVDRN-YSDQKTGWSENDL-------FKQLNLGLP--MFHDCVEI 365

Query: 266 S--KFENEKI--ITFIPPDGDFELMSYRL 290
              K  N+    I FIPPDG F LM Y +
Sbjct: 366 DYEKGINQDFRHIKFIPPDGKFSLMKYNI 394

>Kwal_26.7957 s26 complement(586544..587914) [1371 bp, 456 aa] {ON}
           YBR288C (APM3) - clathrin associated protein medium
           chain [contig 55] FULL
          Length = 456

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 40/132 (30%), Positives = 60/132 (45%), Gaps = 31/132 (23%)

Query: 164 VSWRPEGIMYKKNEAFLDVVESINMLI---TQQGQVL--RSEILGKVKVKSHLSGMPDLK 218
           V WR  G+ Y  NE ++DVVE+I++++    + GQ++  R  I G V  +SHL+G P + 
Sbjct: 186 VPWRTAGLKYSNNELYVDVVETIHVILRKTEKSGQLVPVRGLIDGYVDFRSHLTGNPVVA 245

Query: 219 LGLNDKGIFSNHVSGGVEDEADDLSATGKKKANIELEDLKFHQCVRLSKFENEKIITFIP 278
           L LN  G               DL                 H C +     + + + F+P
Sbjct: 246 LKLNLHG--------------HDLGVPA------------LHPCCQAQYTGSPENLQFVP 279

Query: 279 PDGDFELMSYRL 290
           PDG F LM Y +
Sbjct: 280 PDGKFRLMQYTI 291

>KAFR0D03560 Chr4 complement(695693..697060) [1368 bp, 455 aa] {ON}
           Anc_2.522 YBR288C
          Length = 455

 Score = 57.0 bits (136), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 89/382 (23%), Positives = 155/382 (40%), Gaps = 74/382 (19%)

Query: 104 IRDNFVIIYELLDEMMDYGI---PQITETKMLKQYITQKSF-KLMKSAKKSKNVIRPPIA 159
           I +N+  +  L D ++D GI         K+  Q   +  F   +  A KS    + P  
Sbjct: 107 IMNNYDRMTILFDLLIDGGIIDGNNFYMNKLRNQIPLKNDFSNFINDAAKSLQKGQAPSK 166

Query: 160 LTNS--VSWRPEGIMYKKNEAFLDVVESINMLITQQGQ------VLRSEILGKVKVKSHL 211
             ++  V WR + I   +NE ++DV E++ + + +  +      +L   I G V V S +
Sbjct: 167 TVDNEVVPWRSKEIKTVRNEIYVDVKETLYVTLIKSNRASHRLKLLNGYINGSVSVDSSI 226

Query: 212 SGMPDLKLGLNDKGIFSNHVSGGVEDEADDLSATGKKKANIELEDL--KFHQCVRLSKF- 268
            G+P L++             GG +                  +D+  KFH CV +++F 
Sbjct: 227 GGVPMLEVSF-----------GGCD-----------------FKDIIPKFHDCVEVNEFL 258

Query: 269 -ENEKIITFIPPDGDFELMSYR--LTTPIKPLIWCDIKIQV-HSKSRIEVHCRAKAQIKK 324
             +  II FIPPDG F+LM Y   L++    LI C+    + +S    E+         K
Sbjct: 259 TNDGNIIKFIPPDGKFQLMEYSMALSSFNDNLISCNFTNGLGNSNDEFEITLNINKS-NK 317

Query: 325 KSTANNVEILIPVPEDADSPK---FRYSHGSIKWAPEKNAILWKIKSFPG---------- 371
               NN+++ +         K    R +HG  ++   KN  ++  +   G          
Sbjct: 318 VPKINNLQVCLNFENREGQSKVKILRNTHGRFEYG--KNTWIFDSELLTGTLPVLRGCVE 375

Query: 372 ----GKEYSMAAQLGLPSVSDFEEPVMKRPV---QVKFQIPYFT-TSGIQVRYLKINEPK 423
                +E       G   +S    P ++  +   Q + Q+P  T  S I +R    + P+
Sbjct: 376 EETKNEEDGGIDGEGRRILSKL-RPELRSVIMSFQYEGQLPSGTRVSSINIRNDSTSNPQ 434

Query: 424 MQYQSYPWVRYITQSGDDYTIR 445
            Q Q +  V+Y+T++  +Y IR
Sbjct: 435 RQ-QLFKGVKYVTKTS-NYEIR 454

>ZYRO0B01738g Chr2 complement(139975..141453) [1479 bp, 492 aa] {ON}
           similar to uniprot|P38153 Saccharomyces cerevisiae
           YBR288C APM3 Mu3-like subunit of the yeast AP-3 complex
           which functions in transport of alkaline phosphatase to
           the vacuole via the alternate pathway clathrin
           associated protein medium chain
          Length = 492

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 34/138 (24%), Positives = 64/138 (46%), Gaps = 32/138 (23%)

Query: 164 VSWRPEGIMYKKNEAFLDVVESINMLITQQG-----QVLRSEILGKVKVKSHLSGMPDLK 218
           V WR   + Y  +E ++D++E+++++          Q++   I G+V VKS+LSG P ++
Sbjct: 192 VPWRSGHLKYTSDEIYVDIIETVHVIYQTHHRNNSVQMVSGTINGQVNVKSYLSGNPTVE 251

Query: 219 LGLNDKGIFSNHVSGGVEDEADDLSATGKKKANIELEDLKFHQCVRLSKFENEKIITFIP 278
           + +                   DL+         E+     HQCV + +  +   + FIP
Sbjct: 252 MDM-------------------DLAGN-------EMYAPSMHQCVEMPQ-GSPSSLCFIP 284

Query: 279 PDGDFELMSYRLTTPIKP 296
           PDG+  L++Y +   + P
Sbjct: 285 PDGNCNLLNYTIDLDMNP 302

>Kpol_1018.42 s1018 (137162..138889) [1728 bp, 575 aa] {ON}
           (137162..138889) [1728 nt, 576 aa]
          Length = 575

 Score = 50.1 bits (118), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 39/146 (26%), Positives = 65/146 (44%), Gaps = 46/146 (31%)

Query: 166 WRPEGIMYKKNEAFLDVVESINML----ITQQGQVLRSE----------ILGKVKVKSHL 211
           WR + + +  NE ++D+VES++++    I +  ++ RS+          + G   V+S L
Sbjct: 203 WRSQNVKHNNNEIYIDLVESVHVVYQTKIRRSNELTRSKQSIKKIVNGYLKGTAYVQSFL 262

Query: 212 SGMPDLKLGLNDKGIFSNHVSGGVEDEADDLSATGKKKANIELEDLKFHQCVRLSKF--- 268
           +G P ++L L   G    H S                          FH+CV + ++   
Sbjct: 263 NGNPLVELQLELSGNDIGHPS--------------------------FHECVDIDEYLKN 296

Query: 269 -ENEKI--ITFIPPDGDFELMSYRLT 291
            +N  I  + FIPPDG F LM Y +T
Sbjct: 297 IDNSSISSLKFIPPDGKFTLMDYTIT 322

>NCAS0A04870 Chr1 (973552..975021) [1470 bp, 489 aa] {ON} Anc_2.522
           YBR288C
          Length = 489

 Score = 43.5 bits (101), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 64/323 (19%), Positives = 113/323 (34%), Gaps = 79/323 (24%)

Query: 164 VSWRPEGIMYKKNEAFLDVVESINMLITQQG---------------QVLRSEILGKVKVK 208
           V WR  GI   K E ++D+ E + +   +                 +++   I G + V+
Sbjct: 189 VPWRRNGIKDAKEELYVDLKEEVYVTYRKSDRHHGRDGIRTSNPSMELVSGHIKGTIDVR 248

Query: 209 SHLSGMPDLKLGLNDKGIFSNHVSGGVEDEADDLSATGKKKANIELEDLKFHQCVRLS-- 266
            +L+G P + L  +  G              +DL                FH CV     
Sbjct: 249 CYLNGNPTVSLMFDTMG--------------NDLGIP------------SFHACVEQEDQ 282

Query: 267 -----------KFENEKIITFIPPDGDFELMSYRL----TTPIKPLIWCDIKIQVH---- 307
                       F+ ++++ F+PPDG F L  Y +       +   +  D  IQV     
Sbjct: 283 VQEQKQEQEPESFQGKRLLRFLPPDGKFRLAQYVIDLDGQGGMSRRMDRDGLIQVSFEDG 342

Query: 308 ---SKSRIEVHCRAKAQIKKKSTANNVEILIPVPEDADS--PKFRYSHGSIKWAPEKNAI 362
              +K   EV    +  I       ++ + +      DS     R +HG+     E    
Sbjct: 343 LGLNKDEFEVRLHVRESIAVVDPVEDLVVTLQFSNGNDSNVKMLRATHGTFVGQDEDRQC 402

Query: 363 LWKIKSFPGGKEYSMAAQLGLPSVSDFEEPVMKR------PVQVKFQIPYFTTSGIQVRY 416
            W+  S     E S      L    D  + V ++       V V++  P    SG +V  
Sbjct: 403 SWRFDS----DEISAGTLPVLRGCIDDSKHVQQKKRSCLTSVAVRYGYPGELASGCRVTR 458

Query: 417 LKIN--EPKMQYQSYPWVRYITQ 437
           L ++   P+++ + +  VR +T+
Sbjct: 459 LDVDVASPRVRGKVFKGVRCVTR 481

>Suva_4.548 Chr4 complement(950244..951698) [1455 bp, 484 aa] {ON}
           YBR288C (REAL)
          Length = 484

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 35/134 (26%), Positives = 61/134 (45%), Gaps = 34/134 (25%)

Query: 164 VSWRPEGIM-YKKNEAFLDVVESINMLITQQGQVLR---SEILGKVKVKSHLSGMPDLKL 219
           V WR      ++ NE ++D++E+ ++++ ++   LR    +I G V V+S+L+  P + +
Sbjct: 199 VPWRTSKTSKHENNELYVDLLETFHVVLEKKKTRLRLVNGDICGAVDVRSYLNDNPLVSV 258

Query: 220 GLNDKGIFSNHVSGGVEDEADDLSATGKKKANIELEDLKFHQCVRLS---KFENEKIITF 276
            LN  G                           E+     H+CV ++   +F    I TF
Sbjct: 259 KLNTMGN--------------------------EIGIPSLHECVEINDDGEFTPSNI-TF 291

Query: 277 IPPDGDFELMSYRL 290
           IPPDG F L+ Y +
Sbjct: 292 IPPDGKFRLLEYSI 305

>Skud_2.419 Chr2 complement(746943..748397) [1455 bp, 484 aa] {ON}
           YBR288C (REAL)
          Length = 484

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 36/134 (26%), Positives = 61/134 (45%), Gaps = 34/134 (25%)

Query: 164 VSWR-PEGIMYKKNEAFLDVVESINMLITQQGQVLR---SEILGKVKVKSHLSGMPDLKL 219
           V WR  +   ++ NE ++D++E+ +++   +   LR     I G V V+S+L+  P + +
Sbjct: 199 VPWRTSKASKHENNELYVDLLETFHVVFETKKSRLRLVNGNIHGTVDVRSYLNNNPLVSV 258

Query: 220 GLNDKGIFSNHVSGGVEDEADDLSATGKKKANIELEDLKFHQCVRLSKFENEKI---ITF 276
            LN  G              +D+                 H+CV + K + E +   ITF
Sbjct: 259 KLNTMG--------------NDIGVP------------TLHECVEI-KDDGEFLPSNITF 291

Query: 277 IPPDGDFELMSYRL 290
           IPPDG F L+ Y +
Sbjct: 292 IPPDGKFRLLEYSV 305

>Ecym_7266 Chr7 (559988..560022,560112..561630) [1554 bp, 517 aa]
           {ON} similar to Ashbya gossypii AGL061W
          Length = 517

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 42/177 (23%), Positives = 69/177 (38%), Gaps = 39/177 (22%)

Query: 127 TETKMLKQYITQKSFKLMKSAKKSKNVIRPPIALTNS--------VSWRPEGIMYKKNEA 178
           + TK L + I  +       +  S N+   P    +S        V WR   +    NE 
Sbjct: 150 SATKTLTRTIKNRESSNFLGSSNSSNINGGPTINRSSDSPLDAQVVPWRIPNLSNVNNEI 209

Query: 179 FLDVVESINMLITQQG----QVLRSEILGKVKVKSHLSGMPDLKLGLNDKGIFSNHVSGG 234
           ++D+VE++ + + Q       V    I GK+ +K +L G P +++ L+  G         
Sbjct: 210 YVDMVETLTLNLKQSRPNSFHVFHGVISGKIDLKCYLRGNPTMQINLHSAG--------- 260

Query: 235 VEDEADDLSATGKKKANIELEDLKFHQCVR-LSKFENEKIITFIPPDGDFELMSYRL 290
               A   SA               H+C+   S   +   + FIPPDG F L+ Y +
Sbjct: 261 ---HAFKPSA--------------LHRCLDPSSSSFDSSSLRFIPPDGKFTLLEYTI 300

>CAGL0L02145g Chr12 (252110..253741) [1632 bp, 543 aa] {ON} similar
           to uniprot|P38153 Saccharomyces cerevisiae YBR288c APM3
           AP-3 complex subunit mu3 subunit
          Length = 543

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 39/149 (26%), Positives = 61/149 (40%), Gaps = 49/149 (32%)

Query: 166 WR-PEGIMYKKNEAFLDVVESINMLITQQ-----------------GQV--LRSEILGKV 205
           WR  + I   +NE + DV E I ++  ++                 G +  +R  I G V
Sbjct: 227 WRNGKNIHNDRNELYADVREVIQVVYQKKYSSKKNDSRRKIFGRRSGHLEYVRGNISGSV 286

Query: 206 KVKSHLSGMPDLKLGLNDKGIFSNHVSGGVEDEADDLSATGKKKANIELEDLKFHQCV-R 264
            ++  L+G P +++ L   G+              D+   G            FH CV +
Sbjct: 287 DMRCFLTGNPLVEIALKQGGL--------------DIGIPG------------FHDCVDK 320

Query: 265 LSKFENEKI--ITFIPPDGDFELMSYRLT 291
            S  + EKI  ++FIPPDG F LM Y + 
Sbjct: 321 TSLLKQEKISKLSFIPPDGRFTLMQYNIN 349

>YBR288C Chr2 complement(778012..779463) [1452 bp, 483 aa] {ON}
           APM3Mu3-like subunit of the clathrin associated protein
           complex (AP-3); functions in transport of alkaline
           phosphatase to the vacuole via the alternate pathway
          Length = 483

 Score = 40.0 bits (92), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 35/136 (25%), Positives = 59/136 (43%), Gaps = 39/136 (28%)

Query: 164 VSWR-PEGIMYKKNEAFLDVVESINMLITQQGQVLR---SEILGKVKVKSHLSGMPDLKL 219
           V WR      ++ NE ++D++E+ +++  ++   LR     I G V V+S+L+  P + +
Sbjct: 199 VPWRTSRASKHENNELYVDLLETFHVVFEKKKSHLRLLTGSIHGIVDVRSYLNDNPLVAV 258

Query: 220 GLNDKGIFSNHVSGGVEDEADDLSATGKKKANIELEDLKFHQCVRLSKFENEKI-----I 274
            LN  G              +D+                 H CV +    N+ +     I
Sbjct: 259 KLNTMG--------------NDIGIP------------SLHDCVEI----NDGVFSPSNI 288

Query: 275 TFIPPDGDFELMSYRL 290
           TFIPPDG F L+ Y +
Sbjct: 289 TFIPPDGKFRLLEYSV 304

>Smik_2.430 Chr2 complement(763687..765141) [1455 bp, 484 aa] {ON}
           YBR288C (REAL)
          Length = 484

 Score = 39.7 bits (91), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 33/131 (25%), Positives = 58/131 (44%), Gaps = 32/131 (24%)

Query: 164 VSWR-PEGIMYKKNEAFLDVVESINMLITQQGQVLR---SEILGKVKVKSHLSGMPDLKL 219
           V WR      ++ NE +LD++E+ +++  ++   +R     I G + V+S+L+  P + +
Sbjct: 199 VPWRTSRASKHENNELYLDLLETFHVVFEKKKSHIRLVNGNIHGTLDVRSYLNDTPLVLV 258

Query: 220 GLNDKGIFSNHVSGGVEDEADDLSATGKKKANIELEDLKFHQCVRLSK--FENEKIITFI 277
            LN  G              +D+                 H+CV ++     +   ITFI
Sbjct: 259 KLNTMG--------------NDIGIP------------SLHECVEINDGGVFSPSNITFI 292

Query: 278 PPDGDFELMSY 288
           PPDG F L+ Y
Sbjct: 293 PPDGKFRLLEY 303

>NDAI0K01930 Chr11 (437535..439373) [1839 bp, 612 aa] {ON} Anc_2.522
           YBR288C
          Length = 612

 Score = 35.0 bits (79), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 37/155 (23%), Positives = 60/155 (38%), Gaps = 56/155 (36%)

Query: 164 VSWRPEGIMYKKNEAFLDVVESI-----NMLITQQGQ-------------------VLRS 199
           V WR   I   KNE ++D+ E I     N +  ++G+                   ++  
Sbjct: 259 VPWRNGNIKNAKNELYIDMKEDIHVNFRNQIKNRKGRTYDNNNSNGIRVNNPSCMKLMNG 318

Query: 200 EILGKVKVKSHLSGMPDLKLGLNDKGIFSNHVSGGVEDEADDLSATGKKKANIELEDLKF 259
            I G + V+S+L+G P +++ LN  G              +D+                 
Sbjct: 319 YITGVIDVRSYLNGNPIVEMKLNTCG--------------NDMGTP------------SL 352

Query: 260 HQCVRLS---KFENEKI---ITFIPPDGDFELMSY 288
           H CV L      +++K+   + FIPPDG F L  Y
Sbjct: 353 HPCVELEGDMNGDDDKVMDSLKFIPPDGKFCLARY 387

>KNAG0A06970 Chr1 complement(1086674..1088191) [1518 bp, 505 aa]
           {ON} Anc_2.522 YBR288C
          Length = 505

 Score = 34.3 bits (77), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 25/101 (24%), Positives = 37/101 (36%), Gaps = 30/101 (29%)

Query: 195 QVLRSEILGKVKVKSHLSGMPDLKLGLNDKGIFSNHVSGGVEDEADDLSATGKKKANIEL 254
           Q++   I G V  + +LS  P +++  N+ G                           +L
Sbjct: 249 QLVTGCITGVVDCRCYLSRDPIVEVTFNNHGC--------------------------DL 282

Query: 255 EDLKFHQCVRLSKF----ENEKIITFIPPDGDFELMSYRLT 291
                H CV L        +   + FIPPDG F LM Y +T
Sbjct: 283 GTPALHDCVELDGVPEGPADHTTLKFIPPDGKFRLMEYSVT 323

>CAGL0B02475g Chr2 (236029..237771) [1743 bp, 580 aa] {ON} highly
           similar to uniprot|P25297 Saccharomyces cerevisiae
           YML123c PHO84
          Length = 580

 Score = 31.2 bits (69), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 35/77 (45%), Gaps = 7/77 (9%)

Query: 286 MSYRLTTPIKPLIWCDIKIQVHSKSRIEVHCRAKA------QIKKKSTANNVEILIPVPE 339
           + +RLT P  P    D+K +V   S IE   RA A       +++ ST     I++P P+
Sbjct: 265 LYFRLTIPESPRYALDVKEEVDLPSNIE-KVRATADDEHLEDLERSSTVVEDGIVVPPPK 323

Query: 340 DADSPKFRYSHGSIKWA 356
            A    FR   G  K+ 
Sbjct: 324 KASWKDFRSHFGKWKYG 340

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.135    0.397 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 45,700,254
Number of extensions: 1942090
Number of successful extensions: 5377
Number of sequences better than 10.0: 92
Number of HSP's gapped: 5289
Number of HSP's successfully gapped: 133
Length of query: 447
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 334
Effective length of database: 40,524,141
Effective search space: 13535063094
Effective search space used: 13535063094
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 67 (30.4 bits)