Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0F02970g3.483ON57357329740.0
KLLA0B10868g3.483ON57457126630.0
Kwal_55.211873.483ON57357126500.0
KLTH0F14630g3.483ON57357126430.0
Kpol_480.193.483ON57457126290.0
TDEL0D055203.483ON57357326110.0
CAGL0I10648g3.483ON57457226110.0
Suva_16.4743.483ON57257125880.0
YPR145W (ASN1)3.483ON57257225790.0
KNAG0A079203.483ON57857725720.0
NDAI0B058103.483ON57757625660.0
Smik_16.3963.483ON57257125650.0
Skud_16.4393.483ON57257225610.0
NCAS0F035103.483ON57557525460.0
Smik_6.2203.483ON57257125330.0
YGR124W (ASN2)3.483ON57257125330.0
KAFR0G036703.483ON57257225320.0
AFR303W3.483ON57157325240.0
TPHA0D042003.483ON57457125240.0
Suva_7.4103.483ON57257225230.0
ZYRO0B04136g3.483ON57257325210.0
Skud_7.4353.483ON57257225190.0
Ecym_12443.483ON57357224970.0
TBLA0C044303.483ON58057824510.0
KNAG0J002008.875ON5155031601e-10
ZYRO0A00528g8.875ON5121031384e-08
Kpol_455.78.875ON5181051279e-07
TPHA0C049508.875ON525991206e-06
Skud_13.468.875ON5191011207e-06
ADL350C8.875ON508941162e-05
NDAI0K001808.875ON522941153e-05
KAFR0L021108.875ON514951153e-05
YML096W8.875ON525951144e-05
TDEL0B004408.875ON516941134e-05
TBLA0C063008.875ON5181661135e-05
KLLA0D10285g8.875ON5151131126e-05
NCAS0C001908.875ON5171051127e-05
Smik_13.398.875ON521961127e-05
Suva_13.528.875ON519861091e-04
Ecym_81558.875ON5131121000.001
SAKL0D00352g8.875ON515671000.001
Kwal_27.97058.875ON51569980.003
CAGL0H06963g8.875ON51771880.047
KLTH0E16412g8.875ON51563870.051
Skud_7.311singletonON8188760.14
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0F02970g
         (573 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0F02970g Chr6 complement(252336..254057) [1722 bp, 573 aa] {...  1150   0.0  
KLLA0B10868g Chr2 complement(951111..952835) [1725 bp, 574 aa] {...  1030   0.0  
Kwal_55.21187 s55 (723404..725125) [1722 bp, 573 aa] {ON} YPR145...  1025   0.0  
KLTH0F14630g Chr6 (1198036..1199757) [1722 bp, 573 aa] {ON} high...  1022   0.0  
Kpol_480.19 s480 complement(42251..43975) [1725 bp, 574 aa] {ON}...  1017   0.0  
TDEL0D05520 Chr4 (996468..998189) [1722 bp, 573 aa] {ON} Anc_3.4...  1010   0.0  
CAGL0I10648g Chr9 complement(1053030..1054754) [1725 bp, 574 aa]...  1010   0.0  
Suva_16.474 Chr16 (819031..820749) [1719 bp, 572 aa] {ON} YGR124...  1001   0.0  
YPR145W Chr16 (822620..824338) [1719 bp, 572 aa] {ON}  ASN1Aspar...   998   0.0  
KNAG0A07920 Chr1 (1262894..1264630) [1737 bp, 578 aa] {ON} Anc_3...   995   0.0  
NDAI0B05810 Chr2 (1412089..1413822) [1734 bp, 577 aa] {ON} Anc_3...   993   0.0  
Smik_16.396 Chr16 (694650..696368) [1719 bp, 572 aa] {ON} YPR145...   992   0.0  
Skud_16.439 Chr16 (776317..778035) [1719 bp, 572 aa] {ON} YPR145...   991   0.0  
NCAS0F03510 Chr6 (703369..705096) [1728 bp, 575 aa] {ON} Anc_3.4...   985   0.0  
Smik_6.220 Chr6 (357844..359562) [1719 bp, 572 aa] {ON} YGR124W ...   980   0.0  
YGR124W Chr7 (739944..741662) [1719 bp, 572 aa] {ON}  ASN2Aspara...   980   0.0  
KAFR0G03670 Chr7 (758115..759833) [1719 bp, 572 aa] {ON} Anc_3.4...   979   0.0  
AFR303W Chr6 (989036..990751) [1716 bp, 571 aa] {ON} Syntenic ho...   976   0.0  
TPHA0D04200 Chr4 (904705..906429) [1725 bp, 574 aa] {ON} Anc_3.4...   976   0.0  
Suva_7.410 Chr7 (709927..711645) [1719 bp, 572 aa] {ON} YPR145W ...   976   0.0  
ZYRO0B04136g Chr2 complement(345085..346803) [1719 bp, 572 aa] {...   975   0.0  
Skud_7.435 Chr7 (719202..720920) [1719 bp, 572 aa] {ON} YGR124W ...   974   0.0  
Ecym_1244 Chr1 complement(501719..503440) [1722 bp, 573 aa] {ON}...   966   0.0  
TBLA0C04430 Chr3 (1072027..1073769) [1743 bp, 580 aa] {ON} Anc_3...   948   0.0  
KNAG0J00200 Chr10 complement(24044..25591) [1548 bp, 515 aa] {ON...    66   1e-10
ZYRO0A00528g Chr1 (35425..36963) [1539 bp, 512 aa] {ON} similar ...    58   4e-08
Kpol_455.7 s455 complement(6566..8122) [1557 bp, 518 aa] {ON} co...    54   9e-07
TPHA0C04950 Chr3 complement(1067043..1068620) [1578 bp, 525 aa] ...    51   6e-06
Skud_13.46 Chr13 (79277..80836) [1560 bp, 519 aa] {ON} YML096W (...    51   7e-06
ADL350C Chr4 complement(90152..91678) [1527 bp, 508 aa] {ON} Syn...    49   2e-05
NDAI0K00180 Chr11 (27899..29467) [1569 bp, 522 aa] {ON} Anc_8.87...    49   3e-05
KAFR0L02110 Chr12 complement(400443..401987) [1545 bp, 514 aa] {...    49   3e-05
YML096W Chr13 (79909..81486) [1578 bp, 525 aa] {ON} Putative pro...    49   4e-05
TDEL0B00440 Chr2 complement(78116..79666) [1551 bp, 516 aa] {ON}...    48   4e-05
TBLA0C06300 Chr3 (1523556..1525112) [1557 bp, 518 aa] {ON} Anc_8...    48   5e-05
KLLA0D10285g Chr4 (869754..871301) [1548 bp, 515 aa] {ON} simila...    48   6e-05
NCAS0C00190 Chr3 complement(17177..18730) [1554 bp, 517 aa] {ON}...    48   7e-05
Smik_13.39 Chr13 (77004..78569) [1566 bp, 521 aa] {ON} YML096W (...    48   7e-05
Suva_13.52 Chr13 (81009..82568) [1560 bp, 519 aa] {ON} YML096W (...    47   1e-04
Ecym_8155 Chr8 complement(324050..325591) [1542 bp, 513 aa] {ON}...    43   0.001
SAKL0D00352g Chr4 (31387..32934) [1548 bp, 515 aa] {ON} similar ...    43   0.001
Kwal_27.9705 s27 (28837..30384) [1548 bp, 515 aa] {ON} YML096W -...    42   0.003
CAGL0H06963g Chr8 (689948..691501) [1554 bp, 517 aa] {ON} simila...    39   0.047
KLTH0E16412g Chr5 complement(1455298..1456845) [1548 bp, 515 aa]...    38   0.051
Skud_7.311 Chr7 complement(535445..535513,535517..535621,535625....    34   0.14 

>SAKL0F02970g Chr6 complement(252336..254057) [1722 bp, 573 aa] {ON}
           highly similar to uniprot|P49089 Saccharomyces
           cerevisiae YPR145W ASN1 Asparagine synthetase isozyme of
           Asn2p catalyzes the synthesis of L-asparagine from L-
           aspartate in the asparagine biosynthetic pathway
          Length = 573

 Score = 1150 bits (2974), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 555/573 (96%), Positives = 555/573 (96%)

Query: 1   MCGIFACYKHESVQEFKPKALQLSKRIRHRGPDWSGNVVKNTTILAHERLAIVGLDSGAQ 60
           MCGIFACYKHESVQEFKPKALQLSKRIRHRGPDWSGNVVKNTTILAHERLAIVGLDSGAQ
Sbjct: 1   MCGIFACYKHESVQEFKPKALQLSKRIRHRGPDWSGNVVKNTTILAHERLAIVGLDSGAQ 60

Query: 61  PITSEDGDYTLCVNGEIYNHIKLREELTSYPFKTLSDCEPIIPLYQKYDIDTPKYLDGMF 120
           PITSEDGDYTLCVNGEIYNHIKLREELTSYPFKTLSDCEPIIPLYQKYDIDTPKYLDGMF
Sbjct: 61  PITSEDGDYTLCVNGEIYNHIKLREELTSYPFKTLSDCEPIIPLYQKYDIDTPKYLDGMF 120

Query: 121 AWCLYDAKKDRIIAARDPIGITTLYMGRXXXXXXTVFFASELKCLVDDCDEITAFPPGHV 180
           AWCLYDAKKDRIIAARDPIGITTLYMGR      TVFFASELKCLVDDCDEITAFPPGHV
Sbjct: 121 AWCLYDAKKDRIIAARDPIGITTLYMGRSSSSPSTVFFASELKCLVDDCDEITAFPPGHV 180

Query: 181 YDSATDKITRYYTPDWLDEERIPKTPLDYKLIRNSLESAVRKRLMAEVPYXXXXXXXXXX 240
           YDSATDKITRYYTPDWLDEERIPKTPLDYKLIRNSLESAVRKRLMAEVPY          
Sbjct: 181 YDSATDKITRYYTPDWLDEERIPKTPLDYKLIRNSLESAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIAAIAARETEKANKDLDPVAYDDEDKHLAGVDDKGNLHAAGWSRLHSFAIGLPNAPDL 300
             IAAIAARETEKANKDLDPVAYDDEDKHLAGVDDKGNLHAAGWSRLHSFAIGLPNAPDL
Sbjct: 241 SLIAAIAARETEKANKDLDPVAYDDEDKHLAGVDDKGNLHAAGWSRLHSFAIGLPNAPDL 300

Query: 301 QAARKVAKFISSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
           QAARKVAKFISSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 QAARKVAKFISSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDRDFLDVCMNIDPAEKMINQSEGRIEKYILRKAFDTTDEPDVKPYLPEEILWRQKE 480
           VPFLDRDFLDVCMNIDPAEKMINQSEGRIEKYILRKAFDTTDEPDVKPYLPEEILWRQKE
Sbjct: 421 VPFLDRDFLDVCMNIDPAEKMINQSEGRIEKYILRKAFDTTDEPDVKPYLPEEILWRQKE 480

Query: 481 QFSDGVGYSWIDGLKDAAEAAISDEQFAQPKPEWGDDIPTTKEAYWYRLKFDALFPQKTA 540
           QFSDGVGYSWIDGLKDAAEAAISDEQFAQPKPEWGDDIPTTKEAYWYRLKFDALFPQKTA
Sbjct: 481 QFSDGVGYSWIDGLKDAAEAAISDEQFAQPKPEWGDDIPTTKEAYWYRLKFDALFPQKTA 540

Query: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHEQHIQN 573
           ASTVMRWIPKADWGCAEDPSGRYAKIHEQHIQN
Sbjct: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHEQHIQN 573

>KLLA0B10868g Chr2 complement(951111..952835) [1725 bp, 574 aa] {ON}
           highly similar to uniprot|P49089 Saccharomyces
           cerevisiae YPR145W ASN1 Asparagine synthetase isozyme of
           Asn2p catalyzes the synthesis of L-asparagine from L-
           aspartate in the asparagine biosynthetic pathway
          Length = 574

 Score = 1030 bits (2663), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 488/571 (85%), Positives = 519/571 (90%)

Query: 1   MCGIFACYKHESVQEFKPKALQLSKRIRHRGPDWSGNVVKNTTILAHERLAIVGLDSGAQ 60
           MCGIFA +++  VQ +KPKALQLSKRIRHRGPDWSGN+VKN+TIL HERLAIVGLDSGAQ
Sbjct: 1   MCGIFASFRNPDVQAYKPKALQLSKRIRHRGPDWSGNIVKNSTILVHERLAIVGLDSGAQ 60

Query: 61  PITSEDGDYTLCVNGEIYNHIKLREELTSYPFKTLSDCEPIIPLYQKYDIDTPKYLDGMF 120
           PITSEDG YTL VNGEIYNHI LREE  SYPFKTLSDCEPIIPLY+KYDID PK+LDGMF
Sbjct: 61  PITSEDGSYTLAVNGEIYNHIMLREECASYPFKTLSDCEPIIPLYEKYDIDAPKHLDGMF 120

Query: 121 AWCLYDAKKDRIIAARDPIGITTLYMGRXXXXXXTVFFASELKCLVDDCDEITAFPPGHV 180
           AWCLYD+KKDRIIAARDPIGITTLYMGR      +V+F+SELKCL DDCDEI AFPPGHV
Sbjct: 121 AWCLYDSKKDRIIAARDPIGITTLYMGRSSASPKSVWFSSELKCLTDDCDEIIAFPPGHV 180

Query: 181 YDSATDKITRYYTPDWLDEERIPKTPLDYKLIRNSLESAVRKRLMAEVPYXXXXXXXXXX 240
           YDS TDK+TRY+TPDWLDE RIP TP+D+K +R SLE AVRKRLMAEVPY          
Sbjct: 181 YDSETDKLTRYFTPDWLDESRIPTTPVDFKAVRESLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIAAIAARETEKANKDLDPVAYDDEDKHLAGVDDKGNLHAAGWSRLHSFAIGLPNAPDL 300
             IAAIAARETEK N +LDPV YD +   LAG+D++G+LHAAGWSRLHSFA+GLPNAPDL
Sbjct: 241 SLIAAIAARETEKTNAELDPVVYDSDPHQLAGLDEQGHLHAAGWSRLHSFAVGLPNAPDL 300

Query: 301 QAARKVAKFISSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
           QAARKVA FI SIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 QAARKVATFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDRDFLDVCMNIDPAEKMINQSEGRIEKYILRKAFDTTDEPDVKPYLPEEILWRQKE 480
           VPFLDRDFL +CMNIDP +KMI  +EG+IEKYILRKAFDTTDEPD+KPYLPEEILWRQKE
Sbjct: 421 VPFLDRDFLQLCMNIDPNDKMIKPAEGKIEKYILRKAFDTTDEPDLKPYLPEEILWRQKE 480

Query: 481 QFSDGVGYSWIDGLKDAAEAAISDEQFAQPKPEWGDDIPTTKEAYWYRLKFDALFPQKTA 540
           QFSDGVGYSWIDGLKDAAE+ ISDEQFAQPK EWGDDIPTTKEAYWYRLKFDALFPQKTA
Sbjct: 481 QFSDGVGYSWIDGLKDAAESTISDEQFAQPKAEWGDDIPTTKEAYWYRLKFDALFPQKTA 540

Query: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHEQHI 571
           ASTVMRWIPKADWGCAEDPSGRYAKIHEQH+
Sbjct: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHEQHV 571

>Kwal_55.21187 s55 (723404..725125) [1722 bp, 573 aa] {ON} YPR145W
           (ASN1) - asparagine synthetase [contig 295] FULL
          Length = 573

 Score = 1025 bits (2650), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 482/571 (84%), Positives = 514/571 (90%)

Query: 1   MCGIFACYKHESVQEFKPKALQLSKRIRHRGPDWSGNVVKNTTILAHERLAIVGLDSGAQ 60
           MCGIF C++HE V +FKP ALQL+KRIRHRGPDWSGNV++N+T+LAHERLAIVGLD+GAQ
Sbjct: 1   MCGIFTCFRHEDVDKFKPDALQLAKRIRHRGPDWSGNVIRNSTLLAHERLAIVGLDTGAQ 60

Query: 61  PITSEDGDYTLCVNGEIYNHIKLREELTSYPFKTLSDCEPIIPLYQKYDIDTPKYLDGMF 120
           P+ SE+ DY L VNGEIYNHI+LREE + YPFKTLSDCEPIIPLY+KY ID PKYLDGMF
Sbjct: 61  PMVSEEKDYILAVNGEIYNHIQLREEFSDYPFKTLSDCEPIIPLYEKYGIDAPKYLDGMF 120

Query: 121 AWCLYDAKKDRIIAARDPIGITTLYMGRXXXXXXTVFFASELKCLVDDCDEITAFPPGHV 180
           AW LYD KKDR+IAARDPIGITTLYMGR      TV+FASELKCL D+CD I AFPPGHV
Sbjct: 121 AWALYDTKKDRMIAARDPIGITTLYMGRDSKSPKTVYFASELKCLTDNCDSIIAFPPGHV 180

Query: 181 YDSATDKITRYYTPDWLDEERIPKTPLDYKLIRNSLESAVRKRLMAEVPYXXXXXXXXXX 240
           YDS TD+ITRYYTP+WLDE RIP  PLD   IRNSLE AVRKRLMAEVPY          
Sbjct: 181 YDSETDQITRYYTPNWLDENRIPSEPLDLLKIRNSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIAAIAARETEKANKDLDPVAYDDEDKHLAGVDDKGNLHAAGWSRLHSFAIGLPNAPDL 300
             IAAIAARETEKAN +++PV YD EDKHLAGVDD G LH+AGWSRLHSFA+GLPNAPDL
Sbjct: 241 SLIAAIAARETEKANTEMNPVEYDSEDKHLAGVDDSGKLHSAGWSRLHSFAVGLPNAPDL 300

Query: 301 QAARKVAKFISSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
           +AARKVAKFI S+HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 EAARKVAKFIGSVHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFH ESVKRVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDRDFLDVCMNIDPAEKMINQSEGRIEKYILRKAFDTTDEPDVKPYLPEEILWRQKE 480
           VPFLDR+FLD+CMN+DP EKMINQ+EGRIEKYILRKAFDT+DEP  KPYLPEEILWRQKE
Sbjct: 421 VPFLDREFLDLCMNLDPKEKMINQAEGRIEKYILRKAFDTSDEPGAKPYLPEEILWRQKE 480

Query: 481 QFSDGVGYSWIDGLKDAAEAAISDEQFAQPKPEWGDDIPTTKEAYWYRLKFDALFPQKTA 540
           QFSDGVGYSWIDGLKD AEA ISDEQF QPK EWGDDIPTTKEAYWYRLKFDALFPQKTA
Sbjct: 481 QFSDGVGYSWIDGLKDTAEATISDEQFKQPKAEWGDDIPTTKEAYWYRLKFDALFPQKTA 540

Query: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHEQHI 571
           ASTVMRWIPKADWGCAEDPSGRYAKIH+QHI
Sbjct: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHDQHI 571

>KLTH0F14630g Chr6 (1198036..1199757) [1722 bp, 573 aa] {ON} highly
           similar to uniprot|P49089 Saccharomyces cerevisiae
           YPR145W ASN1 Asparagine synthetase isozyme of Asn2p
           catalyzes the synthesis of L-asparagine from L-
           aspartate in the asparagine biosynthetic pathway
          Length = 573

 Score = 1022 bits (2643), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 482/571 (84%), Positives = 513/571 (89%)

Query: 1   MCGIFACYKHESVQEFKPKALQLSKRIRHRGPDWSGNVVKNTTILAHERLAIVGLDSGAQ 60
           MCGIF C++H+SV+EFKP AL+L KRIRHRGPDWSGN++KN+T++AHERLAIVGLDSGAQ
Sbjct: 1   MCGIFTCFRHQSVEEFKPDALRLVKRIRHRGPDWSGNIIKNSTLMAHERLAIVGLDSGAQ 60

Query: 61  PITSEDGDYTLCVNGEIYNHIKLREELTSYPFKTLSDCEPIIPLYQKYDIDTPKYLDGMF 120
           P  SED +Y L VNGE+YNHI+LREE +SYPFKTLSDCEPIIPLY+KY ID PKYLDGMF
Sbjct: 61  PFVSEDNNYILGVNGEVYNHIQLREEFSSYPFKTLSDCEPIIPLYEKYGIDAPKYLDGMF 120

Query: 121 AWCLYDAKKDRIIAARDPIGITTLYMGRXXXXXXTVFFASELKCLVDDCDEITAFPPGHV 180
           AW LYDAKKDRI+AARDPIGITTLYMGR      TV+FASELKCL D+CD I AFPPGHV
Sbjct: 121 AWALYDAKKDRIVAARDPIGITTLYMGRDSKSPKTVYFASELKCLTDNCDSIIAFPPGHV 180

Query: 181 YDSATDKITRYYTPDWLDEERIPKTPLDYKLIRNSLESAVRKRLMAEVPYXXXXXXXXXX 240
           YDS TD+ITRY+ PDW+DE+RIP  PLD   IR+SLE AVRKRLMAEVPY          
Sbjct: 181 YDSETDQITRYFNPDWIDEDRIPSEPLDLLKIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIAAIAARETEKANKDLDPVAYDDEDKHLAGVDDKGNLHAAGWSRLHSFAIGLPNAPDL 300
             IA+IAARETEKAN  +DPV YD EDKHLAGVDD GNL +AGWS LHSFAIGLPNAPDL
Sbjct: 241 SLIASIAARETEKANSQMDPVKYDSEDKHLAGVDDAGNLRSAGWSHLHSFAIGLPNAPDL 300

Query: 301 QAARKVAKFISSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
           QAARKVAKFI SIHHEHTFTLQEGLDAL DVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 QAARKVAKFIGSIHHEHTFTLQEGLDALSDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFH ESVKRVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDRDFLDVCMNIDPAEKMINQSEGRIEKYILRKAFDTTDEPDVKPYLPEEILWRQKE 480
           VPFLDR+FL +CMN+DP EKMIN +EGRIEKYILRKAFDT+DEP  KPYLPEEILWRQKE
Sbjct: 421 VPFLDREFLQLCMNLDPKEKMINAAEGRIEKYILRKAFDTSDEPGAKPYLPEEILWRQKE 480

Query: 481 QFSDGVGYSWIDGLKDAAEAAISDEQFAQPKPEWGDDIPTTKEAYWYRLKFDALFPQKTA 540
           QFSDGVGYSWIDGLKDAAEAAISDEQF QPK EWGDDIPTTKEAYWYRLKFDALFPQKTA
Sbjct: 481 QFSDGVGYSWIDGLKDAAEAAISDEQFKQPKAEWGDDIPTTKEAYWYRLKFDALFPQKTA 540

Query: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHEQHI 571
           ASTVMRWIPKADWGCAEDPSGRYAKIHEQHI
Sbjct: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHEQHI 571

>Kpol_480.19 s480 complement(42251..43975) [1725 bp, 574 aa] {ON}
           complement(42251..43975) [1725 nt, 575 aa]
          Length = 574

 Score = 1017 bits (2629), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 485/571 (84%), Positives = 508/571 (88%)

Query: 1   MCGIFACYKHESVQEFKPKALQLSKRIRHRGPDWSGNVVKNTTILAHERLAIVGLDSGAQ 60
           MCGIFA YKHE+ + FKP+ALQLSKRIRHRGPDWSGNVVKN+TIL HERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAYKHENAEAFKPRALQLSKRIRHRGPDWSGNVVKNSTILVHERLAIVGLDSGAQ 60

Query: 61  PITSEDGDYTLCVNGEIYNHIKLREELTSYPFKTLSDCEPIIPLYQKYDIDTPKYLDGMF 120
           PITS  GDY LCVNGEIYNHI+LRE    Y +KTLSDCEPIIPLY K+DID PKYLDGMF
Sbjct: 61  PITSPCGDYVLCVNGEIYNHIQLRESCPDYKYKTLSDCEPIIPLYLKHDIDAPKYLDGMF 120

Query: 121 AWCLYDAKKDRIIAARDPIGITTLYMGRXXXXXXTVFFASELKCLVDDCDEITAFPPGHV 180
           AWCLYDAKKDRIIAARDPIGITTLYMGR      TVFFASELKCL DDCD I AFPPGHV
Sbjct: 121 AWCLYDAKKDRIIAARDPIGITTLYMGRNSKSPKTVFFASELKCLTDDCDSIMAFPPGHV 180

Query: 181 YDSATDKITRYYTPDWLDEERIPKTPLDYKLIRNSLESAVRKRLMAEVPYXXXXXXXXXX 240
           YDS TD+ITRY++PDW+DE+RIP  P+ YK IR SLE AVRKRLMAEVPY          
Sbjct: 181 YDSETDQITRYFSPDWIDEQRIPTEPVSYKAIRESLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIAAIAARETEKANKDLDPVAYDDEDKHLAGVDDKGNLHAAGWSRLHSFAIGLPNAPDL 300
             IA+IAARETEKA K++D  AYD EDKHL G+DD+GNLH AGWSRLHSFAIGLPNAPDL
Sbjct: 241 SLIASIAARETEKAMKEMDTTAYDSEDKHLTGIDDQGNLHTAGWSRLHSFAIGLPNAPDL 300

Query: 301 QAARKVAKFISSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
            AARKVAKFI SIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 LAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFH ESVKRVKNLHLADCLRANKSTM+WGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMSWGLEAR 420

Query: 421 VPFLDRDFLDVCMNIDPAEKMINQSEGRIEKYILRKAFDTTDEPDVKPYLPEEILWRQKE 480
           VPFLDR+FL +CMNIDPAEKMIN SEGRIEKYILRKAFDT+DEPD KPYLPEEILWRQKE
Sbjct: 421 VPFLDREFLQLCMNIDPAEKMINASEGRIEKYILRKAFDTSDEPDEKPYLPEEILWRQKE 480

Query: 481 QFSDGVGYSWIDGLKDAAEAAISDEQFAQPKPEWGDDIPTTKEAYWYRLKFDALFPQKTA 540
           QFSDGVGYSWIDGLKD AE  ISDE F+ PK  WG DIPTTKEAYWYRLKFDALFPQKTA
Sbjct: 481 QFSDGVGYSWIDGLKDTAERVISDELFSTPKEHWGADIPTTKEAYWYRLKFDALFPQKTA 540

Query: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHEQHI 571
           A TVMRWIPKADWGCAEDPSGRYAKIHEQHI
Sbjct: 541 AETVMRWIPKADWGCAEDPSGRYAKIHEQHI 571

>TDEL0D05520 Chr4 (996468..998189) [1722 bp, 573 aa] {ON} Anc_3.483
           YPR145W
          Length = 573

 Score = 1010 bits (2611), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 475/573 (82%), Positives = 512/573 (89%)

Query: 1   MCGIFACYKHESVQEFKPKALQLSKRIRHRGPDWSGNVVKNTTILAHERLAIVGLDSGAQ 60
           MCGIFA +KHE VQ +K KALQLSKRIRHRGPDWSGNV++N T+L HERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAHKHEDVQAYKQKALQLSKRIRHRGPDWSGNVLRNNTLLVHERLAIVGLDSGAQ 60

Query: 61  PITSEDGDYTLCVNGEIYNHIKLREELTSYPFKTLSDCEPIIPLYQKYDIDTPKYLDGMF 120
           PITS  G+YTLCVNGEIYNHIKLREE + Y F TLSDCEPIIPLY+KYDIDTPKYLDGMF
Sbjct: 61  PITSPCGNYTLCVNGEIYNHIKLREEFSDYKFSTLSDCEPIIPLYEKYDIDTPKYLDGMF 120

Query: 121 AWCLYDAKKDRIIAARDPIGITTLYMGRXXXXXXTVFFASELKCLVDDCDEITAFPPGHV 180
           AWCLYDAK+DRIIAARDP+GITTLYMGR      TVFFASELKCL DDCD I AFPPGH+
Sbjct: 121 AWCLYDAKQDRIIAARDPVGITTLYMGRNSLSPKTVFFASELKCLTDDCDNIVAFPPGHI 180

Query: 181 YDSATDKITRYYTPDWLDEERIPKTPLDYKLIRNSLESAVRKRLMAEVPYXXXXXXXXXX 240
           YDS TDKITRY+TPDWLDE RIP  P+DYK IR+SLE AVRKRLMAEVPY          
Sbjct: 181 YDSKTDKITRYFTPDWLDETRIPSNPVDYKAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIAAIAARETEKANKDLDPVAYDDEDKHLAGVDDKGNLHAAGWSRLHSFAIGLPNAPDL 300
             IA+IAARETEKAN ++D   YD EDKHLAG+DD GNLH+AGWSRLHSFAIGLP APDL
Sbjct: 241 SLIASIAARETEKANAEIDAQKYDSEDKHLAGIDDSGNLHSAGWSRLHSFAIGLPGAPDL 300

Query: 301 QAARKVAKFISSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
           +AA KVAKFI SIHHEHTFTLQEGLDALDDVI+HLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 KAASKVAKFIGSIHHEHTFTLQEGLDALDDVIWHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAP+A EFH E+VKRVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPNANEFHTEAVKRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDRDFLDVCMNIDPAEKMINQSEGRIEKYILRKAFDTTDEPDVKPYLPEEILWRQKE 480
           VPFLDR+FL +CMNIDP +KMIN+ EGR+EKYILRKAFDTTDEPDVKPYLPEEILWRQKE
Sbjct: 421 VPFLDREFLQLCMNIDPKDKMINKEEGRMEKYILRKAFDTTDEPDVKPYLPEEILWRQKE 480

Query: 481 QFSDGVGYSWIDGLKDAAEAAISDEQFAQPKPEWGDDIPTTKEAYWYRLKFDALFPQKTA 540
           QFSDGVGYSWIDGLKD AE  ISD+ FA PK  WGDD+PTTKEA+WYRLKFDALFPQKTA
Sbjct: 481 QFSDGVGYSWIDGLKDTAERVISDDIFAAPKSAWGDDVPTTKEAFWYRLKFDALFPQKTA 540

Query: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHEQHIQN 573
           A TVMRW+PKADWGCAEDPSGR+A+IH+QH++N
Sbjct: 541 ADTVMRWVPKADWGCAEDPSGRFAQIHDQHVKN 573

>CAGL0I10648g Chr9 complement(1053030..1054754) [1725 bp, 574 aa]
           {ON} highly similar to uniprot|P49090 Saccharomyces
           cerevisiae YGR124w asparagine synthetase or
           uniprot|P49089 Saccharomyces cerevisiae YPR145w ASN1
          Length = 574

 Score = 1010 bits (2611), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 479/572 (83%), Positives = 512/572 (89%), Gaps = 1/572 (0%)

Query: 1   MCGIFACYKHESVQEFKPKALQLSKRIRHRGPDWSGNVVKNTTILAHERLAIVGLDSGAQ 60
           MCGIFA YKH+ V  FKPKALQLSKRIRHRGPDWSGNVVKN+TI+ HERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAYKHQDVHAFKPKALQLSKRIRHRGPDWSGNVVKNSTIMVHERLAIVGLDSGAQ 60

Query: 61  PITSEDGDYTLCVNGEIYNHIKLREELTSYPFKTLSDCEPIIPLYQKYDIDTPKYLDGMF 120
           PITSEDGDYTLCVNGEIYNHI+LRE+   Y FKTLSDCEPIIP Y ++DID PKYLDGMF
Sbjct: 61  PITSEDGDYTLCVNGEIYNHIQLREQFPDYKFKTLSDCEPIIPAYLEHDIDAPKYLDGMF 120

Query: 121 AWCLYDAKKDRIIAARDPIGITTLYMGRXXXXXXTVFFASELKCLVDDCDEITAFPPGHV 180
           AWCLYDAK+DRI+AARDP+GITTLYMGR      TVFFASELKCL DDCDEITAFPPGHV
Sbjct: 121 AWCLYDAKQDRIVAARDPVGITTLYMGRCSSSPKTVFFASELKCLTDDCDEITAFPPGHV 180

Query: 181 YDSATDKITRYYTPDWLDEERIPKTPLDYKLIRNSLESAVRKRLMAEVPYXXXXXXXXXX 240
           YDS TD+ITRY+TPDW+DE RIP TP+++K IR SLE AVRKRLMAEVPY          
Sbjct: 181 YDSKTDQITRYFTPDWIDESRIPTTPVNFKDIRESLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIAAIAARETEKANKDLDPVAYD-DEDKHLAGVDDKGNLHAAGWSRLHSFAIGLPNAPD 299
             IA+IAARETEKAN++ D    D    K LAG+D++G+LH AGWSRLHSFAIGLPNAPD
Sbjct: 241 SLIASIAARETEKANEENDAADNDASASKQLAGIDNQGHLHTAGWSRLHSFAIGLPNAPD 300

Query: 300 LQAARKVAKFISSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ 359
           LQAARKVAKFI SIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ
Sbjct: 301 LQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ 360

Query: 360 GVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANKSTMAWGLEA 419
           GVKMVLSGEGSDEIFGGYLYFAQAPSA EFH+ESVKRVKNLHLADCLRANKSTMAWGLEA
Sbjct: 361 GVKMVLSGEGSDEIFGGYLYFAQAPSATEFHIESVKRVKNLHLADCLRANKSTMAWGLEA 420

Query: 420 RVPFLDRDFLDVCMNIDPAEKMINQSEGRIEKYILRKAFDTTDEPDVKPYLPEEILWRQK 479
           RVPFLD++FL +CMNIDP +KMI+QS GRIEKYILRKAFDT+DEPDVKPYLPEEILWRQK
Sbjct: 421 RVPFLDKEFLQLCMNIDPKDKMIDQSAGRIEKYILRKAFDTSDEPDVKPYLPEEILWRQK 480

Query: 480 EQFSDGVGYSWIDGLKDAAEAAISDEQFAQPKPEWGDDIPTTKEAYWYRLKFDALFPQKT 539
           EQFSDGVGYSWIDGLKD AE  ISD  F+ PK EWG+DIPTTKEAYWYRLKFDALFPQKT
Sbjct: 481 EQFSDGVGYSWIDGLKDTAERVISDTMFSNPKIEWGEDIPTTKEAYWYRLKFDALFPQKT 540

Query: 540 AASTVMRWIPKADWGCAEDPSGRYAKIHEQHI 571
           AASTVMRWIPKADWGCAEDPSGRYAKIHEQH+
Sbjct: 541 AASTVMRWIPKADWGCAEDPSGRYAKIHEQHV 572

>Suva_16.474 Chr16 (819031..820749) [1719 bp, 572 aa] {ON} YGR124W
           (REAL)
          Length = 572

 Score = 1001 bits (2588), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 475/571 (83%), Positives = 504/571 (88%)

Query: 1   MCGIFACYKHESVQEFKPKALQLSKRIRHRGPDWSGNVVKNTTILAHERLAIVGLDSGAQ 60
           MCGIFA +KHE V  +KPKALQLSKRIRHRGPDWSGN VKN+TI  HERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAFKHEDVHRYKPKALQLSKRIRHRGPDWSGNAVKNSTIFVHERLAIVGLDSGAQ 60

Query: 61  PITSEDGDYTLCVNGEIYNHIKLREELTSYPFKTLSDCEPIIPLYQKYDIDTPKYLDGMF 120
           PITS D DY LCVNGEIYNHI+LREE   Y FKTLSDCEPIIP+Y K+DID PKYLDGMF
Sbjct: 61  PITSPDEDYMLCVNGEIYNHIQLREECPDYQFKTLSDCEPIIPMYLKHDIDAPKYLDGMF 120

Query: 121 AWCLYDAKKDRIIAARDPIGITTLYMGRXXXXXXTVFFASELKCLVDDCDEITAFPPGHV 180
           AW LYDAK+DRIIAARDPIGITTLYMGR      TV+FASELKCL DDCD ITAFPPGHV
Sbjct: 121 AWTLYDAKQDRIIAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180

Query: 181 YDSATDKITRYYTPDWLDEERIPKTPLDYKLIRNSLESAVRKRLMAEVPYXXXXXXXXXX 240
           YDS TDKITRY+TPDWLDE+RIP TP+DY  IR+SLE AVRKRLMAEVP+          
Sbjct: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYLAIRHSLEKAVRKRLMAEVPFGVLLSGGLDS 240

Query: 241 XXIAAIAARETEKANKDLDPVAYDDEDKHLAGVDDKGNLHAAGWSRLHSFAIGLPNAPDL 300
             IAAIAARET KA  D++P  YD++ +HLAGVDD+GNLH AGW+ LHSFAIGLPNAPDL
Sbjct: 241 SLIAAIAARETAKATNDVEPSTYDNKARHLAGVDDEGNLHTAGWTSLHSFAIGLPNAPDL 300

Query: 301 QAARKVAKFISSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
           QAARKVAKFI S HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 QAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFH ESV+RVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDRDFLDVCMNIDPAEKMINQSEGRIEKYILRKAFDTTDEPDVKPYLPEEILWRQKE 480
           VPFLDR+FL +CMNIDP+EKMI   EGRIEKYILRKAFDTTDEP+ KPYLPEEILWRQKE
Sbjct: 421 VPFLDREFLQLCMNIDPSEKMIRPKEGRIEKYILRKAFDTTDEPETKPYLPEEILWRQKE 480

Query: 481 QFSDGVGYSWIDGLKDAAEAAISDEQFAQPKPEWGDDIPTTKEAYWYRLKFDALFPQKTA 540
           QFSDGVGYSWID LKD AEA ISDE FA PK EWG+DIPTTKEAYWYRLKFD LFPQKT 
Sbjct: 481 QFSDGVGYSWIDSLKDTAEAVISDEMFANPKAEWGNDIPTTKEAYWYRLKFDGLFPQKTV 540

Query: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHEQHI 571
           A TVMRW+PKADWGCAEDPSGRYA+IHE+HI
Sbjct: 541 ADTVMRWVPKADWGCAEDPSGRYAQIHEKHI 571

>YPR145W Chr16 (822620..824338) [1719 bp, 572 aa] {ON}
           ASN1Asparagine synthetase, isozyme of Asn2p; catalyzes
           the synthesis of L-asparagine from L-aspartate in the
           asparagine biosynthetic pathway
          Length = 572

 Score =  998 bits (2579), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 470/572 (82%), Positives = 502/572 (87%)

Query: 1   MCGIFACYKHESVQEFKPKALQLSKRIRHRGPDWSGNVVKNTTILAHERLAIVGLDSGAQ 60
           MCGIFA ++HE V  +KPKALQLSKRIRHRGPDWSGN +KN+TI  HERLAIVG++SGAQ
Sbjct: 1   MCGIFAAFRHEDVHRYKPKALQLSKRIRHRGPDWSGNAIKNSTIFVHERLAIVGVESGAQ 60

Query: 61  PITSEDGDYTLCVNGEIYNHIKLREELTSYPFKTLSDCEPIIPLYQKYDIDTPKYLDGMF 120
           PITS DG+Y LCVNGEIYNHI+LREE   Y F TLSDCEPIIP+Y K+DID PKYLDGMF
Sbjct: 61  PITSSDGEYMLCVNGEIYNHIQLREECADYEFGTLSDCEPIIPMYLKHDIDAPKYLDGMF 120

Query: 121 AWCLYDAKKDRIIAARDPIGITTLYMGRXXXXXXTVFFASELKCLVDDCDEITAFPPGHV 180
           AW LYDAK+DRI+AARDPIGITTLYMGR      TV+FASELKCL DDCD ITAFPPGHV
Sbjct: 121 AWTLYDAKQDRIVAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180

Query: 181 YDSATDKITRYYTPDWLDEERIPKTPLDYKLIRNSLESAVRKRLMAEVPYXXXXXXXXXX 240
           YDS TDKITRY+TPDWLDE+RIP TP+DY  IR+SLE AVRKRLMAEVPY          
Sbjct: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYMAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIAAIAARETEKANKDLDPVAYDDEDKHLAGVDDKGNLHAAGWSRLHSFAIGLPNAPDL 300
             IA+IAARET KA  D++P  YD + +HLAG+DD G LH AGW+ LHSFAIGLPNAPDL
Sbjct: 241 SLIASIAARETAKATNDVEPSTYDSKARHLAGIDDDGKLHTAGWTSLHSFAIGLPNAPDL 300

Query: 301 QAARKVAKFISSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
           QAARKVAKFI SIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 QAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFH ESV+RVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDRDFLDVCMNIDPAEKMINQSEGRIEKYILRKAFDTTDEPDVKPYLPEEILWRQKE 480
           VPFLDR+FL +CMNIDP EKMI   EGRIEKYILRKAFDTT EPD KPYLPEEILWRQKE
Sbjct: 421 VPFLDREFLQLCMNIDPNEKMIKPKEGRIEKYILRKAFDTTGEPDAKPYLPEEILWRQKE 480

Query: 481 QFSDGVGYSWIDGLKDAAEAAISDEQFAQPKPEWGDDIPTTKEAYWYRLKFDALFPQKTA 540
           QFSDGVGYSWIDGLKD AEA ISDE FA PK EWG DIPTTKEA+WYRLKFDALFPQKT 
Sbjct: 481 QFSDGVGYSWIDGLKDTAEAVISDEMFASPKAEWGSDIPTTKEAFWYRLKFDALFPQKTV 540

Query: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHEQHIQ 572
           A TVMRWIPKADWGCAEDPSGRYA+IHE+HI+
Sbjct: 541 ADTVMRWIPKADWGCAEDPSGRYAQIHEKHIE 572

>KNAG0A07920 Chr1 (1262894..1264630) [1737 bp, 578 aa] {ON}
           Anc_3.483 YPR145W
          Length = 578

 Score =  995 bits (2572), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 473/577 (81%), Positives = 512/577 (88%), Gaps = 4/577 (0%)

Query: 1   MCGIFACYKHESVQEFKPKALQLSKRIRHRGPDWSGNVVKNTTILAHERLAIVGLDSGAQ 60
           MCGIFA ++HE VQ FKP+ALQLSKRIRHRGPDWSGN++KN+TI+AHERLAIVGLDSGAQ
Sbjct: 1   MCGIFATFRHEDVQAFKPRALQLSKRIRHRGPDWSGNIIKNSTIMAHERLAIVGLDSGAQ 60

Query: 61  PITSEDGDYTLCVNGEIYNHIKLREELTSYPFKTLSDCEPIIPLYQKYDIDTPKYLDGMF 120
           PITS  GDY L VNGEIYNHI+LREE   Y +K+LSDCEPIIP+Y KYD+D PK+LDGMF
Sbjct: 61  PITSPCGDYILSVNGEIYNHIQLREECPEYQYKSLSDCEPIIPMYLKYDLDAPKHLDGMF 120

Query: 121 AWCLYDAKKDRIIAARDPIGITTLYMGRXXXXXXTVFFASELKCLVDDCDEITAFPPGHV 180
           AWCLYDAKKDRI+AARDPIGITTLYMGR      TVFFASELKCL DDCD I AFPPGHV
Sbjct: 121 AWCLYDAKKDRIVAARDPIGITTLYMGRSSMCPKTVFFASELKCLTDDCDNIIAFPPGHV 180

Query: 181 YDSATDKITRYYTPDWLDEERIPKTPLDYKLIRNSLESAVRKRLMAEVPYXXXXXXXXXX 240
           YDS TDKITRYYTP+WLDE +IP TP+D K IR++LE AVRKRLMAEVPY          
Sbjct: 181 YDSETDKITRYYTPNWLDETKIPSTPVDLKQIRHTLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIAAIAARETEKANKDLDPVAYDDEDK----HLAGVDDKGNLHAAGWSRLHSFAIGLPN 296
             IAAIAARETEKANK+LDP  YD++++    HLAG+DD+GNL +A WSRLHSFAIGLP 
Sbjct: 241 SLIAAIAARETEKANKELDPRKYDEQEEAEGHHLAGIDDEGNLLSATWSRLHSFAIGLPG 300

Query: 297 APDLQAARKVAKFISSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 356
           APDL AARKVAKFI SIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI
Sbjct: 301 APDLVAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 360

Query: 357 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANKSTMAWG 416
           KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFH ESVKRVKNLHL+DCLRANKSTMAWG
Sbjct: 361 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLSDCLRANKSTMAWG 420

Query: 417 LEARVPFLDRDFLDVCMNIDPAEKMINQSEGRIEKYILRKAFDTTDEPDVKPYLPEEILW 476
           LEARVPFLD++FLD+CMNIDP +K+INQ EGRIEKYILRKAFDT DEPDVKPYLPEEILW
Sbjct: 421 LEARVPFLDKEFLDLCMNIDPKDKLINQKEGRIEKYILRKAFDTCDEPDVKPYLPEEILW 480

Query: 477 RQKEQFSDGVGYSWIDGLKDAAEAAISDEQFAQPKPEWGDDIPTTKEAYWYRLKFDALFP 536
           RQKEQFSDGVGYSWIDGLKD AE  ISDE FA PK  WG D+PTTKEA+WYRLKFDALFP
Sbjct: 481 RQKEQFSDGVGYSWIDGLKDTAETVISDEMFAAPKAHWGIDVPTTKEAFWYRLKFDALFP 540

Query: 537 QKTAASTVMRWIPKADWGCAEDPSGRYAKIHEQHIQN 573
           Q TAA TVMRWIPKADWGCAEDPSGR+AKIHEQH+++
Sbjct: 541 QPTAAETVMRWIPKADWGCAEDPSGRFAKIHEQHVED 577

>NDAI0B05810 Chr2 (1412089..1413822) [1734 bp, 577 aa] {ON}
           Anc_3.483 YGR124W
          Length = 577

 Score =  993 bits (2566), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 476/576 (82%), Positives = 505/576 (87%), Gaps = 4/576 (0%)

Query: 1   MCGIFACYKHESVQEFKPKALQLSKRIRHRGPDWSGNVVKNTTILAHERLAIVGLDSGAQ 60
           MCGIFA +KHE V  FKP+ALQLSKRIRHRGPDWSGNV+KNTTILAHERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAFKHEDVHAFKPRALQLSKRIRHRGPDWSGNVIKNTTILAHERLAIVGLDSGAQ 60

Query: 61  PITSEDGDYTLCVNGEIYNHIKLREELTSYPFKTLSDCEPIIPLYQKYDIDTPKYLDGMF 120
           PITS  G+YTLCVNGEIYNHI++RE+   YPFKTLSDCEPIIPLY K+DIDTPK+LDGMF
Sbjct: 61  PITSPCGNYTLCVNGEIYNHIQIREQFPDYPFKTLSDCEPIIPLYLKHDIDTPKHLDGMF 120

Query: 121 AWCLYDAKKDRIIAARDPIGITTLYMGRXXXXXXTVFFASELKCLVDDCDEITAFPPGHV 180
           AWCLYD+K+DRIIAARDPIGITTLYMGR      TVFFASELKCL DDCD I AFPPGHV
Sbjct: 121 AWCLYDSKQDRIIAARDPIGITTLYMGRNSKTPQTVFFASELKCLTDDCDSIIAFPPGHV 180

Query: 181 YDSATDKITRYYTPDWLDEERIPKTPLDYKLIRNSLESAVRKRLMAEVPYXXXXXXXXXX 240
           YDS TD+ITRY+TPDWLDE+RIP+  LD   IR SLESAVRKRLMAEVP+          
Sbjct: 181 YDSKTDQITRYFTPDWLDEQRIPENKLDLTAIRESLESAVRKRLMAEVPFGVLLSGGLDS 240

Query: 241 XXIAAIAARETEKANKD--LDPVAYDDEDK--HLAGVDDKGNLHAAGWSRLHSFAIGLPN 296
             IA+IAARETEKAN    LD    +DE    HL GVDD+G+LH  GWS+LHSFAIGLPN
Sbjct: 241 SLIASIAARETEKANAQATLDNENANDETSKAHLTGVDDEGHLHNGGWSKLHSFAIGLPN 300

Query: 297 APDLQAARKVAKFISSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 356
           APDLQAARKVAKFI SIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI
Sbjct: 301 APDLQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 360

Query: 357 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANKSTMAWG 416
           KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFH ESVKRV NLHLADCLRANKSTMAWG
Sbjct: 361 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVNNLHLADCLRANKSTMAWG 420

Query: 417 LEARVPFLDRDFLDVCMNIDPAEKMINQSEGRIEKYILRKAFDTTDEPDVKPYLPEEILW 476
           LEARVPFLDRDFL +CMNIDP EKMINQ+EGRIEKYILRKAFDT+D+P+ KPYLPEEILW
Sbjct: 421 LEARVPFLDRDFLQLCMNIDPKEKMINQAEGRIEKYILRKAFDTSDDPEAKPYLPEEILW 480

Query: 477 RQKEQFSDGVGYSWIDGLKDAAEAAISDEQFAQPKPEWGDDIPTTKEAYWYRLKFDALFP 536
           RQKEQFSDGVGYSWIDGLKD AE  ISD  F  PK  WG DIPTTKEAYWYRLKFDAL+P
Sbjct: 481 RQKEQFSDGVGYSWIDGLKDTAERVISDAMFENPKDHWGTDIPTTKEAYWYRLKFDALYP 540

Query: 537 QKTAASTVMRWIPKADWGCAEDPSGRYAKIHEQHIQ 572
           QKTAA TVMRWIPKADWGCAEDPSGRYAKIHE+H+ 
Sbjct: 541 QKTAADTVMRWIPKADWGCAEDPSGRYAKIHEKHVN 576

>Smik_16.396 Chr16 (694650..696368) [1719 bp, 572 aa] {ON} YPR145W
           (REAL)
          Length = 572

 Score =  992 bits (2565), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 470/571 (82%), Positives = 498/571 (87%)

Query: 1   MCGIFACYKHESVQEFKPKALQLSKRIRHRGPDWSGNVVKNTTILAHERLAIVGLDSGAQ 60
           MCGIFA +KHE V  +KPKALQLSKRIRHRGPDWSGN +KN+TI  HERLAIVGL+SGAQ
Sbjct: 1   MCGIFAAFKHEDVHNYKPKALQLSKRIRHRGPDWSGNAIKNSTIFVHERLAIVGLESGAQ 60

Query: 61  PITSEDGDYTLCVNGEIYNHIKLREELTSYPFKTLSDCEPIIPLYQKYDIDTPKYLDGMF 120
           PITS D DY LCVNGEIYNHI+LREE   Y FKTLSDCEPIIP+Y K+DID PKYLDGMF
Sbjct: 61  PITSPDEDYMLCVNGEIYNHIQLREECPEYQFKTLSDCEPIIPMYLKHDIDAPKYLDGMF 120

Query: 121 AWCLYDAKKDRIIAARDPIGITTLYMGRXXXXXXTVFFASELKCLVDDCDEITAFPPGHV 180
           AW LYDAK+DRI+AARDPIGITTLYMGR      TV+FASELKCL DDCD ITAFPPGHV
Sbjct: 121 AWTLYDAKQDRIVAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180

Query: 181 YDSATDKITRYYTPDWLDEERIPKTPLDYKLIRNSLESAVRKRLMAEVPYXXXXXXXXXX 240
           YDS TDKITRY+TPDWLDE+RIP TP+DY  IR+SLE AVRKRLMAEVPY          
Sbjct: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYLAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIAAIAARETEKANKDLDPVAYDDEDKHLAGVDDKGNLHAAGWSRLHSFAIGLPNAPDL 300
             IA+IAARET  A  D+DP  YD + +HLAGVDD G LH AGW+ LHSFAIGLPNAPDL
Sbjct: 241 SLIASIAARETANATNDVDPSTYDSKARHLAGVDDDGKLHTAGWTSLHSFAIGLPNAPDL 300

Query: 301 QAARKVAKFISSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
           QAARKVAKFI S HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 QAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFH ESV+RVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDRDFLDVCMNIDPAEKMINQSEGRIEKYILRKAFDTTDEPDVKPYLPEEILWRQKE 480
           VPFLD++FL +CMNIDP EKMI   EGRIEKYILRKAFDTT EPD KPYLPEEILWRQKE
Sbjct: 421 VPFLDKEFLQLCMNIDPNEKMIKPKEGRIEKYILRKAFDTTGEPDAKPYLPEEILWRQKE 480

Query: 481 QFSDGVGYSWIDGLKDAAEAAISDEQFAQPKPEWGDDIPTTKEAYWYRLKFDALFPQKTA 540
           QFSDGVGYSWIDGLKD AE  ISDE FA PK EWG DIP+TKEA+WYRLKFDALFPQKT 
Sbjct: 481 QFSDGVGYSWIDGLKDTAETVISDEMFASPKAEWGSDIPSTKEAFWYRLKFDALFPQKTV 540

Query: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHEQHI 571
           A TVMRWIPKADWGCAEDPSGRYA+IHE+HI
Sbjct: 541 ADTVMRWIPKADWGCAEDPSGRYAQIHEKHI 571

>Skud_16.439 Chr16 (776317..778035) [1719 bp, 572 aa] {ON} YPR145W
           (REAL)
          Length = 572

 Score =  991 bits (2561), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 469/572 (81%), Positives = 498/572 (87%)

Query: 1   MCGIFACYKHESVQEFKPKALQLSKRIRHRGPDWSGNVVKNTTILAHERLAIVGLDSGAQ 60
           MCGIFA YKHE V  +K KALQLSKRIRHRGPDWSGN  KN+TI  HERLAIVGL+SGAQ
Sbjct: 1   MCGIFAAYKHEDVHRYKQKALQLSKRIRHRGPDWSGNATKNSTIFVHERLAIVGLESGAQ 60

Query: 61  PITSEDGDYTLCVNGEIYNHIKLREELTSYPFKTLSDCEPIIPLYQKYDIDTPKYLDGMF 120
           PITS D DY LCVNGEIYNHI+LREE   Y FKTLSDCEPIIP+Y K+DI+ PKYLDGMF
Sbjct: 61  PITSPDEDYMLCVNGEIYNHIQLREECPDYQFKTLSDCEPIIPMYLKHDIEAPKYLDGMF 120

Query: 121 AWCLYDAKKDRIIAARDPIGITTLYMGRXXXXXXTVFFASELKCLVDDCDEITAFPPGHV 180
           AW LYDAK+DRI+AARDPIGITTLYMGR      TV+FASELKCL DDCD ITAFPPGHV
Sbjct: 121 AWTLYDAKQDRIVAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180

Query: 181 YDSATDKITRYYTPDWLDEERIPKTPLDYKLIRNSLESAVRKRLMAEVPYXXXXXXXXXX 240
           YDS TDKITRY+TPDWLDE+RIP TP+DY  IR+SLE AVRKRLMAEVP+          
Sbjct: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYMAIRHSLEKAVRKRLMAEVPFGVLLSGGLDS 240

Query: 241 XXIAAIAARETEKANKDLDPVAYDDEDKHLAGVDDKGNLHAAGWSRLHSFAIGLPNAPDL 300
             IA+IAARET  A  D++P  YD + +HLAGVDD GNLH AGW+ LHSFAIGLPNAPDL
Sbjct: 241 SLIASIAARETANATNDVEPSTYDSKARHLAGVDDDGNLHTAGWTSLHSFAIGLPNAPDL 300

Query: 301 QAARKVAKFISSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
           QAARKVAKFI S HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 QAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFH ESV+RVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDRDFLDVCMNIDPAEKMINQSEGRIEKYILRKAFDTTDEPDVKPYLPEEILWRQKE 480
           VPFLDR+FL +CMNIDP EKMI   EGRIEKYILRKAFDTT EPD KPYLPEEILWRQKE
Sbjct: 421 VPFLDREFLQLCMNIDPKEKMIRAKEGRIEKYILRKAFDTTGEPDAKPYLPEEILWRQKE 480

Query: 481 QFSDGVGYSWIDGLKDAAEAAISDEQFAQPKPEWGDDIPTTKEAYWYRLKFDALFPQKTA 540
           QFSDGVGYSWID LKD AEA ISDE FA PK EWG DIPTTKEA+WYRLKFDALFPQKT 
Sbjct: 481 QFSDGVGYSWIDSLKDNAEAVISDEMFASPKAEWGSDIPTTKEAFWYRLKFDALFPQKTV 540

Query: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHEQHIQ 572
           A TVMRW+PKADWGCAEDPSGRYA+IHE+HI+
Sbjct: 541 ADTVMRWVPKADWGCAEDPSGRYAQIHEKHIE 572

>NCAS0F03510 Chr6 (703369..705096) [1728 bp, 575 aa] {ON} Anc_3.483
           YGR124W
          Length = 575

 Score =  985 bits (2546), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 467/575 (81%), Positives = 509/575 (88%), Gaps = 7/575 (1%)

Query: 1   MCGIFACYKHESVQEFKPKALQLSKRIRHRGPDWSGNVVKNTTILAHERLAIVGLDSGAQ 60
           MCGIFA ++HE V+ +KPKALQL+KRIRHRGPDWSGNVVKNTTILAHERL+IVGLDSGAQ
Sbjct: 1   MCGIFAAFRHEDVKAYKPKALQLTKRIRHRGPDWSGNVVKNTTILAHERLSIVGLDSGAQ 60

Query: 61  PITSEDGDYTLCVNGEIYNHIKLREELTSYPFKTLSDCEPIIPLYQKYDIDTPKYLDGMF 120
           PITS  G+YTLCVNGEIYNHI++REE   Y FKTLSDCEPIIPLY KYD+D PK+LDGMF
Sbjct: 61  PITSPCGNYTLCVNGEIYNHIQIREECADYQFKTLSDCEPIIPLYLKYDLDAPKHLDGMF 120

Query: 121 AWCLYDAKKDRIIAARDPIGITTLYMGRXXXXXXTVFFASELKCLVDDCDEITAFPPGHV 180
           AWCLYDAK+DRI+AARDPIGITTLYMGR      TV+FASELKCL DDCD I AFPPGHV
Sbjct: 121 AWCLYDAKQDRIVAARDPIGITTLYMGRQSKTPQTVYFASELKCLTDDCDSIVAFPPGHV 180

Query: 181 YDSATDKITRYYTPDWLDEERIPKTPLDYKLIRNSLESAVRKRLMAEVPYXXXXXXXXXX 240
           YDS TD+ITRY+ PDWLDE+RIP TP+D K IR +LE AVRKRLMAEVPY          
Sbjct: 181 YDSNTDQITRYFNPDWLDEDRIPSTPVDLKAIRETLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIAAIAARETEKANKDLDPVAYDDED----KHLAGVDDKGNLHAAGWSRLHSFAIGLPN 296
             IA+IAARETEKA +D+D    +DE+    KHL GVDD+G+LH  GWSRLHSFAIGLPN
Sbjct: 241 SLIASIAARETEKAMQDVD---VEDENGEHHKHLTGVDDEGHLHTGGWSRLHSFAIGLPN 297

Query: 297 APDLQAARKVAKFISSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 356
           APDLQAARKVAKFI S+HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI
Sbjct: 298 APDLQAARKVAKFIGSVHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 357

Query: 357 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANKSTMAWG 416
           KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFH ESVKRVKNLHLADCLRANKSTMAWG
Sbjct: 358 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWG 417

Query: 417 LEARVPFLDRDFLDVCMNIDPAEKMINQSEGRIEKYILRKAFDTTDEPDVKPYLPEEILW 476
           LEARVPFLD++FL +CMNIDP +KMI+Q+ G+IEKYILRKAFDTTD+P+ KPYLP+EILW
Sbjct: 418 LEARVPFLDKEFLQLCMNIDPKDKMIDQASGKIEKYILRKAFDTTDDPEEKPYLPQEILW 477

Query: 477 RQKEQFSDGVGYSWIDGLKDAAEAAISDEQFAQPKPEWGDDIPTTKEAYWYRLKFDALFP 536
           RQKEQFSDGVGYSWIDGLKD AE  ISD  F  PKP WG+D+PTTKEAYWYRLKFDAL+P
Sbjct: 478 RQKEQFSDGVGYSWIDGLKDTAERVISDAMFENPKPHWGNDVPTTKEAYWYRLKFDALYP 537

Query: 537 QKTAASTVMRWIPKADWGCAEDPSGRYAKIHEQHI 571
           QKTAA TVMRWIPKADWGCAEDPSGRYAKIHE+H+
Sbjct: 538 QKTAADTVMRWIPKADWGCAEDPSGRYAKIHEKHV 572

>Smik_6.220 Chr6 (357844..359562) [1719 bp, 572 aa] {ON} YGR124W
           (REAL)
          Length = 572

 Score =  980 bits (2533), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 465/571 (81%), Positives = 503/571 (88%), Gaps = 1/571 (0%)

Query: 1   MCGIFACYKHESVQEFKPKALQLSKRIRHRGPDWSGNVVKNTTILAHERLAIVGLDSGAQ 60
           MCGIFA +KH+ +  FKPKALQLSKRIRHRGPDWSGN V N+TI  HERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAFKHDDIHSFKPKALQLSKRIRHRGPDWSGNAVMNSTIFVHERLAIVGLDSGAQ 60

Query: 61  PITSEDGDYTLCVNGEIYNHIKLREELTSYPFKTLSDCEPIIPLYQKYDIDTPKYLDGMF 120
           PITS DG+Y L VNGEIYNHI+LREE + Y F+T SDCEPIIPLY ++DID PKYLDGMF
Sbjct: 61  PITSADGEYMLGVNGEIYNHIQLREECSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF 120

Query: 121 AWCLYDAKKDRIIAARDPIGITTLYMGRXXXXXXTVFFASELKCLVDDCDEITAFPPGHV 180
           A+C+YDAKKDRI+AARDPIG+ TLYMGR      TV+FASELKCL D CD I AFPPGHV
Sbjct: 121 AFCIYDAKKDRIVAARDPIGVVTLYMGRSSKSPKTVYFASELKCLTDVCDSIIAFPPGHV 180

Query: 181 YDSATDKITRYYTPDWLDEERIPKTPLDYKLIRNSLESAVRKRLMAEVPYXXXXXXXXXX 240
           YDS TDKITRY+TPDWLDE+RIP TP+DY  IR+SLE AVRKRLMAEVPY          
Sbjct: 181 YDSQTDKITRYFTPDWLDEKRIPSTPVDYLAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIAAIAARETEKANKDLDPVAYDDEDKHLAGVDDKGNLHAAGWSRLHSFAIGLPNAPDL 300
             IAAIAARETEKAN D++  +  DE K LAG+DD+G+LH +GWSRLHSFAIGLPNAPDL
Sbjct: 241 SLIAAIAARETEKANADVNEESSVDE-KQLAGIDDQGHLHTSGWSRLHSFAIGLPNAPDL 299

Query: 301 QAARKVAKFISSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
           QAARKVAKFI SIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 300 QAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 359

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFH ESV+RVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 360 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 419

Query: 421 VPFLDRDFLDVCMNIDPAEKMINQSEGRIEKYILRKAFDTTDEPDVKPYLPEEILWRQKE 480
           VPFLD+DFL +CMNIDP +KMI   EG+IEKYILRKAFDTT+EPDVKPYLPEEILWRQKE
Sbjct: 420 VPFLDKDFLQLCMNIDPKDKMIKPKEGKIEKYILRKAFDTTNEPDVKPYLPEEILWRQKE 479

Query: 481 QFSDGVGYSWIDGLKDAAEAAISDEQFAQPKPEWGDDIPTTKEAYWYRLKFDALFPQKTA 540
           QFSDGVGYSWIDGL+D AE  ISD  FA PK +WGDDIPTTKEAYWYRLKFDA FPQKTA
Sbjct: 480 QFSDGVGYSWIDGLRDTAERVISDTMFANPKADWGDDIPTTKEAYWYRLKFDAWFPQKTA 539

Query: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHEQHI 571
           A+TVMRW+PKADWGCAEDPSGRYAKIHE+H+
Sbjct: 540 ANTVMRWVPKADWGCAEDPSGRYAKIHEKHV 570

>YGR124W Chr7 (739944..741662) [1719 bp, 572 aa] {ON}
           ASN2Asparagine synthetase, isozyme of Asn1p; catalyzes
           the synthesis of L-asparagine from L-aspartate in the
           asparagine biosynthetic pathway
          Length = 572

 Score =  980 bits (2533), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 468/571 (81%), Positives = 500/571 (87%), Gaps = 1/571 (0%)

Query: 1   MCGIFACYKHESVQEFKPKALQLSKRIRHRGPDWSGNVVKNTTILAHERLAIVGLDSGAQ 60
           MCGIFA +KHE +  FKPKALQLSK+IRHRGPDWSGN V N+TI  HERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAFKHEDIHNFKPKALQLSKKIRHRGPDWSGNAVMNSTIFVHERLAIVGLDSGAQ 60

Query: 61  PITSEDGDYTLCVNGEIYNHIKLREELTSYPFKTLSDCEPIIPLYQKYDIDTPKYLDGMF 120
           PITS DG+Y L VNGEIYNHI+LRE  + Y F+T SDCEPIIPLY ++DID PKYLDGMF
Sbjct: 61  PITSADGEYMLGVNGEIYNHIQLREMCSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF 120

Query: 121 AWCLYDAKKDRIIAARDPIGITTLYMGRXXXXXXTVFFASELKCLVDDCDEITAFPPGHV 180
           A+CLYD+KKDRI+AARDPIG+ TLYMGR      TV+FASELKCL D CD I +FPPGHV
Sbjct: 121 AFCLYDSKKDRIVAARDPIGVVTLYMGRSSQSPETVYFASELKCLTDVCDSIISFPPGHV 180

Query: 181 YDSATDKITRYYTPDWLDEERIPKTPLDYKLIRNSLESAVRKRLMAEVPYXXXXXXXXXX 240
           YDS TDKITRY+TPDWLDE+RIP TP+DY  IR+SLE AVRKRLMAEVPY          
Sbjct: 181 YDSETDKITRYFTPDWLDEKRIPSTPVDYHAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIAAIAARETEKANKDLDPVAYDDEDKHLAGVDDKGNLHAAGWSRLHSFAIGLPNAPDL 300
             IAAIAARETEKAN D +     DE K LAG+DD+G+LH +GWSRLHSFAIGLPNAPDL
Sbjct: 241 SLIAAIAARETEKANADANEDNNVDE-KQLAGIDDQGHLHTSGWSRLHSFAIGLPNAPDL 299

Query: 301 QAARKVAKFISSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
           QAARKVAKFI SIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 300 QAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 359

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFH ESV+RVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 360 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 419

Query: 421 VPFLDRDFLDVCMNIDPAEKMINQSEGRIEKYILRKAFDTTDEPDVKPYLPEEILWRQKE 480
           VPFLD+DFL +CMNIDP EKMI   EGRIEKYILRKAFDTTDEPDVKPYLPEEILWRQKE
Sbjct: 420 VPFLDKDFLQLCMNIDPNEKMIKPKEGRIEKYILRKAFDTTDEPDVKPYLPEEILWRQKE 479

Query: 481 QFSDGVGYSWIDGLKDAAEAAISDEQFAQPKPEWGDDIPTTKEAYWYRLKFDALFPQKTA 540
           QFSDGVGYSWIDGL+D AE AISD  FA PK +WGDDIPTTKEAYWYRLKFDA FPQKTA
Sbjct: 480 QFSDGVGYSWIDGLRDTAERAISDAMFANPKADWGDDIPTTKEAYWYRLKFDAWFPQKTA 539

Query: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHEQHI 571
           A TVMRWIPKADWGCAEDPSGRYAKIHE+H+
Sbjct: 540 ADTVMRWIPKADWGCAEDPSGRYAKIHEKHV 570

>KAFR0G03670 Chr7 (758115..759833) [1719 bp, 572 aa] {ON} Anc_3.483
           YPR145W
          Length = 572

 Score =  979 bits (2532), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 464/572 (81%), Positives = 500/572 (87%)

Query: 1   MCGIFACYKHESVQEFKPKALQLSKRIRHRGPDWSGNVVKNTTILAHERLAIVGLDSGAQ 60
           MCGIFA ++HE V  FK KALQLSKRIRHRGPDWSGNVVKN+TI+ HERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAFRHEDVTSFKSKALQLSKRIRHRGPDWSGNVVKNSTIMVHERLAIVGLDSGAQ 60

Query: 61  PITSEDGDYTLCVNGEIYNHIKLREELTSYPFKTLSDCEPIIPLYQKYDIDTPKYLDGMF 120
           PITS  G+YTLCVNGEIYNHI+LRE+   Y FKTLSDCEPIIPLY + DID PK LDGMF
Sbjct: 61  PITSPCGNYTLCVNGEIYNHIQLREQFPDYKFKTLSDCEPIIPLYLRDDIDAPKSLDGMF 120

Query: 121 AWCLYDAKKDRIIAARDPIGITTLYMGRXXXXXXTVFFASELKCLVDDCDEITAFPPGHV 180
           AW LYD+KKDRI+AARDPIG+TTLYMGR      TVFFASELKCLVDDCD I AFPPGH+
Sbjct: 121 AWTLYDSKKDRILAARDPIGVTTLYMGRSSMSPKTVFFASELKCLVDDCDSIVAFPPGHI 180

Query: 181 YDSATDKITRYYTPDWLDEERIPKTPLDYKLIRNSLESAVRKRLMAEVPYXXXXXXXXXX 240
           YDS TDKITRY+TP+W+DE +IP TP+DY  IR+SLE AVRKRLMAEVPY          
Sbjct: 181 YDSETDKITRYFTPNWIDENKIPTTPVDYTAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIAAIAARETEKANKDLDPVAYDDEDKHLAGVDDKGNLHAAGWSRLHSFAIGLPNAPDL 300
             IA+IAARETE AN++LD   Y +E  HLAG+DD+G+L  +GWSRLHSFAIGLP APDL
Sbjct: 241 SLIASIAARETEAANRELDASQYAEEGSHLAGIDDEGHLRTSGWSRLHSFAIGLPGAPDL 300

Query: 301 QAARKVAKFISSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
            AA+KVAKFI SIHHEHTFTLQEG+DALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 IAAKKVAKFIGSIHHEHTFTLQEGIDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFH ESVKRVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDRDFLDVCMNIDPAEKMINQSEGRIEKYILRKAFDTTDEPDVKPYLPEEILWRQKE 480
           VPFLDR+FLD+CMNIDP +K+INQ EGRIEKYILRKAFDT D+P  KPYLP+EILWRQKE
Sbjct: 421 VPFLDREFLDLCMNIDPNDKLINQKEGRIEKYILRKAFDTKDDPSAKPYLPDEILWRQKE 480

Query: 481 QFSDGVGYSWIDGLKDAAEAAISDEQFAQPKPEWGDDIPTTKEAYWYRLKFDALFPQKTA 540
           QFSDGVGYSWID LKD AE  ISDE FA PK  WG DIPTTKEAYWYRLKFDALFPQ TA
Sbjct: 481 QFSDGVGYSWIDCLKDTAEKVISDEMFANPKSHWGKDIPTTKEAYWYRLKFDALFPQPTA 540

Query: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHEQHIQ 572
           A TVMRWIPKADWGCAEDPSGRYA+IHE+HIQ
Sbjct: 541 AETVMRWIPKADWGCAEDPSGRYAQIHEKHIQ 572

>AFR303W Chr6 (989036..990751) [1716 bp, 571 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR124W (ASN2) and
           YPR145W (ASN1)
          Length = 571

 Score =  976 bits (2524), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 459/573 (80%), Positives = 503/573 (87%), Gaps = 2/573 (0%)

Query: 1   MCGIFACYKHESVQEFKPKALQLSKRIRHRGPDWSGNVVKNTTILAHERLAIVGLDSGAQ 60
           MCGIFACY+ + ++ FKP AL+LSKR+RHRGPDWSGNV+KN TIL HERLAIVGLDSGAQ
Sbjct: 1   MCGIFACYRKDDIESFKPTALRLSKRVRHRGPDWSGNVIKNDTILVHERLAIVGLDSGAQ 60

Query: 61  PITSEDGDYTLCVNGEIYNHIKLREELTSYPFKTLSDCEPIIPLYQKYDIDTPKYLDGMF 120
           PI S DG+Y LCVNGEIYNHI LREE + Y F +LSDCEPIIPLY KYD++TP++LDGMF
Sbjct: 61  PINSPDGNYVLCVNGEIYNHIHLREECSDYEFTSLSDCEPIIPLYLKYDVETPQHLDGMF 120

Query: 121 AWCLYDAKKDRIIAARDPIGITTLYMGRXXXXXXTVFFASELKCLVDDCDEITAFPPGHV 180
           AWCLYD ++DRI+AARDPIG+TTLYMG+      T +FASELKCLVD+CDEITAFPPGHV
Sbjct: 121 AWCLYDVQRDRIVAARDPIGVTTLYMGKSSSSPRTRYFASELKCLVDECDEITAFPPGHV 180

Query: 181 YDSATDKITRYYTPDWLDEERIPKTPLDYKLIRNSLESAVRKRLMAEVPYXXXXXXXXXX 240
           YDS TDK+TRY+ PDW+DE RIP  P+DYK +R +LE AVRKRLMAEVPY          
Sbjct: 181 YDSDTDKLTRYFKPDWIDETRIPSQPVDYKAVRTTLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIAAIAARETEKANKDLDPVAYDDEDKHLAGVDDKGNLHAAGWSRLHSFAIGLPNAPDL 300
             IA+IAARETE+AN++   V  D   KHLAG+DD+G LH  GWSRLHSFAIGLPNAPDL
Sbjct: 241 SLIASIAARETERANREAGDVYADG--KHLAGMDDRGLLHTGGWSRLHSFAIGLPNAPDL 298

Query: 301 QAARKVAKFISSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
           QAARKVAKFI SIHHEHTFTLQEGLDALDDVI+HLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 299 QAARKVAKFIGSIHHEHTFTLQEGLDALDDVIHHLETYDVTTIRASTPMFLLSRKIKAQG 358

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPS AEFH E+VKRV NLHLADCLRANKSTMAWGLEAR
Sbjct: 359 VKMVLSGEGSDEIFGGYLYFAQAPSPAEFHTETVKRVNNLHLADCLRANKSTMAWGLEAR 418

Query: 421 VPFLDRDFLDVCMNIDPAEKMINQSEGRIEKYILRKAFDTTDEPDVKPYLPEEILWRQKE 480
           VPFLDR+FL +CMNIDPAEKMI   +GRIEKYILRKAFDT+DEP V PYLPEEILWRQKE
Sbjct: 419 VPFLDREFLQLCMNIDPAEKMIAPQKGRIEKYILRKAFDTSDEPGVDPYLPEEILWRQKE 478

Query: 481 QFSDGVGYSWIDGLKDAAEAAISDEQFAQPKPEWGDDIPTTKEAYWYRLKFDALFPQKTA 540
           QFSDGVGYSWIDGLKDAAE AISDEQFA P P WGDDIPTTKEA+WYRLKFDALFPQ TA
Sbjct: 479 QFSDGVGYSWIDGLKDAAERAISDEQFANPNPAWGDDIPTTKEAFWYRLKFDALFPQPTA 538

Query: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHEQHIQN 573
           A+TVMRW+PKADWGCAEDPSGRYAKIH+QHI +
Sbjct: 539 AATVMRWVPKADWGCAEDPSGRYAKIHDQHISS 571

>TPHA0D04200 Chr4 (904705..906429) [1725 bp, 574 aa] {ON} Anc_3.483
           YPR145W
          Length = 574

 Score =  976 bits (2524), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 464/571 (81%), Positives = 495/571 (86%)

Query: 1   MCGIFACYKHESVQEFKPKALQLSKRIRHRGPDWSGNVVKNTTILAHERLAIVGLDSGAQ 60
           MCGIF  YKHE+ + FKP+ALQLSKRIRHRGPDWSGNVVKN+TI+AHERLAIVGLDSGAQ
Sbjct: 1   MCGIFTVYKHENAEAFKPRALQLSKRIRHRGPDWSGNVVKNSTIMAHERLAIVGLDSGAQ 60

Query: 61  PITSEDGDYTLCVNGEIYNHIKLREELTSYPFKTLSDCEPIIPLYQKYDIDTPKYLDGMF 120
           PITS+DGD+ LCVNGEIYNHI++RE+   Y FKTLSDCEPIIPLY KY  + PK+LDGMF
Sbjct: 61  PITSQDGDHILCVNGEIYNHIQIREQFPDYQFKTLSDCEPIIPLYMKYGAEAPKHLDGMF 120

Query: 121 AWCLYDAKKDRIIAARDPIGITTLYMGRXXXXXXTVFFASELKCLVDDCDEITAFPPGHV 180
           AW LYDAK+DRIIAARDPIGITTLYMGR      TV+FASELKCL DDCD I AFPPGHV
Sbjct: 121 AWTLYDAKQDRIIAARDPIGITTLYMGRSSKSPKTVYFASELKCLTDDCDSIVAFPPGHV 180

Query: 181 YDSATDKITRYYTPDWLDEERIPKTPLDYKLIRNSLESAVRKRLMAEVPYXXXXXXXXXX 240
           YDS TD+ITRYYTPDW+DE RI   PLD   IR+SLE AVRKRLMAEVPY          
Sbjct: 181 YDSVTDQITRYYTPDWIDENRIANQPLDLMKIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIAAIAARETEKANKDLDPVAYDDEDKHLAGVDDKGNLHAAGWSRLHSFAIGLPNAPDL 300
             IA+IAARETEKA K     +       L G+DD GNL ++GWSRLHSFAIGLP APDL
Sbjct: 241 SLIASIAARETEKAMKTASSDSLSSSVNQLTGIDDNGNLRSSGWSRLHSFAIGLPGAPDL 300

Query: 301 QAARKVAKFISSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
            AA+KVAKFI S+HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 IAAKKVAKFIGSVHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFH ESVKRVKNLHL+DCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLSDCLRANKSTMAWGLEAR 420

Query: 421 VPFLDRDFLDVCMNIDPAEKMINQSEGRIEKYILRKAFDTTDEPDVKPYLPEEILWRQKE 480
           VPFLDR+FLD+CMNIDP+EKMINQ EGRIEKYILRKAFDTTDEP+ KPYLP+EILWRQKE
Sbjct: 421 VPFLDREFLDLCMNIDPSEKMINQKEGRIEKYILRKAFDTTDEPNEKPYLPDEILWRQKE 480

Query: 481 QFSDGVGYSWIDGLKDAAEAAISDEQFAQPKPEWGDDIPTTKEAYWYRLKFDALFPQKTA 540
           QFSDGVGYSWIDGLKD AE  ISDE F  P+  WG DIPTTKEAYWYRLKFDALFPQ TA
Sbjct: 481 QFSDGVGYSWIDGLKDTAERVISDELFENPREHWGSDIPTTKEAYWYRLKFDALFPQPTA 540

Query: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHEQHI 571
           ASTVMRWIPKADWGCAEDPSGRYAKIHEQHI
Sbjct: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHEQHI 571

>Suva_7.410 Chr7 (709927..711645) [1719 bp, 572 aa] {ON} YPR145W
           (REAL)
          Length = 572

 Score =  976 bits (2523), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 460/572 (80%), Positives = 502/572 (87%), Gaps = 1/572 (0%)

Query: 1   MCGIFACYKHESVQEFKPKALQLSKRIRHRGPDWSGNVVKNTTILAHERLAIVGLDSGAQ 60
           MCGIFA +KHE +++FKPKALQLSKRIRHRGPDWSGN + N+TI  HERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAFKHEDIEDFKPKALQLSKRIRHRGPDWSGNAIMNSTIFVHERLAIVGLDSGAQ 60

Query: 61  PITSEDGDYTLCVNGEIYNHIKLREELTSYPFKTLSDCEPIIPLYQKYDIDTPKYLDGMF 120
           PITS DGDY L VNGEIYNHI+LRE+ + Y F+T SDCEPIIPLY ++DID PKYLDGMF
Sbjct: 61  PITSSDGDYMLGVNGEIYNHIQLREQCSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF 120

Query: 121 AWCLYDAKKDRIIAARDPIGITTLYMGRXXXXXXTVFFASELKCLVDDCDEITAFPPGHV 180
           A+CLYD+KKDR+IAARDPIG+ TLYMGR      TV+FASELKCL D CD I AFPPGHV
Sbjct: 121 AFCLYDSKKDRVIAARDPIGVVTLYMGRCSKSPKTVYFASELKCLTDVCDSIIAFPPGHV 180

Query: 181 YDSATDKITRYYTPDWLDEERIPKTPLDYKLIRNSLESAVRKRLMAEVPYXXXXXXXXXX 240
           YDS TDKITRY+TPDWLDE+R+P TP+DY+ IR+SLE AVRKRLMAEVPY          
Sbjct: 181 YDSETDKITRYFTPDWLDEKRVPTTPVDYRAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIAAIAARETEKANKDLDPVAYDDEDKHLAGVDDKGNLHAAGWSRLHSFAIGLPNAPDL 300
             IAAIAARETE AN + +  A  ++ K LAG+DD+G+LH +GWSRLHSFA+GLPNAPDL
Sbjct: 241 SLIAAIAARETETANVEANEEASAEKSK-LAGIDDQGHLHTSGWSRLHSFAVGLPNAPDL 299

Query: 301 QAARKVAKFISSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
           QAARKVAKFI SIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 300 QAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 359

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFH ESV+RVKNLHLADCLRANKST+AWGLEAR
Sbjct: 360 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTLAWGLEAR 419

Query: 421 VPFLDRDFLDVCMNIDPAEKMINQSEGRIEKYILRKAFDTTDEPDVKPYLPEEILWRQKE 480
           VPFLD+DFL +CMNIDP +KMIN  EGRIEKYILRKAFDTTDEPDVKPYLPEEILWRQKE
Sbjct: 420 VPFLDKDFLQLCMNIDPKDKMINSKEGRIEKYILRKAFDTTDEPDVKPYLPEEILWRQKE 479

Query: 481 QFSDGVGYSWIDGLKDAAEAAISDEQFAQPKPEWGDDIPTTKEAYWYRLKFDALFPQKTA 540
           QFSDGVGYSWID L+D AE  ISD  FA PK  WGDDIPTTKEAYWYRLKFDA FPQKTA
Sbjct: 480 QFSDGVGYSWIDSLRDTAERVISDAMFANPKASWGDDIPTTKEAYWYRLKFDAWFPQKTA 539

Query: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHEQHIQ 572
           A TVMRW+PKADWGCAEDPSGRYA+IHE+H+ 
Sbjct: 540 ADTVMRWVPKADWGCAEDPSGRYAQIHEKHVN 571

>ZYRO0B04136g Chr2 complement(345085..346803) [1719 bp, 572 aa] {ON}
           highly similar to uniprot|P49089 Saccharomyces
           cerevisiae YPR145W ASN1 Asparagine synthetase isozyme of
           Asn2p catalyzes the synthesis of L-asparagine from L-
           aspartate in the asparagine biosynthetic pathway
          Length = 572

 Score =  975 bits (2521), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 459/573 (80%), Positives = 502/573 (87%), Gaps = 1/573 (0%)

Query: 1   MCGIFACYKHESVQEFKPKALQLSKRIRHRGPDWSGNVVKNTTILAHERLAIVGLDSGAQ 60
           MCGIFA ++H  VQE++P ALQLSKRIRHRGPDWSGNVVKN+TIL HERLAIVGL+SG+Q
Sbjct: 1   MCGIFAAFRHTDVQEYRPHALQLSKRIRHRGPDWSGNVVKNSTILVHERLAIVGLESGSQ 60

Query: 61  PITSEDGDYTLCVNGEIYNHIKLREELTSYPFKTLSDCEPIIPLYQKYDIDTPKYLDGMF 120
           PI S  G+YTLCVNGEIYNHI+LREE + YPF++LSDCEPIIPLY KY +D PK LDGMF
Sbjct: 61  PIKSPCGNYTLCVNGEIYNHIQLREECSDYPFQSLSDCEPIIPLYLKYGLDAPKKLDGMF 120

Query: 121 AWCLYDAKKDRIIAARDPIGITTLYMGRXXXXXXTVFFASELKCLVDDCDEITAFPPGHV 180
           AWCLYD+K+DRI+AARDPIGITTLYMG+      T FFASELKCL+DDCDEI AFPPGHV
Sbjct: 121 AWCLYDSKEDRIVAARDPIGITTLYMGKSSKSPKTRFFASELKCLIDDCDEIVAFPPGHV 180

Query: 181 YDSATDKITRYYTPDWLDEERIPKTPLDYKLIRNSLESAVRKRLMAEVPYXXXXXXXXXX 240
           YDS +D+ITRY+ P WLDE  +P TPLDYK++R+SLE +VRKRLMAEVPY          
Sbjct: 181 YDSKSDQITRYFNPQWLDESYMPSTPLDYKVLRHSLEKSVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIAAIAARETEKANKDLDPVAYDDEDKHLAGVDDKGNLHAAGWSRLHSFAIGLPNAPDL 300
             IA+IAARETE+AN++LDPV YD E+KHLAG+D +GNLH  GWSRLHSFAIGLP APDL
Sbjct: 241 SLIASIAARETERANEELDPVNYDSEEKHLAGIDAQGNLHTGGWSRLHSFAIGLPGAPDL 300

Query: 301 QAARKVAKFISSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
            AARKVAKFI S+HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 LAARKVAKFIGSLHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSA EF  E   RVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAKEFQAECASRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDRDFLDVCMNIDPAEKMINQSEGRIEKYILRKAFDTTDEPDVKPYLPEEILWRQKE 480
           VPFLDRDFL++CM +DP EKMI   EGRIEKYILRKAFDTTDEP+VKPYLPE+ILWRQKE
Sbjct: 421 VPFLDRDFLNLCMELDPNEKMIKPEEGRIEKYILRKAFDTTDEPNVKPYLPEDILWRQKE 480

Query: 481 QFSDGVGYSWIDGLKDAAEAAISDEQFAQPKPEWGDDIPTTKEAYWYRLKFDALFPQKTA 540
           QFSDGVGYSWIDGLKDAAE AISDE  A P+PEWGDD PTTKEAYWYRLKFD  FP K+A
Sbjct: 481 QFSDGVGYSWIDGLKDAAEEAISDEMLATPRPEWGDDQPTTKEAYWYRLKFDKFFP-KSA 539

Query: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHEQHIQN 573
           A+TVMRWIPKADWGC  DPSGR+AKIHEQHI N
Sbjct: 540 ANTVMRWIPKADWGCHGDPSGRFAKIHEQHIDN 572

>Skud_7.435 Chr7 (719202..720920) [1719 bp, 572 aa] {ON} YGR124W
           (REAL)
          Length = 572

 Score =  974 bits (2519), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 461/572 (80%), Positives = 500/572 (87%), Gaps = 1/572 (0%)

Query: 1   MCGIFACYKHESVQEFKPKALQLSKRIRHRGPDWSGNVVKNTTILAHERLAIVGLDSGAQ 60
           MCGIFA +KHE +  FKPKALQLSKRIRHRGPDWSGN V N+TI  HERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAFKHEDINSFKPKALQLSKRIRHRGPDWSGNAVMNSTIFVHERLAIVGLDSGAQ 60

Query: 61  PITSEDGDYTLCVNGEIYNHIKLREELTSYPFKTLSDCEPIIPLYQKYDIDTPKYLDGMF 120
           PI S DG+Y L VNGEIYNHI+LRE+ + Y F+T SDCEPIIPLY ++DID PK+LDGMF
Sbjct: 61  PIASADGEYMLGVNGEIYNHIQLREKCSGYKFQTFSDCEPIIPLYLEHDIDAPKHLDGMF 120

Query: 121 AWCLYDAKKDRIIAARDPIGITTLYMGRXXXXXXTVFFASELKCLVDDCDEITAFPPGHV 180
           A+CLYDAKKDR++AARDPIG+ TLYMGR      TV+FASELKCL D CD I +FPPGHV
Sbjct: 121 AFCLYDAKKDRVVAARDPIGVVTLYMGRSSKSPKTVYFASELKCLTDVCDSIISFPPGHV 180

Query: 181 YDSATDKITRYYTPDWLDEERIPKTPLDYKLIRNSLESAVRKRLMAEVPYXXXXXXXXXX 240
           YDS TDKITRY+TP+WLDE+RIP  P+DY  IR+SLE AVRKRLMAEVPY          
Sbjct: 181 YDSETDKITRYFTPNWLDEKRIPSVPVDYHAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIAAIAARETEKANKDLDPVAYDDEDKHLAGVDDKGNLHAAGWSRLHSFAIGLPNAPDL 300
             IAAIAARETEKAN D D  A  + +K LAG+DD+G+LH +GWSRLHSFA+GLPNAPDL
Sbjct: 241 SLIAAIAARETEKANADADGDASVN-NKQLAGIDDQGHLHTSGWSRLHSFAVGLPNAPDL 299

Query: 301 QAARKVAKFISSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
           QAARKVAKFI SIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 300 QAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 359

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANKSTMAWGLEAR 420
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFH ESV+RVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 360 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 419

Query: 421 VPFLDRDFLDVCMNIDPAEKMINQSEGRIEKYILRKAFDTTDEPDVKPYLPEEILWRQKE 480
           VPFLDRDFL +CMNIDP +KMIN  EGRIEKYILRKAFDTTDEP+VKPYLPEEILWRQKE
Sbjct: 420 VPFLDRDFLQLCMNIDPKDKMINPKEGRIEKYILRKAFDTTDEPEVKPYLPEEILWRQKE 479

Query: 481 QFSDGVGYSWIDGLKDAAEAAISDEQFAQPKPEWGDDIPTTKEAYWYRLKFDALFPQKTA 540
           QFSDGVGYSWIDGL+D AE  ISD  FA PK +WG+DIPTTKEAYWYRLKFDA FPQKTA
Sbjct: 480 QFSDGVGYSWIDGLRDTAERVISDTMFANPKADWGNDIPTTKEAYWYRLKFDAWFPQKTA 539

Query: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHEQHIQ 572
           A TVMRW+PKADWGCAEDPSGRYAKIHE+H+ 
Sbjct: 540 ADTVMRWVPKADWGCAEDPSGRYAKIHEKHVS 571

>Ecym_1244 Chr1 complement(501719..503440) [1722 bp, 573 aa] {ON}
           similar to Ashbya gossypii AFR303W
          Length = 573

 Score =  966 bits (2497), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 451/572 (78%), Positives = 503/572 (87%)

Query: 1   MCGIFACYKHESVQEFKPKALQLSKRIRHRGPDWSGNVVKNTTILAHERLAIVGLDSGAQ 60
           MCGIFACY+ + ++ FKP ALQLSKRIRHRGPDWSGNVVKN TI  HERLAIVGLD+GAQ
Sbjct: 1   MCGIFACYRRDGIESFKPVALQLSKRIRHRGPDWSGNVVKNDTIFVHERLAIVGLDTGAQ 60

Query: 61  PITSEDGDYTLCVNGEIYNHIKLREELTSYPFKTLSDCEPIIPLYQKYDIDTPKYLDGMF 120
           PI S+DG+Y LCVNGEIYNHI LR+    YPF TLSDCEPIIPL++KY ++TP YLDGMF
Sbjct: 61  PIVSDDGNYVLCVNGEIYNHIHLRDICADYPFSTLSDCEPIIPLFKKYGVETPNYLDGMF 120

Query: 121 AWCLYDAKKDRIIAARDPIGITTLYMGRXXXXXXTVFFASELKCLVDDCDEITAFPPGHV 180
           AWCLYDAK DRI+AARDPIG+TTLYMG+      T +FASELKCLV++CDEI +FPPGHV
Sbjct: 121 AWCLYDAKDDRIVAARDPIGVTTLYMGKCSKSPRTRYFASELKCLVEECDEIISFPPGHV 180

Query: 181 YDSATDKITRYYTPDWLDEERIPKTPLDYKLIRNSLESAVRKRLMAEVPYXXXXXXXXXX 240
           YDS TD+ITRY+ P WL +   P  P+DYK +R  LE AVRKRLM EVPY          
Sbjct: 181 YDSDTDQITRYFKPSWLVDSITPTKPVDYKKLRGGLEKAVRKRLMTEVPYGVLLSGGLDS 240

Query: 241 XXIAAIAARETEKANKDLDPVAYDDEDKHLAGVDDKGNLHAAGWSRLHSFAIGLPNAPDL 300
             IAAIAARETEKANK++D V YD + ++L GVDD+ +LHA+GWS+LHSFAIGLPNAPDL
Sbjct: 241 SLIAAIAARETEKANKEMDVVKYDSQVRNLVGVDDELHLHASGWSKLHSFAIGLPNAPDL 300

Query: 301 QAARKVAKFISSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360
           QAARKVAKFI SIHHEHTFT+QEGLDALDDVI+HLET+DVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 QAARKVAKFIGSIHHEHTFTIQEGLDALDDVIHHLETFDVTTIRASTPMFLLSRKIKAQG 360

Query: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANKSTMAWGLEAR 420
           +KMVLSGEGSDEIFGGYLYFAQAPSA +FH ESV+RVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 IKMVLSGEGSDEIFGGYLYFAQAPSAKDFHNESVERVKNLHLADCLRANKSTMAWGLEAR 420

Query: 421 VPFLDRDFLDVCMNIDPAEKMINQSEGRIEKYILRKAFDTTDEPDVKPYLPEEILWRQKE 480
           VPFLDRDFL++CMNIDP EKMI   EG+IEKYILRKAFDT+DEPDV+PYLP+EILWRQKE
Sbjct: 421 VPFLDRDFLELCMNIDPEEKMIKPKEGKIEKYILRKAFDTSDEPDVEPYLPQEILWRQKE 480

Query: 481 QFSDGVGYSWIDGLKDAAEAAISDEQFAQPKPEWGDDIPTTKEAYWYRLKFDALFPQKTA 540
           QFSDGVGYSWID LKDAAE AISDEQFAQPKPEWGDDIP+TKEAYWYR+KFDALFPQ TA
Sbjct: 481 QFSDGVGYSWIDALKDAAENAISDEQFAQPKPEWGDDIPSTKEAYWYRMKFDALFPQPTA 540

Query: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHEQHIQ 572
           ASTVMRW+PKA+WGC+EDPSGR+AKIHE+HI 
Sbjct: 541 ASTVMRWVPKAEWGCSEDPSGRFAKIHEKHIS 572

>TBLA0C04430 Chr3 (1072027..1073769) [1743 bp, 580 aa] {ON}
           Anc_3.483 YPR145W
          Length = 580

 Score =  948 bits (2451), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 453/578 (78%), Positives = 489/578 (84%), Gaps = 7/578 (1%)

Query: 1   MCGIFACYKHESVQEFKPKALQLSKRIRHRGPDWSGNVVKNTTILAHERLAIVGLDSGAQ 60
           MCGIFA YKH  V  FKP+ALQL+KRIRHRGPDWSGNVVKNTT+ AHERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAYKHPEVNAFKPRALQLTKRIRHRGPDWSGNVVKNTTLFAHERLAIVGLDSGAQ 60

Query: 61  PITSEDGDYTLCVNGEIYNHIKLREELTSYPFKTLSDCEPIIPLYQKYDIDTPKYLDGMF 120
           PITS  G+Y L VNGEIYNHI+LREE T Y +KTL DCEPIIP+Y KYD+D P +LDGMF
Sbjct: 61  PITSPCGNYMLTVNGEIYNHIQLREETTDYKYKTLGDCEPIIPMYLKYDVDAPNHLDGMF 120

Query: 121 AWCLYDAKKDRIIAARDPIGITTLYMGRXXXXXXTVFFASELKCLVDDCDEITAFPPGHV 180
           A+ LYD++KDR+IAARDP+GITTLYMGR      TV+FASELKCLVDDCD I AFPPGHV
Sbjct: 121 AFVLYDSQKDRVIAARDPVGITTLYMGRNSKTPKTVYFASELKCLVDDCDSIIAFPPGHV 180

Query: 181 YDSATDKITRYYTPDWLDEERIPKTPLDYKLIRNSLESAVRKRLMAEVPYXXXXXXXXXX 240
           YDS TDKI RY+ P+W+DE  IP TP+D K +R +LE AVRKRLMAEVPY          
Sbjct: 181 YDSETDKIERYFKPNWIDESIIPTTPVDLKQVRETLERAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIAAIAARETEKANKDLDPVAYD-------DEDKHLAGVDDKGNLHAAGWSRLHSFAIG 293
             IA+IAARETEK   + + + Y+       D  K L G+DD GNL    WS+LHSFAIG
Sbjct: 241 SLIASIAARETEKVMDETNTIDYEKQSDDAADASKKLTGLDDSGNLQTQSWSKLHSFAIG 300

Query: 294 LPNAPDLQAARKVAKFISSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLS 353
           LP APDL+AARKVA FI SIHHEH FT+QEGLDALDDVIYHLETYDVTTIRASTPMFLLS
Sbjct: 301 LPGAPDLKAARKVANFIGSIHHEHNFTIQEGLDALDDVIYHLETYDVTTIRASTPMFLLS 360

Query: 354 RKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANKSTM 413
           RKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLAD LRANKSTM
Sbjct: 361 RKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADNLRANKSTM 420

Query: 414 AWGLEARVPFLDRDFLDVCMNIDPAEKMINQSEGRIEKYILRKAFDTTDEPDVKPYLPEE 473
           AWGLEARVPFLDRDFL++CMNIDP +KMI   EG+IEKY+LRKAFDT+DEPDVKPYLPEE
Sbjct: 421 AWGLEARVPFLDRDFLNLCMNIDPNDKMIKPKEGKIEKYLLRKAFDTSDEPDVKPYLPEE 480

Query: 474 ILWRQKEQFSDGVGYSWIDGLKDAAEAAISDEQFAQPKPEWGDDIPTTKEAYWYRLKFDA 533
           ILWRQKEQFSDGVGYSWID LKD AE  ISDE FA PK  WG DIPTTKEAYWYRLKFDA
Sbjct: 481 ILWRQKEQFSDGVGYSWIDSLKDTAERVISDEMFANPKDHWGSDIPTTKEAYWYRLKFDA 540

Query: 534 LFPQKTAASTVMRWIPKADWGCAEDPSGRYAKIHEQHI 571
           LFPQKTAA TVMRWIPKADWGCAEDPSGRYAKIHEQHI
Sbjct: 541 LFPQKTAADTVMRWIPKADWGCAEDPSGRYAKIHEQHI 578

>KNAG0J00200 Chr10 complement(24044..25591) [1548 bp, 515 aa] {ON}
           Anc_8.875 YML096W
          Length = 515

 Score = 66.2 bits (160), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 123/503 (24%), Positives = 189/503 (37%), Gaps = 93/503 (18%)

Query: 1   MCGIFAC------YKHESVQEFK-------PKALQLSKR--------IRHRGPD---WSG 36
           MCGI  C      +  E V EF        P  L    R        I  RGP+   W G
Sbjct: 1   MCGILLCRDPGRQFNDEHV-EFAEAQPIEIPGGLDAQARWIASTLPCIAARGPNFASWRG 59

Query: 37  NVVKNTTILAHERLAIVGLDSGAQPITSE----DGDYTLCVNGEIYN-HIKLREELTSYP 91
           +   +T   +    +++ L    QP T +    DG Y L  NGE+YN  I+  +  T Y 
Sbjct: 60  SAEYSTAWFS----SVLSL---RQPFTKQSLVVDGRYVLQFNGELYNDEIEFND--TQYI 110

Query: 92  FKTLSDCEPIIPLYQKYDIDTPKYLDGMFAWCLYDAKKDRIIAARDPIGITTLYMGRXXX 151
              L+  E  IP       D    LDG FA+ +YD +  +    RD IG  +L       
Sbjct: 111 ADMLARGEASIP-------DIIARLDGEFAYTIYDTEDQKYYFGRDAIGKRSL--SYYVN 161

Query: 152 XXXTVFFASELKCLVDDC---DEITAFPPGHVYDSA------TDKITRYYTPDWLDEERI 202
                 + S +   V+D    D I      ++YD+       ++ I+  YT   L +E  
Sbjct: 162 TSKDQLYVSSVTGRVEDIEFRDCIAGII--YIYDAKNQHLDDSNHISDPYTVSPLVDENF 219

Query: 203 PKTPLDYKLIRNSLESAVRKRLMAEVPYXXXXXXXXX--------XXXIAAIAARETEKA 254
            +     + +   L  AV KR+ +  P                     +A I  + + KA
Sbjct: 220 TERGEHIEKLHFQLNLAVEKRINSIHPNHIENSPISVLFSGGLDCSVIVALICNQLSGKA 279

Query: 255 NKDLDP------------VAYDDEDKHLAGVDDKGNLHAAGWSRLHSFAIGLPNAPDLQA 302
            K ++             V  D  D+ LA    K   H      +    I +P    L+A
Sbjct: 280 RKTVELLNVGFENPRTGLVPSDSPDRKLAIESYKTLQHLYPDIDIRLIEIDVPYEEYLRA 339

Query: 303 ARKVAKFISSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQGVK 362
             KV   +        F  Q  +D    + ++  +    +I   +       KI  Q   
Sbjct: 340 KPKVIDLM--------FPKQTEMDLSIAIAFYFASKGEGSITDKST----KGKIAYQRKG 387

Query: 363 MVL-SGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANKSTMAWGLEARV 421
           +VL SG G+DE++GGY  FA   S  +  +E  +++ N+H  +  R +K   + G+E R 
Sbjct: 388 IVLFSGLGADELYGGYHKFANK-SFPDLQIELTRQINNIHDRNLNRDDKVIASNGVEIRY 446

Query: 422 PFLDRDFLDVCMNIDPAEKMINQ 444
           PFLD   +       P    IN+
Sbjct: 447 PFLDSSVVKFSTEDLPINYKINK 469

>ZYRO0A00528g Chr1 (35425..36963) [1539 bp, 512 aa] {ON} similar to
           uniprot|Q04489 Saccharomyces cerevisiae YML096W
           Hypothetical ORF
          Length = 512

 Score = 57.8 bits (138), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 37/103 (35%), Positives = 56/103 (54%), Gaps = 9/103 (8%)

Query: 354 RKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANKSTM 413
           +K + QG+ ++ SG G+DE++GGY  FA+  S  E   E  +++ N++  +  R +K   
Sbjct: 378 KKYQRQGI-VLFSGLGADELYGGYYKFAR-KSTDELVEELTRQINNIYNRNLNRDDKVIA 435

Query: 414 AWGLEARVPFLDRDFLDVCMNIDPAEKMINQSEGRIEKYILRK 456
           A G+E R PFLDR  ++  M   P    IN       K ILRK
Sbjct: 436 ANGVEVRYPFLDRHVIEFSMQSIPINWKIN-------KLILRK 471

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 42/83 (50%), Gaps = 9/83 (10%)

Query: 63  TSEDGD-YTLCVNGEIYNHIKLREELTSYPFKTLSDCEPIIPLYQKYDIDTPKYLDGMFA 121
           + E GD Y L  NGE+YN  ++ +  TS+    L + +  +        +   +L+G FA
Sbjct: 81  SVEVGDRYILQFNGELYNE-EILDNDTSFVASLLENDKMSV-------FEVISFLEGEFA 132

Query: 122 WCLYDAKKDRIIAARDPIGITTL 144
           + +YD  + ++   RD IG  +L
Sbjct: 133 YTIYDMHEHKLYFGRDDIGKRSL 155

>Kpol_455.7 s455 complement(6566..8122) [1557 bp, 518 aa] {ON}
           complement(6566..8122) [1557 nt, 519 aa]
          Length = 518

 Score = 53.5 bits (127), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 35/105 (33%), Positives = 54/105 (51%), Gaps = 7/105 (6%)

Query: 363 MVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANKSTMAWGLEARVP 422
           ++ SG G+DE++GGY  FA   S  E  VE  +++ N+H  +  R +K     G+E R P
Sbjct: 391 VLFSGLGADELYGGYHSFANK-SIEELTVELTRQINNIHDRNLNRDDKVIADNGVEVRYP 449

Query: 423 FLDRDFLDVCMNIDPAEKMINQSEGR---IEKYILRKAFDTTDEP 464
           FLD + +   ++  P    +N+   R   +EK  LR   D   EP
Sbjct: 450 FLDEEVIQYSVSQIPISYKVNKGILRKLALEKLQLR---DIAQEP 491

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 39/123 (31%), Positives = 54/123 (43%), Gaps = 18/123 (14%)

Query: 27  IRHRGPDWSGNVVKNTTILAHERLAIVGLDSGAQPITSE----DGDYTLCVNGEIYNHIK 82
           I  RGP++S   V       H       + S  QP T +    D  Y L  NGE+YN  +
Sbjct: 50  IVSRGPNYSSLRVNR----EHGISWFSSILSLRQPFTRQSIVVDERYVLQFNGELYNS-E 104

Query: 83  LREELTSYPFKTLSDCEP-IIPLYQKYDIDTPKYLDGMFAWCLYDAKKDRIIAARDPIGI 141
           +    T Y    L  C+  ++ L +K        LDG FA+ +YD K+  I   RD IG 
Sbjct: 105 ISGNDTQYIVSLLKSCDGDVVSLVRK--------LDGGFAYTIYDLKEGNIYFGRDTIGK 156

Query: 142 TTL 144
            +L
Sbjct: 157 RSL 159

>TPHA0C04950 Chr3 complement(1067043..1068620) [1578 bp, 525 aa]
           {ON} Anc_8.875 YML096W
          Length = 525

 Score = 50.8 bits (120), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 53/99 (53%), Gaps = 9/99 (9%)

Query: 357 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANKSTMAWG 416
           K +G+ ++ SG G+DE++GGY  FA   S  E   E  K++ N+H  +  R +K +   G
Sbjct: 388 KRKGI-VLFSGLGADELYGGYHKFANK-SREELVEELTKQINNIHDRNLNRDDKVSADNG 445

Query: 417 LEARVPFLDRDFLDVCMNIDPAEKMINQSEGRIEKYILR 455
           +E R PFLD    +  +N    E  IN    +I K ILR
Sbjct: 446 IEVRYPFLD----EYVVNFSTKEIPINY---KINKKILR 477

 Score = 37.4 bits (85), Expect = 0.098,   Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 54/119 (45%), Gaps = 7/119 (5%)

Query: 27  IRHRGPDWSG-NVVKNTTILAHERLAIVGLDSGAQPITSEDGDYTLCVNGEIYNHIKLRE 85
           I  RGP++    V K+  I  +  +  +      Q I   D  Y L  NGE+YN+     
Sbjct: 47  IARRGPNYQMFRVFKSEQISWYSSILSLRKPFTKQSIEVND-RYILQFNGELYNNEIHGI 105

Query: 86  ELTSYPFKTLSDCEPIIPLYQKYDIDTPKYLDGMFAWCLYDAKKDRIIAARDPIGITTL 144
             T+Y    L        L +K  I+  + L+G FA+ ++D+KK  +   RD IG  +L
Sbjct: 106 SDTTYFVNCLKTA-----LDEKDIINILRTLEGEFAYTIFDSKKKLVYFGRDTIGKRSL 159

>Skud_13.46 Chr13 (79277..80836) [1560 bp, 519 aa] {ON} YML096W
           (REAL)
          Length = 519

 Score = 50.8 bits (120), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 35/101 (34%), Positives = 55/101 (54%), Gaps = 9/101 (8%)

Query: 357 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANKSTMAWG 416
           + QGV ++LSG G+DE++GGY  FA   +  E   E  +++ N++  +  R +K     G
Sbjct: 388 QRQGV-VLLSGLGADELYGGYHKFANK-AHHELVKELTRQINNIYERNLNRDDKVIAHNG 445

Query: 417 LEARVPFLDRDFLDVCMNIDPAEKMINQSEGRIEKYILRKA 457
           +E R PFLD    +  +N+   E  IN    ++ K ILRK 
Sbjct: 446 VEVRYPFLD----EYVINLSTLEIPINY---KVNKLILRKV 479

 Score = 40.4 bits (93), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 36/123 (29%), Positives = 57/123 (46%), Gaps = 14/123 (11%)

Query: 27  IRHRGPDWSGNVVKNTTILAHERLAIVGLDSGAQPITSE----DGDYTLCVNGEIYNHIK 82
           I  RGP++S   V    I AH+      + S  +P T +    D  Y L  NGE+YN   
Sbjct: 47  IAARGPNYSSLRV----IKAHQTRWFSSVLSLRRPFTKQSINVDDRYHLQFNGELYN--- 99

Query: 83  LREELTSYPFKTLSDCEPIIPLYQKYDI-DTPKYLDGMFAWCLYDAKKDRIIAARDPIGI 141
             +E++ +   +L     +  L    ++ D  + L+G +A+ +YD K       RDPIG 
Sbjct: 100 --KEISDWDNDSLYIASLLRNLEDGRNVVDVIRSLEGEYAYTVYDVKSSIFYFGRDPIGK 157

Query: 142 TTL 144
            +L
Sbjct: 158 RSL 160

>ADL350C Chr4 complement(90152..91678) [1527 bp, 508 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YML096W
          Length = 508

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 49/94 (52%), Gaps = 9/94 (9%)

Query: 363 MVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANKSTMAWGLEARVP 422
           ++ +G G+DE++GGY  FA   S  E  VE  +++ N+H  +  R +K     G+EAR P
Sbjct: 382 VLFNGLGADELYGGYHKFANK-STEELVVELTRQINNIHDRNLNRDDKVLACHGVEARYP 440

Query: 423 FLDRDFLDVCMNIDPAEKMINQSEGRIEKYILRK 456
           FLD   +   + +  + K         +K ILRK
Sbjct: 441 FLDEKVIKASVALPISYKN--------DKMILRK 466

>NDAI0K00180 Chr11 (27899..29467) [1569 bp, 522 aa] {ON} Anc_8.875
           YML096W
          Length = 522

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 46/94 (48%), Gaps = 8/94 (8%)

Query: 363 MVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANKSTMAWGLEARVP 422
           ++ SG G+DE++GGY  FA   S  E   E  K++ N++  +  R +K     G+E R P
Sbjct: 396 VLFSGLGADELYGGYHKFANK-STEELVKELTKQINNIYDRNLNRDDKVIAHNGVEVRYP 454

Query: 423 FLDRDFLDVCMNIDPAEKMINQSEGRIEKYILRK 456
           FLD D +       P    IN       K ILRK
Sbjct: 455 FLDIDVIKFSTEELPINYKIN-------KLILRK 481

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 53/209 (25%), Positives = 92/209 (44%), Gaps = 17/209 (8%)

Query: 27  IRHRGPDWSG-NVVKNTTILAHERLAIVGLDSGAQPITSEDGDYTLCVNGEIYNHIKLRE 85
           I  RGP++S   V K  +I     +  +      Q +  +D  Y +  NGE+YN  +++ 
Sbjct: 49  IAARGPNYSSFKVSKQYSITWFSSVLSLREPFTKQCVEIKD-RYVVQFNGELYND-EIQY 106

Query: 86  ELTSYPFKTLSDCEPIIPLYQKYDIDTPKYLDGMFAWCLYDAKKDRIIAARDPIGITTLY 145
             T Y  + L + + II + +K        LDG FA+ +YD +       RDPIG   L 
Sbjct: 107 NDTQYTIQLLKEGKEIIDVIRK--------LDGEFAYTIYDIQNRMFYFGRDPIGRRCLS 158

Query: 146 MGRXXXXXXTVFFASELKCLV--DDCDEITAFP-PGHVYDSATD-KITR-YYTPDWLDEE 200
                     ++ +S   C     DC   T +     + +  TD KI++ +Y  + LD+E
Sbjct: 159 FS-IDNETGELYISSVTGCKTGFQDCIAGTIYKYDCQLKELNTDSKISKPFYVSEELDDE 217

Query: 201 RIPKTPLDYKLIRNSLESAVRKRLMAEVP 229
            +     + + +   L  +V KR+++  P
Sbjct: 218 NLSHLDDNVEKLYTHLLDSVSKRVVSIHP 246

>KAFR0L02110 Chr12 complement(400443..401987) [1545 bp, 514 aa] {ON}
           Anc_8.875 YML096W
          Length = 514

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 30/95 (31%), Positives = 45/95 (47%), Gaps = 8/95 (8%)

Query: 363 MVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANKSTMAWGLEARVP 422
           ++ SG G+DE++GGY  F    S  E   E   ++ N+H  +  R +K   + G+E R P
Sbjct: 388 VLFSGLGADELYGGYHKFVNR-SLEELSAELTGQINNIHDRNLNRDDKVIASNGVEVRYP 446

Query: 423 FLDRDFLDVCMNIDPAEKMINQSEGRIEKYILRKA 457
           FLD + +       P    +N       K ILRK 
Sbjct: 447 FLDHNVVQFSTQEIPINYKVN-------KLILRKV 474

 Score = 40.8 bits (94), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 37/120 (30%), Positives = 54/120 (45%), Gaps = 11/120 (9%)

Query: 27  IRHRGPDWSGNVVKNTTILA-HERLAIVGLDSGAQPITSEDGDYTLCVNGEIYN-HIKLR 84
           I +RGP++S   +      A    +  + L    Q +  ED  Y L  NGE+YN  IK  
Sbjct: 46  IANRGPNYSSLRLSEKYHTAWFSSVLALRLPFTKQSLCVED-RYVLQFNGELYNKEIKQD 104

Query: 85  EELTSYPFKTLSDCEPIIPLYQKYDIDTPKYLDGMFAWCLYDAKKDRIIAARDPIGITTL 144
           +  T +    LS    +I         T   LDG FA+ +YD ++ +I   RD IG  +L
Sbjct: 105 QNDTQFIASLLSSSTDVI--------HTLTQLDGEFAYTIYDLRETKIYFGRDSIGKRSL 156

>YML096W Chr13 (79909..81486) [1578 bp, 525 aa] {ON} Putative
           protein of unknown function with similarity to
           asparagine synthetases; green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm; YML096W
           is not an essential gene and partially overlaps the
           verified gene RAD10
          Length = 525

 Score = 48.5 bits (114), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 32/95 (33%), Positives = 50/95 (52%), Gaps = 8/95 (8%)

Query: 363 MVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANKSTMAWGLEARVP 422
           ++ SG G+DE++GGY  FA  P   E   E  +++ N++  +  R +K     G+E R P
Sbjct: 393 VLFSGLGADELYGGYHKFANKP-PHELVEELTRQINNIYDRNLNRDDKVIAHNGVEVRYP 451

Query: 423 FLDRDFLDVCMNIDPAEKMINQSEGRIEKYILRKA 457
           FLD    +  + +  AE  IN    ++ K ILRK 
Sbjct: 452 FLD----EYVIKLSTAEIPIN---FKVNKLILRKV 479

 Score = 38.9 bits (89), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 35/123 (28%), Positives = 55/123 (44%), Gaps = 14/123 (11%)

Query: 27  IRHRGPDWSGNVVKNTTILAHERLAIVGLDSGAQPITSE----DGDYTLCVNGEIYN-HI 81
           I  RGP++S        + A+       + S  QP T +    D  Y L  NGE+YN  I
Sbjct: 47  IAARGPNYSSL----RAVKAYRISWFSSVLSLRQPFTKQSINVDDRYFLQFNGELYNKEI 102

Query: 82  KLREELTSYPFKTLSDCEPIIPLYQKYDIDTPKYLDGMFAWCLYDAKKDRIIAARDPIGI 141
              +  + Y    L + +  + +     ID  K L+G +A+ +YD    ++   RDPIG 
Sbjct: 103 SQGDNDSLYIASMLQNLKEGMGV-----IDVIKSLEGEYAYTIYDVNSSKLYFGRDPIGR 157

Query: 142 TTL 144
            +L
Sbjct: 158 RSL 160

>TDEL0B00440 Chr2 complement(78116..79666) [1551 bp, 516 aa] {ON}
           Anc_8.875 YML096W
          Length = 516

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 30/94 (31%), Positives = 46/94 (48%), Gaps = 8/94 (8%)

Query: 363 MVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANKSTMAWGLEARVP 422
           ++ SG G+DE++GGY   A   S +E   E  +++ N+H  +  R +K     G+E R P
Sbjct: 390 VLFSGLGADELYGGYHKLANK-SPSELKEELTRQINNIHDRNLNRDDKVIADNGVEVRYP 448

Query: 423 FLDRDFLDVCMNIDPAEKMINQSEGRIEKYILRK 456
           FLD D +       P    +N       K ILR+
Sbjct: 449 FLDHDVIKFSTEEIPINYKVN-------KMILRR 475

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 66/265 (24%), Positives = 110/265 (41%), Gaps = 55/265 (20%)

Query: 1   MCGIFA----------CYKHESVQEFKPKALQLSKR----------IRHRGPDWSGNVVK 40
           MCGI            C+  E V++      Q SK           I+ RGPD+S   V 
Sbjct: 1   MCGILLHYAPLKSDNHCFVDEYVEDIADGHSQRSKTTAFFDSMVPYIKSRGPDYSSLRVS 60

Query: 41  NTTILAHERLAIVGLDSGAQPITSED----GDYTLCVNGEIYNHIKLREELTSYPFKTLS 96
           +     H       + S  +P TS+       + L  NGE+YN     +E+T++     +
Sbjct: 61  S----EHSTAWYSSVLSLREPFTSQSVKVGNRFILQFNGELYN-----QEITAHD----N 107

Query: 97  DCEPIIPLYQK--YDI-DTPKYLDGMFAWCLYDAKKDRIIAARDPIGITTLYMGRXXXXX 153
           D + I+   Q+  +D+    + L G FA+ LYD ++ +    RD +G  +L         
Sbjct: 108 DTQFIVSKLQEGYHDVCQIIRQLSGEFAYTLYDLQQRKFYYGRDNVGKRSLSY-HLSAIT 166

Query: 154 XTVFFASELKCLVDDCDEITAFPPGHVYDSATDKI-------TRYYTPDWLDEERIPKTP 206
             ++ +S    +    D I      +VYD+ +  +       ++Y+    LDEE    T 
Sbjct: 167 GELYISSVSGAIPGFKDCIAGVV--YVYDTESKTLDDSIKLESQYFITKKLDEEL---TC 221

Query: 207 LDYKL--IRNSLESAVRKRLMAEVP 229
           LD  +  +   L  AVRKR+++  P
Sbjct: 222 LDSTVEQLYGMLSLAVRKRVLSIHP 246

>TBLA0C06300 Chr3 (1523556..1525112) [1557 bp, 518 aa] {ON}
           Anc_8.875 YML096W
          Length = 518

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 51/166 (30%), Positives = 69/166 (41%), Gaps = 28/166 (16%)

Query: 1   MCGIFAC--------YKHESVQEFK---PKAL----------QLSKRIRHRGPDW-SGNV 38
           MCGI           +     +EFK   P AL           L K I  RGP++ S   
Sbjct: 1   MCGILLNISPNDNLKFFQNEYKEFKENCPDALLNSNNDYTFSNLMKLISARGPNFASLRT 60

Query: 39  VKNTTILAHERLAIVGLDSGAQPITSEDGDYTLCVNGEIYNHIKLREELTSYPFKTLSDC 98
           +K+  I     +  +      Q +  ED  Y L  NGE+YN   +  + T +  K L + 
Sbjct: 61  LKDHRISLFSSVLSLREPFCKQSVLVED-RYVLQFNGELYNDEIIHND-TQFIVKLLLNT 118

Query: 99  EPIIPLYQKYDIDTPKYLDGMFAWCLYDAKKDRIIAARDPIGITTL 144
           E       K  I   K LDG FA+ +YD K  R+   RDPIG  +L
Sbjct: 119 EQ----NSKGIISVIKNLDGEFAFSIYDLKNKRLYFGRDPIGKRSL 160

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 30/94 (31%), Positives = 45/94 (47%), Gaps = 8/94 (8%)

Query: 363 MVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANKSTMAWGLEARVP 422
           ++ SG G+DE++GGY  F    +  E   E  +++ N+H  +  R +K     G+E R P
Sbjct: 392 VLFSGLGADELYGGYHKFVNK-TPRELVEELTRQINNIHDRNLNRDDKVIANNGVEVRYP 450

Query: 423 FLDRDFLDVCMNIDPAEKMINQSEGRIEKYILRK 456
           FLD   +    +  P    IN       K ILRK
Sbjct: 451 FLDEHVIKYSTHDIPINYKIN-------KLILRK 477

>KLLA0D10285g Chr4 (869754..871301) [1548 bp, 515 aa] {ON} similar
           to uniprot|Q04489 Saccharomyces cerevisiae YML096W
           Hypothetical ORF
          Length = 515

 Score = 47.8 bits (112), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 36/113 (31%), Positives = 58/113 (51%), Gaps = 5/113 (4%)

Query: 353 SRKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANKST 412
           S+     G+ M  SG G+DE++GGY  F+   S  E  +E  K++  +H  +  R +K  
Sbjct: 381 SKPYNRSGIVM-FSGLGADELYGGYHKFSNK-SNEELVIELQKQIAQIHDRNLNRDDKVI 438

Query: 413 MAWGLEARVPFLDRDFLDVCMNIDPAEKMINQSEGRI-EKYILRKAFDTTDEP 464
              G+E R PFLD   +   +++ P    +N+   R+  K ILR  F  ++EP
Sbjct: 439 SNHGIEVRYPFLDERVVQFSVDL-PLNYKVNKHILRVMAKDILRLDF-ISEEP 489

>NCAS0C00190 Chr3 complement(17177..18730) [1554 bp, 517 aa] {ON}
           Anc_8.875
          Length = 517

 Score = 47.8 bits (112), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 31/105 (29%), Positives = 53/105 (50%), Gaps = 9/105 (8%)

Query: 352 LSRKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANKS 411
           +  K + +G+ ++ SG G+DE++GGY  FA   S  +  +E  +++ N++  +  R +K 
Sbjct: 380 IKEKYQRKGI-VLFSGLGADELYGGYHKFANK-SPDDLAIELTRQINNIYDRNLNRDDKV 437

Query: 412 TMAWGLEARVPFLDRDFLDVCMNIDPAEKMINQSEGRIEKYILRK 456
               G+E R PFLD + +       P    +N       K ILRK
Sbjct: 438 IANNGVEVRYPFLDEEVIKFSTMEIPINYKVN-------KMILRK 475

 Score = 40.4 bits (93), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 36/122 (29%), Positives = 51/122 (41%), Gaps = 16/122 (13%)

Query: 27  IRHRGPDWSGNVVKNTTILAHERLAIVGLDSGAQPITSEDGD----YTLCVNGEIYNHIK 82
           I  RGP++S   V      A     +    S  QP T +  +    Y L  NGE+YNH  
Sbjct: 48  ISARGPNYSSLRVSKKYKTAWYSSVL----SLRQPFTCQSIEIEERYVLQFNGELYNHEI 103

Query: 83  LREELTSYPFKTLSDCEPIIPLYQKYDIDTPKYLDGMFAWCLYDAKKDRIIAARDPIGIT 142
           +  + T Y    L +  P IP          K L+G FA+ +YD +       RD +G  
Sbjct: 104 VHND-TQYIVGLLKESAPSIPA-------IIKKLNGEFAYSIYDIQNGTFYFGRDTVGKR 155

Query: 143 TL 144
           +L
Sbjct: 156 SL 157

>Smik_13.39 Chr13 (77004..78569) [1566 bp, 521 aa] {ON} YML096W
           (REAL)
          Length = 521

 Score = 47.8 bits (112), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 51/96 (53%), Gaps = 10/96 (10%)

Query: 363 MVLSGEGSDEIFGGYLYFA-QAPSAAEFHVESVKRVKNLHLADCLRANKSTMAWGLEARV 421
           ++LSG G+DE++GGY  FA +AP   E   E  K++ N++  +  R +K     G+E R 
Sbjct: 393 VLLSGLGADELYGGYHKFANKAPH--ELVEELTKQINNIYERNLNRDDKVIAHNGVEVRY 450

Query: 422 PFLDRDFLDVCMNIDPAEKMINQSEGRIEKYILRKA 457
           PFLD    +  +     E  IN    ++ K ILRK 
Sbjct: 451 PFLD----EYVIKFSTVEIPINY---KVNKLILRKV 479

 Score = 38.5 bits (88), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 53/123 (43%), Gaps = 14/123 (11%)

Query: 27  IRHRGPDWSGNVVKNTTILAHERLAIVGLDSGAQPITSE----DGDYTLCVNGEIYN-HI 81
           I  RGP++S       T+ A+       + S  +P T +    D  Y L  NGE+YN  +
Sbjct: 47  IAARGPNYSSL----RTVRAYRTSWFSSVLSLREPFTKQSINVDDRYYLQFNGELYNKEV 102

Query: 82  KLREELTSYPFKTLSDCEPIIPLYQKYDIDTPKYLDGMFAWCLYDAKKDRIIAARDPIGI 141
                 + Y    L D E          ID  K L+G +A+ +YD K  +    RDPIG 
Sbjct: 103 SHWGNDSLYIASLLKDLED-----DGSVIDVIKSLEGEYAYTVYDVKSAKFYFGRDPIGR 157

Query: 142 TTL 144
            +L
Sbjct: 158 RSL 160

>Suva_13.52 Chr13 (81009..82568) [1560 bp, 519 aa] {ON} YML096W
           (REAL)
          Length = 519

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 29/86 (33%), Positives = 44/86 (51%), Gaps = 2/86 (2%)

Query: 359 QGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANKSTMAWGLE 418
           QGV ++ SG G+DE++GGY  FA  P   E   E  +++ N++  +  R +K     G+E
Sbjct: 390 QGV-VLFSGLGADELYGGYHKFANKP-PHELVEELTRQINNIYERNLNRDDKVIAHNGVE 447

Query: 419 ARVPFLDRDFLDVCMNIDPAEKMINQ 444
            R PFLD   +       P    IN+
Sbjct: 448 VRYPFLDEHVIKFSAVDIPINFKINK 473

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 39/127 (30%), Positives = 57/127 (44%), Gaps = 22/127 (17%)

Query: 27  IRHRGPDWSGNVVKNTTILAHERLAIVGLDSGAQPIT----SEDGDYTLCVNGEIYNHIK 82
           I  RGP++S   V      A++      + S  QP T    S D  Y L  NGE+YN   
Sbjct: 47  IAARGPNYSSLRVSK----AYQTSWFSSVLSLRQPFTKQSISVDDRYYLQFNGELYN--- 99

Query: 83  LREELTSYPFKTLSDCEPIIPLYQKYD-----IDTPKYLDGMFAWCLYDAKKDRIIAARD 137
             +E++       +D + I  L Q        ID  + L+G +A+ +YD K  +    RD
Sbjct: 100 --KEISD----DDNDSQYIASLLQNLTGDGDVIDVIRMLEGEYAYTVYDVKASKFYFGRD 153

Query: 138 PIGITTL 144
           PIG  +L
Sbjct: 154 PIGRRSL 160

>Ecym_8155 Chr8 complement(324050..325591) [1542 bp, 513 aa] {ON}
           similar to Ashbya gossypii ADL350C
          Length = 513

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/112 (28%), Positives = 55/112 (49%), Gaps = 3/112 (2%)

Query: 354 RKIKAQGVKMVL-SGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANKST 412
           + I  Q   +VL SG G+DE++GGY  F    S      E  K++ N++  +  R +K  
Sbjct: 376 KTISYQRRSLVLFSGLGADELYGGYHKFNNK-SPELLIKELTKQINNIYDRNLDRDDKCM 434

Query: 413 MAWGLEARVPFLDRDFLDVCMNIDPAEKMINQSEGRIEKYILRKAFDTTDEP 464
              G+E R PFLD + +++  ++ P     N++  R+      +  D  +EP
Sbjct: 435 ACNGIEIRYPFLDEEVINLSTSL-PINYKTNKNILRLLATNKLQLMDIGEEP 485

>SAKL0D00352g Chr4 (31387..32934) [1548 bp, 515 aa] {ON} similar to
           uniprot|Q04489 Saccharomyces cerevisiae YML096W
           Hypothetical ORF
          Length = 515

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 38/67 (56%), Gaps = 2/67 (2%)

Query: 359 QGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANKSTMAWGLE 418
           +GV ++ SG G+DE++GGY   A   SA E       ++ N+H  +  R +K   + G+E
Sbjct: 387 KGV-VLFSGLGADELYGGYHKLANK-SAEELANALTLQINNIHDRNLNRDDKVIASNGVE 444

Query: 419 ARVPFLD 425
            R PFLD
Sbjct: 445 VRYPFLD 451

 Score = 35.0 bits (79), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 49/214 (22%), Positives = 93/214 (43%), Gaps = 36/214 (16%)

Query: 27  IRHRGPDWSGNVVKNTTILAHERLAIVGLDSGAQPITSE----DGDYTLCVNGEIYNHIK 82
           I +RGP+++   ++N++       +   + S   P+T +    +  + L  NGE+YN   
Sbjct: 49  IINRGPNYAS--IRNSSKYGISWFS--SILSLRDPLTRQSVKINDRFVLQYNGELYNS-S 103

Query: 83  LREELTSYPFKTLSDCEPIIPLYQKYDIDTPKY---LDGMFAWCLYDAKKDRIIAARDPI 139
           ++   T +          I  L ++Y  D PK    ++G FA+ ++D + +++   RD I
Sbjct: 104 IQHNDTLF----------IASLIERYQDDIPKAIREMEGEFAYTIFDKQCEKLYFGRDTI 153

Query: 140 GITTL-YMGRXXXXXXTVFFASELKCLVDDCDEITAFPPGHVYDSATDKI--------TR 190
           G  +L Y          +   S      +DC+  T +    +YDS T  +          
Sbjct: 154 GKRSLSYKFDSETSKLFISSVSGTSEGFEDCEGGTIY----IYDSKTGNLEDDLRIRDVP 209

Query: 191 YYTPDWLDEERIPKTPLDYKLIRNSLESAVRKRL 224
           Y     +DEE + +   + +L+ N L  AV +R+
Sbjct: 210 YTVSCSIDEE-MCQISENIELLFNELSEAVCRRV 242

>Kwal_27.9705 s27 (28837..30384) [1548 bp, 515 aa] {ON} YML096W -
           Hypothetical ORF [contig 336] FULL
          Length = 515

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 40/69 (57%), Gaps = 2/69 (2%)

Query: 357 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANKSTMAWG 416
           K +G+ ++ SG G+DE++GGY  F+   +  E   E   ++ N+H  +  R +K   + G
Sbjct: 384 KRRGI-VLFSGLGADELYGGYHKFSN-KTPEELVGELETQINNIHDRNLNRDDKVIASNG 441

Query: 417 LEARVPFLD 425
           +E R PFLD
Sbjct: 442 VEVRYPFLD 450

 Score = 33.5 bits (75), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 43/170 (25%), Positives = 68/170 (40%), Gaps = 39/170 (22%)

Query: 1   MCGIF------ACYKHESVQEFKPKALQLSKRIRH----------------RGPDWSGNV 38
           MCGI       +C   +S  EF  + L     + H                RGP+++ ++
Sbjct: 1   MCGILLSHYGESCPLEDSFHEFGEEELARGDLLPHTRQLGFLQTLIPHIVDRGPNYA-SL 59

Query: 39  VKNTTILAHERLAIVGLDSGAQPITSEDGD----YTLCVNGEIYNHIKLREELTSYPFKT 94
             + T  A    +I+ L    +P+T +  D    + L  NGEIYN   +    T Y    
Sbjct: 60  KSSATDAAVWFTSILSL---REPLTKQCIDINDRFVLQYNGEIYNS-SIAHNDTQYIATE 115

Query: 95  LSDCEPIIPLYQKYDIDTPKYLDGMFAWCLYDAKKDRIIAARDPIGITTL 144
           LS  + +  + +K        L G FA+ +YD     I   RD +G  +L
Sbjct: 116 LSIVQNVPTVIRK--------LSGEFAYTVYDRATGEIFFGRDGVGKRSL 157

>CAGL0H06963g Chr8 (689948..691501) [1554 bp, 517 aa] {ON} similar
           to uniprot|Q04489 Saccharomyces cerevisiae YML096w
          Length = 517

 Score = 38.5 bits (88), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 39/71 (54%), Gaps = 2/71 (2%)

Query: 354 RKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANKSTM 413
           ++ K +G+ ++ SG G+DE++GGY Y        E   E   ++ N++  +  R +K   
Sbjct: 384 KEYKRKGL-VLFSGLGADELYGGY-YKLSNKHEDELANELTTQINNIYRRNLNRDDKVIA 441

Query: 414 AWGLEARVPFL 424
           + G+E R PFL
Sbjct: 442 SNGVEVRYPFL 452

 Score = 36.6 bits (83), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 43/166 (25%), Positives = 67/166 (40%), Gaps = 32/166 (19%)

Query: 1   MCGIFACY------KHESVQEFKPKAL----------QLSKRIRHRGPDW-SGNVVKNTT 43
           MCGI  CY      +++ + EF    +           + K +R RGP++ S   +K+  
Sbjct: 1   MCGILLCYGPSFKAENDRLLEFYEDEVPRLGYDDNIESIVKLVRCRGPNYCSMRQIKDVN 60

Query: 44  ILAHERLAIVGLDSGAQPITSED----GDYTLCVNGEIYN-HIKLREELTSYPFKTLSDC 98
                 + I  + S  QP T +       Y L  NGE+YN  I      T +    L  C
Sbjct: 61  -----SIWISSVLSLRQPFTKQSIVIGNKYVLQFNGELYNDEIIESGNDTQFLSGLLKKC 115

Query: 99  EPIIPLYQKYDIDTPKYLDGMFAWCLYDAKKDRIIAARDPIGITTL 144
                + +    +    LDG FA+ + D + + I   RD IG  +L
Sbjct: 116 -----ISEDDIFNILHGLDGEFAFTIQDLENNLIYFGRDTIGKRSL 156

>KLTH0E16412g Chr5 complement(1455298..1456845) [1548 bp, 515 aa]
           {ON} similar to uniprot|Q04489 Saccharomyces cerevisiae
           YML096W Hypothetical ORF
          Length = 515

 Score = 38.1 bits (87), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 37/63 (58%), Gaps = 1/63 (1%)

Query: 363 MVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANKSTMAWGLEARVP 422
           ++ SG G+DE++GGY  F++  +  E   E   ++ N++  +  R +K   + G+E R P
Sbjct: 389 VLFSGLGADELYGGYHKFSKRAN-EELVPELEVQINNIYDRNLNRDDKVISSNGVEIRYP 447

Query: 423 FLD 425
           FLD
Sbjct: 448 FLD 450

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 38/85 (44%), Gaps = 10/85 (11%)

Query: 60  QPITSEDGDYTLCVNGEIYNHIKLREELTSYPFKTLSDCEPIIPLYQKYDIDTPKYLDGM 119
           Q I  ED  + L  NGEIYN   +    T Y  + L + + I  +         + L G 
Sbjct: 83  QCIEVED-RFVLQYNGEIYNS-SISHNDTQYIAEMLLNAKDIPSVI--------RTLSGE 132

Query: 120 FAWCLYDAKKDRIIAARDPIGITTL 144
           FA+ +YD     +   RDPIG  +L
Sbjct: 133 FAYTIYDKLTGEVFFGRDPIGRRSL 157

>Skud_7.311 Chr7
           complement(535445..535513,535517..535621,535625..535693)
           [243 bp, 81 aa] {ON} YGR124W (REAL)
          Length = 81

 Score = 33.9 bits (76), Expect = 0.14,   Method: Composition-based stats.
 Identities = 27/88 (30%), Positives = 38/88 (43%), Gaps = 14/88 (15%)

Query: 102 IPLYQKYDIDTPKYLDGMFAWCLYDAKKDRIIAARDPIGITTLYMGRXXXXXXTVFFASE 161
           +P Y + DID PK+L+ MFA+     +K              ++ G       T F  S+
Sbjct: 1   VPFYLERDIDAPKHLNDMFAFSWKKKEKSCC--------CCKIFYGCSFLMHRTFFQVSK 52

Query: 162 --LKC----LVDDCDEITAFPPGHVYDS 183
             L C    L   CD   +F PG V+DS
Sbjct: 53  DCLLCFTQILTGFCDNNDSFSPGRVFDS 80

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.136    0.419 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 60,828,488
Number of extensions: 2596372
Number of successful extensions: 5934
Number of sequences better than 10.0: 47
Number of HSP's gapped: 6018
Number of HSP's successfully gapped: 64
Length of query: 573
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 458
Effective length of database: 40,294,809
Effective search space: 18455022522
Effective search space used: 18455022522
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)