Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0F02926g3.485ON1050105051020.0
Kwal_55.212013.485ON1011105530240.0
KLTH0F14674g3.485ON1010105830050.0
Skud_7.4363.485ON1036107728440.0
Smik_6.2213.485ON1036107728230.0
Suva_7.4133.485ON1037108027950.0
NCAS0E009503.485ON1052108927800.0
YGR125W3.485ON1036107727750.0
NDAI0G009903.485ON1054108127440.0
CAGL0I10626g3.485ON1070106527390.0
KLLA0E04731g3.485ON1060106927350.0
Kpol_480.183.485ON1057108427260.0
KNAG0B008603.485ON1088109927240.0
KAFR0C019103.485ON1020106126840.0
ZYRO0C07986g3.485ON102483026090.0
TDEL0D055303.485ON103182525660.0
AFR304W3.485ON1015106025550.0
TBLA0C044403.485ON1150114325550.0
TPHA0D042103.485ON1049109724470.0
Skud_16.2868.99ON7452861183e-05
Smik_16.2418.99ON7442871075e-04
Suva_16.3228.99ON7422901020.002
SAKL0H08800gna 1ON620261850.20
YPR003C8.99ON754291850.26
Suva_11.3145.670ON58163810.57
SAKL0B03124g8.99ON744294791.0
ZYRO0F04796g8.99ON735285791.2
TDEL0H037307.78ON79782753.8
TBLA0H005608.442ON2216196745.0
YKR078W5.670ON58552735.4
KLLA0E17535g3.197ON32985725.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0F02926g
         (1050 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0F02926g Chr6 complement(245957..249109) [3153 bp, 1050 aa] ...  1969   0.0  
Kwal_55.21201 s55 (727206..730241) [3036 bp, 1011 aa] {ON} YGR12...  1169   0.0  
KLTH0F14674g Chr6 (1201874..1204906) [3033 bp, 1010 aa] {ON} sim...  1162   0.0  
Skud_7.436 Chr7 (721556..724666) [3111 bp, 1036 aa] {ON} YGR125W...  1100   0.0  
Smik_6.221 Chr6 (360160..363270) [3111 bp, 1036 aa] {ON} YGR125W...  1092   0.0  
Suva_7.413 Chr7 (712372..715485) [3114 bp, 1037 aa] {ON} YGR125W...  1081   0.0  
NCAS0E00950 Chr5 complement(171346..174504) [3159 bp, 1052 aa] {...  1075   0.0  
YGR125W Chr7 (742325..745435) [3111 bp, 1036 aa] {ON} Putative p...  1073   0.0  
NDAI0G00990 Chr7 complement(205221..208385) [3165 bp, 1054 aa] {...  1061   0.0  
CAGL0I10626g Chr9 complement(1048818..1052030) [3213 bp, 1070 aa...  1059   0.0  
KLLA0E04731g Chr5 complement(418094..421276) [3183 bp, 1060 aa] ...  1058   0.0  
Kpol_480.18 s480 complement(36794..39967) [3174 bp, 1057 aa] {ON...  1054   0.0  
KNAG0B00860 Chr2 complement(156225..159491) [3267 bp, 1088 aa] {...  1053   0.0  
KAFR0C01910 Chr3 (382140..385202) [3063 bp, 1020 aa] {ON} Anc_3....  1038   0.0  
ZYRO0C07986g Chr3 complement(609503..612577) [3075 bp, 1024 aa] ...  1009   0.0  
TDEL0D05530 Chr4 (999021..1002116) [3096 bp, 1031 aa] {ON} Anc_3...   993   0.0  
AFR304W Chr6 (991645..994692) [3048 bp, 1015 aa] {ON} Syntenic h...   988   0.0  
TBLA0C04440 Chr3 (1075482..1078934) [3453 bp, 1150 aa] {ON} Anc_...   988   0.0  
TPHA0D04210 Chr4 (908861..912010) [3150 bp, 1049 aa] {ON} Anc_3....   947   0.0  
Skud_16.286 Chr16 complement(525800..528037) [2238 bp, 745 aa] {...    50   3e-05
Smik_16.241 Chr16 complement(438048..440282) [2235 bp, 744 aa] {...    46   5e-04
Suva_16.322 Chr16 complement(565605..567833) [2229 bp, 742 aa] {...    44   0.002
SAKL0H08800g Chr8 (753145..755007) [1863 bp, 620 aa] {ON} simila...    37   0.20 
YPR003C Chr16 complement(561504..563768) [2265 bp, 754 aa] {ON} ...    37   0.26 
Suva_11.314 Chr11 (569449..571194) [1746 bp, 581 aa] {ON} YKR078...    36   0.57 
SAKL0B03124g Chr2 complement(288006..290240) [2235 bp, 744 aa] {...    35   1.0  
ZYRO0F04796g Chr6 (399222..401429) [2208 bp, 735 aa] {ON} simila...    35   1.2  
TDEL0H03730 Chr8 (623125..625518) [2394 bp, 797 aa] {ON} Anc_7.7...    33   3.8  
TBLA0H00560 Chr8 complement(107440..114090) [6651 bp, 2216 aa] {...    33   5.0  
YKR078W Chr11 (584952..586709) [1758 bp, 585 aa] {ON} Cytoplasmi...    33   5.4  
KLLA0E17535g Chr5 complement(1557680..1558669) [990 bp, 329 aa] ...    32   5.9  

>SAKL0F02926g Chr6 complement(245957..249109) [3153 bp, 1050 aa] {ON}
            similar to uniprot|P53273 Saccharomyces cerevisiae
            YGR125W Hypothetical ORF
          Length = 1050

 Score = 1969 bits (5102), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 971/1050 (92%), Positives = 971/1050 (92%)

Query: 1    MPNKKNRKSISEAITISLGLHSDNIKQPSQANRRSSMNPENSSNYYLGRSYVGSFSSPSF 60
            MPNKKNRKSISEAITISLGLHSDNIKQPSQANRRSSMNPENSSNYYLGRSYVGSFSSPSF
Sbjct: 1    MPNKKNRKSISEAITISLGLHSDNIKQPSQANRRSSMNPENSSNYYLGRSYVGSFSSPSF 60

Query: 61   LQRESSADTGHILSLHKDASKSIHESVKLHRQTAALSNNFDDSSDGKSDEIDVAASQEFQ 120
            LQRESSADTGHILSLHKDASKSIHESVKLHRQTAALSNNFDDSSDGKSDEIDVAASQEFQ
Sbjct: 61   LQRESSADTGHILSLHKDASKSIHESVKLHRQTAALSNNFDDSSDGKSDEIDVAASQEFQ 120

Query: 121  NEALQRELSLENGSYXXXXXXXXXXXQIAYSEDAITQENNGLNECTRLLSPTSAAATDLE 180
            NEALQRELSLENGSY           QIAYSEDAITQENNGLNECTRLLSPTSAAATDLE
Sbjct: 121  NEALQRELSLENGSYSNSNNNNNNNNQIAYSEDAITQENNGLNECTRLLSPTSAAATDLE 180

Query: 181  YGTSPTNLSPPSSQYEQEQYVSLVADHSPSSAVYDQATGDGDNAFNTYHSLRQPVVRSYY 240
            YGTSPTNLSPPSSQYEQEQYVSLVADHSPSSAVYDQATGDGDNAFNTYHSLRQPVVRSYY
Sbjct: 181  YGTSPTNLSPPSSQYEQEQYVSLVADHSPSSAVYDQATGDGDNAFNTYHSLRQPVVRSYY 240

Query: 241  DYAKGWSIKTLNYMPAVILGLLLNVLDALSYGMIIFPITEPVFSHLGPTGLSMFYVSTIL 300
            DYAKGWSIKTLNYMPAVILGLLLNVLDALSYGMIIFPITEPVFSHLGPTGLSMFYVSTIL
Sbjct: 241  DYAKGWSIKTLNYMPAVILGLLLNVLDALSYGMIIFPITEPVFSHLGPTGLSMFYVSTIL 300

Query: 301  SQLVYSCGFSAFGNGIGSEMIEITPFFHTMALSIMNSLPGHDDEIISTTIVCYALSSIFT 360
            SQLVYSCGFSAFGNGIGSEMIEITPFFHTMALSIMNSLPGHDDEIISTTIVCYALSSIFT
Sbjct: 301  SQLVYSCGFSAFGNGIGSEMIEITPFFHTMALSIMNSLPGHDDEIISTTIVCYALSSIFT 360

Query: 361  GLAFFLLGKLRLGKIVGFFPRHILIGCVGGVGYFLLITGIEVCTRVSKFEYSWPFLRELF 420
            GLAFFLLGKLRLGKIVGFFPRHILIGCVGGVGYFLLITGIEVCTRVSKFEYSWPFLRELF
Sbjct: 361  GLAFFLLGKLRLGKIVGFFPRHILIGCVGGVGYFLLITGIEVCTRVSKFEYSWPFLRELF 420

Query: 421  YNTEVLGKWMLPLILTLSLIVTQHYFNNSLVLPSFYIITLALFHFVVAIVPNLSLNSLRE 480
            YNTEVLGKWMLPLILTLSLIVTQHYFNNSLVLPSFYIITLALFHFVVAIVPNLSLNSLRE
Sbjct: 421  YNTEVLGKWMLPLILTLSLIVTQHYFNNSLVLPSFYIITLALFHFVVAIVPNLSLNSLRE 480

Query: 481  SGWIFPMAGSSNHWYDFYKLYDFQNVHWTLVLKQVPTMLALTFFGILHVPINVPALAMSI 540
            SGWIFPMAGSSNHWYDFYKLYDFQNVHWTLVLKQVPTMLALTFFGILHVPINVPALAMSI
Sbjct: 481  SGWIFPMAGSSNHWYDFYKLYDFQNVHWTLVLKQVPTMLALTFFGILHVPINVPALAMSI 540

Query: 541  GMDKFDVDKELIAHGYSNLLSGFSGSIQNYLVYTNSFLFIRAGSDSSWAGFLLALGTFVV 600
            GMDKFDVDKELIAHGYSNLLSGFSGSIQNYLVYTNSFLFIRAGSDSSWAGFLLALGTFVV
Sbjct: 541  GMDKFDVDKELIAHGYSNLLSGFSGSIQNYLVYTNSFLFIRAGSDSSWAGFLLALGTFVV 600

Query: 601  MXXXXXXXXXXXXXXXXXLIFLLGYELIKEALFDTWGKLNRFEYITIVIIVFTMGVFDFV 660
            M                 LIFLLGYELIKEALFDTWGKLNRFEYITIVIIVFTMGVFDFV
Sbjct: 601  MIIGPVIISFIPICIVGSLIFLLGYELIKEALFDTWGKLNRFEYITIVIIVFTMGVFDFV 660

Query: 661  LGIIVGILIACFSFLVDSTKLQTINGEFNGQVARSTVYRDYIQTKFLNKVGEQIHVLKLQ 720
            LGIIVGILIACFSFLVDSTKLQTINGEFNGQVARSTVYRDYIQTKFLNKVGEQIHVLKLQ
Sbjct: 661  LGIIVGILIACFSFLVDSTKLQTINGEFNGQVARSTVYRDYIQTKFLNKVGEQIHVLKLQ 720

Query: 721  NLLFFGTIISIEEKIDGLLEISDKDSSRQRIKYLILDFKNINADNIDYSAAEGFNRIKRF 780
            NLLFFGTIISIEEKIDGLLEISDKDSSRQRIKYLILDFKNINADNIDYSAAEGFNRIKRF
Sbjct: 721  NLLFFGTIISIEEKIDGLLEISDKDSSRQRIKYLILDFKNINADNIDYSAAEGFNRIKRF 780

Query: 781  TETKRIQLIISSITEKDRIYNAFNKVGLLQDVELFADLNSALEWCENEFLLQYKQIRTRT 840
            TETKRIQLIISSITEKDRIYNAFNKVGLLQDVELFADLNSALEWCENEFLLQYKQIRTRT
Sbjct: 781  TETKRIQLIISSITEKDRIYNAFNKVGLLQDVELFADLNSALEWCENEFLLQYKQIRTRT 840

Query: 841  XXXXXXXXXXXXHLSKSLLPINTPRNNQIVTVAQKIFPDEQNVTHLRTQYQKREXXXXXX 900
                        HLSKSLLPINTPRNNQIVTVAQKIFPDEQNVTHLRTQYQKRE      
Sbjct: 841  KAKLQAQKKQEKHLSKSLLPINTPRNNQIVTVAQKIFPDEQNVTHLRTQYQKREPVLPLL 900

Query: 901  XXXXXXFRPQIMSYDKDVKQAEEDFWSKLCPYFVRKRFAPGSXXXXXXXXXXXVESGMLK 960
                  FRPQIMSYDKDVKQAEEDFWSKLCPYFVRKRFAPGS           VESGMLK
Sbjct: 901  LVALKKFRPQIMSYDKDVKQAEEDFWSKLCPYFVRKRFAPGSLLLHNNNLFFLVESGMLK 960

Query: 961  ITYDLHQGQFYETMSSKTCYGRISGNAEFTTNLYVNIKTETDCAVWIIDXXXXXXXXXXX 1020
            ITYDLHQGQFYETMSSKTCYGRISGNAEFTTNLYVNIKTETDCAVWIID           
Sbjct: 961  ITYDLHQGQFYETMSSKTCYGRISGNAEFTTNLYVNIKTETDCAVWIIDATNLANLKEKN 1020

Query: 1021 XXXXXELLLVVMSINQYRSKELLGYSLVSS 1050
                 ELLLVVMSINQYRSKELLGYSLVSS
Sbjct: 1021 LALYAELLLVVMSINQYRSKELLGYSLVSS 1050

>Kwal_55.21201 s55 (727206..730241) [3036 bp, 1011 aa] {ON} YGR125W -
            Hypothetical ORF [contig 295] FULL
          Length = 1011

 Score = 1169 bits (3024), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 626/1055 (59%), Positives = 741/1055 (70%), Gaps = 59/1055 (5%)

Query: 5    KNRKSISEAITISLGLHSDNIKQP-----SQANRRSSMNPENSSNYYLGRSYVGSFSSPS 59
            KN+ SISEAI++SLGL S +          +AN  S    + S +YYLGRSYV + S P 
Sbjct: 7    KNKPSISEAISVSLGLQSQSNSDQDSSYIPRANPFSHTG-DGSPHYYLGRSYVANLSPPP 65

Query: 60   FLQRESSADTGHI-LSLHKDASKSIHESVKLHRQTAALSNNFDDSSDGKSDEIDVAASQE 118
             L R      G + LS   + S+SIH+SV L RQTAALSN F+D+ +    E  +A   E
Sbjct: 66   -LARLPGGLPGELPLSYRPEQSQSIHQSVSLRRQTAALSNEFEDTFEF---EDQLAGVSE 121

Query: 119  FQNEALQRELSLENGSYXXXXXXXXXXXQIAYSEDAITQENNGLNECTRLLSPTSAAATD 178
                +   E    NG+             +     ++      +NE +  L P +A   D
Sbjct: 122  DDGHSTTAEEPSMNGT-------------LISPVSSVPDTPIDINEPSNALLPPNAEH-D 167

Query: 179  LEYGTSPTNLSPPSSQYEQEQYVSLVADHSPSSAVYDQATGDGDNAFNTY--HSLRQPVV 236
            LEYG+           YE  QYVSL            Q+   G N  N     SLR+ ++
Sbjct: 168  LEYGS--------IDGYEH-QYVSL------------QSRRSGANTHNIGPDASLREKMM 206

Query: 237  RSYYDYAKGWSIKTLNYMPAVILGLLLNVLDALSYGMIIFPITEPVFSHLGPTGLSMFYV 296
             +        + + +NYMPAVILGLLLN+LDALSYGMIIFPITEP+FSHLGPTG+SMFYV
Sbjct: 207  FT--------ARRMVNYMPAVILGLLLNILDALSYGMIIFPITEPLFSHLGPTGMSMFYV 258

Query: 297  STILSQLVYSCGFSAFGNGIGSEMIEITPFFHTMALSIMNSLPGHDDEIISTTIVCYALS 356
            S+I+SQL+YS GFSAFGN +GSEMIEITPF+H MA SI+  LPG  D ++STTIVCYALS
Sbjct: 259  SSIISQLIYSGGFSAFGNAVGSEMIEITPFYHAMAASIVAGLPGEKDRVLSTTIVCYALS 318

Query: 357  SIFTGLAFFLLGKLRLGKIVGFFPRHILIGCVGGVGYFLLITGIEVCTRVSKFEYSWPFL 416
            SI TGL FFLLG+LRLGKIVGFFPRHILIGC+GGVGYFLLITG+EV TRV+KFEYS+ FL
Sbjct: 319  SIITGLVFFLLGRLRLGKIVGFFPRHILIGCIGGVGYFLLITGLEVTTRVAKFEYSFEFL 378

Query: 417  RELFYNTEVLGKWMLPLILTLSLIVTQHYFNNSLVLPSFYIITLALFHFVVAIVPNLSLN 476
              LF N EVLGKW LP ++ + L+V QH F NSLVLP+FYI  L LFHF+VA++P+LSL+
Sbjct: 379  SSLFTNIEVLGKWGLPALMAVLLVVVQHAFGNSLVLPAFYIAALLLFHFIVALIPSLSLD 438

Query: 477  SLRESGWIFPMAGSSNHWYDFYKLYDFQNVHWTLVLKQVPTMLALTFFGILHVPINVPAL 536
             LR+SGWIFP   S+ HW+DFY LY+F+ V W ++LKQ+PTMLALTFFGILHVPINVPAL
Sbjct: 439  ILRDSGWIFPATDSTEHWFDFYTLYNFKLVSWPMILKQIPTMLALTFFGILHVPINVPAL 498

Query: 537  AMSIGMDKFDVDKELIAHGYSNLLSGFSGSIQNYLVYTNSFLFIRAGSDSSWAGFLLALG 596
            AMSIG+DK DVDKELIAHGYSN LSG  GS+QNYLVYTNS LFIRAG D + AG +LA  
Sbjct: 499  AMSIGLDKLDVDKELIAHGYSNFLSGIMGSVQNYLVYTNSVLFIRAGGDDALAGLMLAAA 558

Query: 597  TFVVMXXXXXXXXXXXXXXXXXLIFLLGYELIKEALFDTWGKLNRFEYITIVIIVFTMGV 656
            TF +M                 LIFLLGYEL+KEAL+DTWGKLN FEY T+V IVFTMG 
Sbjct: 559  TFGIMIVGPVIVAYIPVCIVGSLIFLLGYELLKEALYDTWGKLNNFEYATVVAIVFTMGA 618

Query: 657  FDFVLGIIVGILIACFSFLVDSTKLQTINGEFNGQVARSTVYRDYIQTKFLNKVGEQIHV 716
            FDFVLGIIVGILIACFSFLVDSTKLQT+NGEF+GQVARSTV RDYIQT+FLNK+GEQIHV
Sbjct: 619  FDFVLGIIVGILIACFSFLVDSTKLQTVNGEFDGQVARSTVSRDYIQTQFLNKIGEQIHV 678

Query: 717  LKLQNLLFFGTIISIEEKIDGLLEISDKDSSRQRIKYLILDFKNINADNIDYSAAEGFNR 776
            LKLQNLLFFGTI+SIEEKID LLE+SDKDSS++RIKYLILDFKNINADNIDYSAAEGFNR
Sbjct: 679  LKLQNLLFFGTILSIEEKIDKLLELSDKDSSKKRIKYLILDFKNINADNIDYSAAEGFNR 738

Query: 777  IKRFTETKRIQLIISSITEKDRIYNAFNKVGLLQDVELFADLNSALEWCENEFLLQYKQI 836
            IKRFT +KRI LIISSI   DRIY AFNKVG+L+ VELF DLNSALEWCENEFL+Q+K +
Sbjct: 739  IKRFTSSKRIHLIISSIKTSDRIYRAFNKVGMLEGVELFDDLNSALEWCENEFLIQFKDL 798

Query: 837  RTRTXXXXXXXXXXXXHLSKSLLPINTPRNNQIVTVAQKIFPDEQNVTHLRTQYQKREXX 896
            R +T             +SK  LP NTPRNNQ V+VAQK+F DEQ++THL++ Y++R   
Sbjct: 799  RNKT--KLKAGKKQDRRMSKVPLPFNTPRNNQFVSVAQKLFTDEQSMTHLKSSYRERPPV 856

Query: 897  XXXXXXXXXXFRPQIMSYDKDVKQAEEDFWSKLCPYFVRKRFAPGSXXXXXXXXXXXVES 956
                      FRPQIMS DK VK+ EE  WS LC YF +KR A  S           +E+
Sbjct: 857  LPLLLSALQRFRPQIMSSDKSVKEGEERLWSDLCKYFYKKRLAAHSLLLHKDNIFFVIET 916

Query: 957  GMLKITYDLHQGQFYETMSSKTCYGRISGNAEFTTNLY-VNIKTETDCAVWIIDXXXXXX 1015
            GM+K+TY+L QGQ YETMS KTCYGR+S        +  V ++ ETDC++WIID      
Sbjct: 917  GMVKVTYNLRQGQLYETMSGKTCYGRMSIPNNNNNPISCVEVEMETDCSLWIIDDAGLAK 976

Query: 1016 XXXXXXXXXXELLLVVMSINQYRSKELLGYSLVSS 1050
                      E+LLV + INQ R KELLG+ LVSS
Sbjct: 977  LKRENLNLYTEVLLVTLCINQDRLKELLGHCLVSS 1011

>KLTH0F14674g Chr6 (1201874..1204906) [3033 bp, 1010 aa] {ON} similar
            to uniprot|P53273 Saccharomyces cerevisiae YGR125W
            Hypothetical ORF
          Length = 1010

 Score = 1162 bits (3005), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 616/1058 (58%), Positives = 735/1058 (69%), Gaps = 66/1058 (6%)

Query: 5    KNRKSISEAITISLGLHSDNIKQPSQANRRSSM---NP-----ENSSNYYLGRSYVGSFS 56
            +N+ S+SEAI++SLGL S    QP       S+   NP     + S +YYLGRSYV + S
Sbjct: 7    RNKHSLSEAISVSLGLQS----QPGSETDTLSVPRGNPFSNGADGSPHYYLGRSYVANLS 62

Query: 57   SPSFLQRES-SADTGHILSLHKDASKSIHESVKLHRQTAALSNNFDDSSDGKSDEIDVAA 115
             P    +E  S D     S   + S+SIH+S+ L RQTAALSN FD + + +    D+A 
Sbjct: 63   PPPLAIKERFSGDPTS--SSRPEQSQSIHQSLSLRRQTAALSNEFDGTFEFEDQLEDLA- 119

Query: 116  SQEFQNEALQRELSLENGSYXXXXXXXXXXXQIAYSEDAITQENNGLN--ECTRLLSPTS 173
              E  N A+  E S+  GS              A S  +   E + L+  + + LL P +
Sbjct: 120  --ENGNTAVPDE-SVMAGS--------------AISPTSSGPEPSVLDNTDVSNLLLPPN 162

Query: 174  AAATDLEYGTSPTNLSPPSSQYEQEQYVSLVADHSPSSAVYDQATGDGDNAFNTYHSLRQ 233
                DLEYG         S      QYVSL +          Q  G    A +   S+R 
Sbjct: 163  TQ-RDLEYG---------SIDEFDHQYVSLQS----------QRAGSNSRAIDPNASMRD 202

Query: 234  PVVRSYYDYAKGWSIKTLNYMPAVILGLLLNVLDALSYGMIIFPITEPVFSHLGPTGLSM 293
              + ++            NY+PAVILGLLLN+LDALSYGMIIFPITEP+FSHLGP+GLSM
Sbjct: 203  KTLFTFRRLG--------NYVPAVILGLLLNILDALSYGMIIFPITEPLFSHLGPSGLSM 254

Query: 294  FYVSTILSQLVYSCGFSAFGNGIGSEMIEITPFFHTMALSIMNSLPGHDDEIISTTIVCY 353
            FY+S+++SQLVYSCGFSAFGN +GSEMIEITPF+H+MA SIM S+PG  D +++TTIVCY
Sbjct: 255  FYMSSVVSQLVYSCGFSAFGNAVGSEMIEITPFYHSMAASIMASMPGEKDRVLTTTIVCY 314

Query: 354  ALSSIFTGLAFFLLGKLRLGKIVGFFPRHILIGCVGGVGYFLLITGIEVCTRVSKFEYSW 413
            A+SSI TGL FFLLG+L+LGKIVGFFPRHILIGC+GGVGYFL+ITG EV TR SKFEYS+
Sbjct: 315  AMSSIMTGLVFFLLGRLKLGKIVGFFPRHILIGCIGGVGYFLVITGFEVTTRASKFEYSF 374

Query: 414  PFLRELFYNTEVLGKWMLPLILTLSLIVTQHYFNNSLVLPSFYIITLALFHFVVAIVPNL 473
             FL  L  + E+LGKW LP ++ + L+V Q    NSLVLP+FYI  L LFHF+VA++P+L
Sbjct: 375  EFLSSLLTDPEILGKWGLPALMAVLLVVIQRACKNSLVLPTFYIAALLLFHFIVALIPSL 434

Query: 474  SLNSLRESGWIFPMAGSSNHWYDFYKLYDFQNVHWTLVLKQVPTMLALTFFGILHVPINV 533
            SL+SLR+SGW+FP   ++ HW+DFYKLY+F+ V W LVLKQVPTMLALTFFGILHVPINV
Sbjct: 435  SLHSLRDSGWVFPATTTTEHWFDFYKLYNFKLVSWPLVLKQVPTMLALTFFGILHVPINV 494

Query: 534  PALAMSIGMDKFDVDKELIAHGYSNLLSGFSGSIQNYLVYTNSFLFIRAGSDSSWAGFLL 593
            PALAMSIG+DK DVDKELIAHGYSN LSG  GS+QNYLVYTNS LFI+AG+D S AG +L
Sbjct: 495  PALAMSIGLDKLDVDKELIAHGYSNFLSGMIGSVQNYLVYTNSLLFIKAGADDSLAGLML 554

Query: 594  ALGTFVVMXXXXXXXXXXXXXXXXXLIFLLGYELIKEALFDTWGKLNRFEYITIVIIVFT 653
            A  TF +M                 LIFLLGYEL+KEAL DTWGKLN FEY T+V IVFT
Sbjct: 555  AAATFGIMVIGPVIVAYIPVCIVGSLIFLLGYELLKEALVDTWGKLNNFEYATVVAIVFT 614

Query: 654  MGVFDFVLGIIVGILIACFSFLVDSTKLQTINGEFNGQVARSTVYRDYIQTKFLNKVGEQ 713
            MG FDFVLGIIVGILIACFSFLVDSTKLQTINGEF+GQVARSTV RDYIQT+FLNK+GEQ
Sbjct: 615  MGAFDFVLGIIVGILIACFSFLVDSTKLQTINGEFDGQVARSTVRRDYIQTQFLNKIGEQ 674

Query: 714  IHVLKLQNLLFFGTIISIEEKIDGLLEISDKDSSRQRIKYLILDFKNINADNIDYSAAEG 773
            IHVLKLQNLLFFGTIISIEEKID LLE+SDKD+S++RIKYLILDFKNINADNIDYSAAEG
Sbjct: 675  IHVLKLQNLLFFGTIISIEEKIDKLLELSDKDASKKRIKYLILDFKNINADNIDYSAAEG 734

Query: 774  FNRIKRFTETKRIQLIISSITEKDRIYNAFNKVGLLQDVELFADLNSALEWCENEFLLQY 833
            FNRIKRFT +KRI LIISSI   DRIY AFNKVG L  VELF DLNSALEWCENEFL Q+
Sbjct: 735  FNRIKRFTFSKRIHLIISSIKTTDRIYRAFNKVGTLDGVELFDDLNSALEWCENEFLRQF 794

Query: 834  KQIRTRTXXXXXXXXXXXXHLSKSLLPINTPRNNQIVTVAQKIFPDEQNVTHLRTQYQKR 893
            + +R +T             LSK  LP NTPRNN  V+VAQK+F DEQ++ HL+T Y+++
Sbjct: 795  RDLRNKT--KLKAVRKQERQLSKGALPFNTPRNNHFVSVAQKLFTDEQSMPHLKTHYKEK 852

Query: 894  EXXXXXXXXXXXXFRPQIMSYDKDVKQAEEDFWSKLCPYFVRKRFAPGSXXXXXXXXXXX 953
                         +RP+IMS +K VK+ EE  WS+L  +F ++R A  S           
Sbjct: 853  TPVLHLLLSALQRYRPEIMSPEKPVKETEEKMWSELGKFFFKRRLAAQSLLPHKNNIFLV 912

Query: 954  VESGMLKITYDLHQGQFYETMSSKTCYGRISG-NAEFTTNLYVNIKTETDCAVWIIDXXX 1012
            VESGM+K+TY+L QGQ YE +S KTCYGRI+  N+       V IK ETDCA+WI+D   
Sbjct: 913  VESGMVKVTYNLRQGQLYEILSGKTCYGRITAPNSSEVPISSVEIKMETDCALWILDEAN 972

Query: 1013 XXXXXXXXXXXXXELLLVVMSINQYRSKELLGYSLVSS 1050
                         ELLLV + +NQ R KELLG+ LVSS
Sbjct: 973  LAKLKKENLALYTELLLVTLCMNQDRLKELLGHCLVSS 1010

>Skud_7.436 Chr7 (721556..724666) [3111 bp, 1036 aa] {ON} YGR125W
            (REAL)
          Length = 1036

 Score = 1100 bits (2844), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 591/1077 (54%), Positives = 732/1077 (67%), Gaps = 94/1077 (8%)

Query: 12   EAITISLGLHSDNIKQPSQANRRSSMNPENSSNYYLGRSYV-GSFSSPSFLQRESSADTG 70
            EAI++SLG++ D+ K        S+M+P       L RSY+ G F+  S    ++ +D+ 
Sbjct: 16   EAISVSLGINQDSSKNKMHRASVSAMSPP------LCRSYMSGFFTGGSSPMVKNMSDSK 69

Query: 71   HILSLHKDASKSIHESVKLHRQTAALSNNF-----DDSSDGKSDEIDVAASQEFQNEALQ 125
               S +K     IH S  LHRQTA LSN F     +++S    D +D+  S + +++   
Sbjct: 70   LPFS-NKQHPTVIHGSENLHRQTAQLSNEFCSSSVEENSPTIKDYMDIIDSDDRKDDQSM 128

Query: 126  RELSLENGSYXXXXXXXXXXXQIAYSEDAITQENNGLNECTRLLSPTSAAATDLEYGTSP 185
            R + +EN                      I +E +  +E +RLL                
Sbjct: 129  RTI-VEN----------------------IDEEYS--DEYSRLL---------------- 147

Query: 186  TNLSPPSSQYEQEQYVSLVADHSPSSAVYDQATGDGDNAFNTYHSLR-QPVVRSYYDYAK 244
              LSP SS  + E+  +L     P S + D   G G  +    H+LR +P  R+ + +  
Sbjct: 148  --LSPASSNVDDERNRAL--QSGPISELEDDY-GGGYQSLRPSHNLRFRP--RNIWQWCT 200

Query: 245  GWSIKTLNYMPAVILGLLLNVLDALSYGMIIFPITEPVFSHLGPTGLSMFYVSTILSQLV 304
             +  K  +Y+PA +LGLLLN+LDALSYGMIIFPITEPVFSHLGPTG+SMFY+STI+SQ V
Sbjct: 201  SFPFKFAHYLPAAVLGLLLNILDALSYGMIIFPITEPVFSHLGPTGISMFYISTIISQAV 260

Query: 305  YSCGFSAFGNGIGSEMIEITPFFHTMALSIMNSLPGHDDEIISTTIVCYALSSIFTGLAF 364
            YS G+S+F +GIGSEMIEITPF+HTMAL++ ++L G+DDEII+TTI CY +SS+ TG+ F
Sbjct: 261  YSGGWSSFPSGIGSEMIEITPFYHTMALAVKDALEGNDDEIITTTIFCYVISSMLTGVVF 320

Query: 365  FLLGKLRLGKIVGFFPRHILIGCVGGVGYFLLITGIEVCTRVSKFEYSWPFLRELFYNTE 424
            ++LGKLRLGKIVGFFPRHILIGC+GGVGYFL+ITGIEV TRV+KFEYSWPF   LF N +
Sbjct: 321  YVLGKLRLGKIVGFFPRHILIGCIGGVGYFLIITGIEVTTRVAKFEYSWPFFSGLFTNYD 380

Query: 425  VLGKWMLPLILTLSLIVTQHYFNNSLVLPSFYIITLALFHFVVAIVPNLSLNSLRESGWI 484
             L KW+LP++LT+ LI TQ YF NSLVLP+FYI+TL LFHF+VAI+P LSL++LRE+GWI
Sbjct: 381  TLAKWLLPVLLTVILIGTQRYFKNSLVLPTFYILTLVLFHFIVAIIPTLSLDTLREAGWI 440

Query: 485  FPMAGSSNHWYDFYKLYDFQNVHWTLVLKQVPTMLALTFFGILHVPINVPALAMSIGMDK 544
            FP+A S + WYD YKL++   VHW+LVL+Q+PTM+ALTFFGILHVPINVPALAMS+ MDK
Sbjct: 441  FPIANSDSKWYDHYKLFNVHKVHWSLVLQQIPTMMALTFFGILHVPINVPALAMSLQMDK 500

Query: 545  FDVDKELIAHGYSNLLSGFSGSIQNYLVYTNSFLFIRAGSDSSWAGFLLALGTFVVMXXX 604
            +DVD+ELIAHGYSN  SG  GS+QNYLVYTNS LFIRAG+DSS+AGFLL   T  VM   
Sbjct: 501  YDVDRELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGADSSFAGFLLIALTICVMLIG 560

Query: 605  XXXXXXXXXXXXXXLIFLLGYELIKEALFDTWGKLNRFEYITIVIIVFTMGVFDFVLGII 664
                          LIFLLGYEL+ EAL DTW KLNRFEY+T+VIIVFTMGVFDFVLGII
Sbjct: 561  PVIISFIPICIVGSLIFLLGYELLVEALVDTWNKLNRFEYLTVVIIVFTMGVFDFVLGII 620

Query: 665  VGILIACFSFLVDSTKLQTINGEFNGQVARSTVYRDYIQTKFLNKVGEQIHVLKLQNLLF 724
            VGILIACFSFLVDSTKLQTINGE+NG VA+STVYRDY+QTKFL+ +GEQI+VLKLQN+LF
Sbjct: 621  VGILIACFSFLVDSTKLQTINGEYNGNVAKSTVYRDYVQTKFLDGIGEQIYVLKLQNVLF 680

Query: 725  FGTIISIEEKIDGLLEISDKDSSRQRIKYLILDFKNINADNIDYSAAEGFNRIKRFTETK 784
            FGTIISIEEKI+ LL+IS+KD+ ++RIKYLILDFKNINADNIDYSAAEGFNRIKRFT TK
Sbjct: 681  FGTIISIEEKIEKLLQISNKDAKKRRIKYLILDFKNINADNIDYSAAEGFNRIKRFTGTK 740

Query: 785  RIQLIISSITEKDRIYNAFNKVGLLQDVELFADLNSALEWCENEFLLQYKQIRTR----- 839
            RI+LIISSI E+DRIYNAFN VGLL DVELFADLNSALEWCENEFL QYKQ+R +     
Sbjct: 741  RIKLIISSIKERDRIYNAFNNVGLLNDVELFADLNSALEWCENEFLFQYKQLREKAKKRL 800

Query: 840  ---------TXXXXXXXXXXXXHLSKSL--------------LPINTPRNNQIVTVAQKI 876
                     +             L   L              LP NTPRN Q+++VAQ +
Sbjct: 801  EERKQSSVASAIMAATQNKKIDGLGNGLSTGENRDHARNLMSLPTNTPRNYQMLSVAQNV 860

Query: 877  F-PDEQNVTHLRTQYQKREXXXXXXXXXXXXFRPQIMSYDKDVKQAEEDFWSKLCPYFVR 935
            F  DEQ V + + +Y+  E            +RP I+S  + V++ E  FW++LCPYF R
Sbjct: 861  FVNDEQAVKNFKMEYKNDEPILPILLFALKQYRPDIISEIQTVREKEIKFWAQLCPYFTR 920

Query: 936  KRFAPGSXXXXXXXXXXXVESGMLKITYDLHQGQFYETMSSKTCYGRI--SGNAEFTTNL 993
            +R A  S           VE+GMLK TY+L QG  YE  S+ TC+G+I   GNA      
Sbjct: 921  RRLASQSLLLHADNIFFLVETGMLKATYELPQGTLYEIFSNGTCFGKIIAPGNA-MPREQ 979

Query: 994  YVNIKTETDCAVWIIDXXXXXXXXXXXXXXXXELLLVVMSINQYRSKELLGYSLVSS 1050
             + I+TETD  +W+ID                E+ L+VM I   R KELLGY+LVS+
Sbjct: 980  KLTIETETDSVLWVIDSSSLKKMKEENLALYVEVTLMVMCIKDTRFKELLGYTLVSA 1036

>Smik_6.221 Chr6 (360160..363270) [3111 bp, 1036 aa] {ON} YGR125W
            (REAL)
          Length = 1036

 Score = 1092 bits (2823), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 587/1077 (54%), Positives = 728/1077 (67%), Gaps = 94/1077 (8%)

Query: 12   EAITISLGLHSDNIKQPSQANRRSSMNPENSSNYYLGRSYV-GSFSSPSFLQRESSADTG 70
            EAI++SLG++ D+          S+M+P       L RSY+ G F+  +     S +D+ 
Sbjct: 16   EAISVSLGINQDSSINKMHRASVSAMSPP------LCRSYMSGFFTGGNSPMINSMSDSK 69

Query: 71   HILSLHKDASKSIHESVKLHRQTAALSNNF-----DDSSDGKSDEIDVAASQEFQNEALQ 125
              LS +K   K IH S  LHRQTA LSN F     +++S    D +D+  S + +++   
Sbjct: 70   LPLS-NKQHPKVIHGSENLHRQTAQLSNEFCSSSVEENSPTIKDYMDIIDSGDRKDDQSM 128

Query: 126  RELSLENGSYXXXXXXXXXXXQIAYSEDAITQENNGLNECTRLLSPTSAAATDLEYGTSP 185
            R +                       E+ I +E +  +E +RLL                
Sbjct: 129  RTI-----------------------EEDIDEEYS--DEYSRLL---------------- 147

Query: 186  TNLSPPSSQYEQEQYVSLVADHSPSSAVYDQATGDGDNAFNTYHSLR-QPVVRSYYDYAK 244
              LSP SS    ++   L   +  +S + D   G G  +  + H+LR +P  R++     
Sbjct: 148  --LSPASSNINDDRNRGL--QNGLTSELEDDYEG-GYQSLRSSHNLRSRP--RNFRRLCT 200

Query: 245  GWSIKTLNYMPAVILGLLLNVLDALSYGMIIFPITEPVFSHLGPTGLSMFYVSTILSQLV 304
             +  K ++Y+PA +LGLLLN+LDALSYGMIIFPITEPVFSHLGPTG+SMFY+STI+SQ V
Sbjct: 201  SFPSKFIHYLPAAVLGLLLNILDALSYGMIIFPITEPVFSHLGPTGISMFYISTIISQAV 260

Query: 305  YSCGFSAFGNGIGSEMIEITPFFHTMALSIMNSLPGHDDEIISTTIVCYALSSIFTGLAF 364
            YS G S+F +GIGSEMIEITPF+HTMAL++  +L G DDEII+TTI CY +SS+ TG  F
Sbjct: 261  YSGGCSSFPSGIGSEMIEITPFYHTMALAVKEALAGDDDEIITTTIFCYVISSMLTGTVF 320

Query: 365  FLLGKLRLGKIVGFFPRHILIGCVGGVGYFLLITGIEVCTRVSKFEYSWPFLRELFYNTE 424
            ++LGKL+LGKIVGFFPRHILIGC+GGVGYFL+ITGIEV TRV+KFEYSWPF   LF N +
Sbjct: 321  YVLGKLQLGKIVGFFPRHILIGCIGGVGYFLIITGIEVTTRVAKFEYSWPFFLGLFTNYD 380

Query: 425  VLGKWMLPLILTLSLIVTQHYFNNSLVLPSFYIITLALFHFVVAIVPNLSLNSLRESGWI 484
             L KW+LP+ILT+ LI TQ YF NSLVLPSFYI+TL LFHF+VAI+P LSL++LR +GWI
Sbjct: 381  TLAKWLLPVILTVILIGTQRYFKNSLVLPSFYILTLVLFHFIVAIIPTLSLDTLRAAGWI 440

Query: 485  FPMAGSSNHWYDFYKLYDFQNVHWTLVLKQVPTMLALTFFGILHVPINVPALAMSIGMDK 544
            FP+A S + WYD YKL++   VHW+LVL+Q+PTM+ALTFFGILHVPINVPALAMS+ MDK
Sbjct: 441  FPIANSDSKWYDHYKLFNVHKVHWSLVLQQIPTMMALTFFGILHVPINVPALAMSLQMDK 500

Query: 545  FDVDKELIAHGYSNLLSGFSGSIQNYLVYTNSFLFIRAGSDSSWAGFLLALGTFVVMXXX 604
            +DVD+ELIAHGYSN  SG  GS+QNYLVYTNS LFIRAG+DSS+AGFLL   T  +M   
Sbjct: 501  YDVDRELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGADSSFAGFLLIALTICIMMIG 560

Query: 605  XXXXXXXXXXXXXXLIFLLGYELIKEALFDTWGKLNRFEYITIVIIVFTMGVFDFVLGII 664
                          LIFLLGYEL+ EAL DTW KLNRFEY+T+VIIVFTMG+FDFVLGII
Sbjct: 561  PVIISFIPICIVGSLIFLLGYELLVEALIDTWNKLNRFEYLTVVIIVFTMGIFDFVLGII 620

Query: 665  VGILIACFSFLVDSTKLQTINGEFNGQVARSTVYRDYIQTKFLNKVGEQIHVLKLQNLLF 724
            VGILIACFSFLVDSTKLQTINGE+NG VA+STVYRDY+QTKFL+ +GEQI+VLKLQNLLF
Sbjct: 621  VGILIACFSFLVDSTKLQTINGEYNGNVAKSTVYRDYVQTKFLDGIGEQIYVLKLQNLLF 680

Query: 725  FGTIISIEEKIDGLLEISDKDSSRQRIKYLILDFKNINADNIDYSAAEGFNRIKRFTETK 784
            FGTI+SIEEKI+ LL+IS+KD++++RIKYLILDFKNINADNIDYSAAEGFNRIKRFTETK
Sbjct: 681  FGTILSIEEKIEKLLQISNKDATKRRIKYLILDFKNINADNIDYSAAEGFNRIKRFTETK 740

Query: 785  RIQLIISSITEKDRIYNAFNKVGLLQDVELFADLNSALEWCENEFLLQYKQIRTR----- 839
            +I+LIISSI E+DRIYNAFN VGLL DVELFADLNSALEWCENEFL QYKQ+R +     
Sbjct: 741  KIKLIISSIRERDRIYNAFNNVGLLNDVELFADLNSALEWCENEFLFQYKQLRIKAKERL 800

Query: 840  ---------TXXXXXXXXXXXXHLSKSL--------------LPINTPRNNQIVTVAQKI 876
                     +             L   L              LP NTPRN Q+++VAQ +
Sbjct: 801  EERKQNNIVSAVMAATQNKNINALGNGLNKGNNIDPVRNLMSLPTNTPRNYQMLSVAQNV 860

Query: 877  F-PDEQNVTHLRTQYQKREXXXXXXXXXXXXFRPQIMSYDKDVKQAEEDFWSKLCPYFVR 935
            F  DEQ V + + +Y+  E            +RP I+S  + V++ E  FW++LCPYF R
Sbjct: 861  FVNDEQAVKNFKKEYKDDEPVLPILLFALKQYRPDIISEIQKVREKEIKFWAQLCPYFTR 920

Query: 936  KRFAPGSXXXXXXXXXXXVESGMLKITYDLHQGQFYETMSSKTCYGRI--SGNAEFTTNL 993
            +R A  S           VE+GMLK TY+L QG  YE  S+ TC+G+I   GNA      
Sbjct: 921  RRLASQSLLLHADNVFFLVETGMLKATYELPQGTLYEIFSNGTCFGKIIAPGNA-MPREQ 979

Query: 994  YVNIKTETDCAVWIIDXXXXXXXXXXXXXXXXELLLVVMSINQYRSKELLGYSLVSS 1050
             + I+TETD  +W+ID                E+ L+VM I   R KELLGY+LVS+
Sbjct: 980  KLTIETETDSILWVIDSSSLKKMKEENLALYVEVALMVMCIKDTRFKELLGYTLVSA 1036

>Suva_7.413 Chr7 (712372..715485) [3114 bp, 1037 aa] {ON} YGR125W
            (REAL)
          Length = 1037

 Score = 1081 bits (2795), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 591/1080 (54%), Positives = 727/1080 (67%), Gaps = 99/1080 (9%)

Query: 12   EAITISLGL-HSDNIKQPSQANRRSSMNPENSSNYYLGRSYV-GSFSSPSFLQRESSADT 69
            EAIT+SLG+ + D+ K        S+M+P       L RSY+ G F+  S     + +D 
Sbjct: 16   EAITVSLGINYQDSSKNKIHRASASTMSPP------LCRSYMSGFFTGGSSPMNYNMSDP 69

Query: 70   GHILSLHKDASKSIHESVKLHRQTAALSNNF-----DDSSDGKSDEIDVAASQEFQNEAL 124
                S +K   K IH S  LHRQTA LSN F     +++S    D +D+  S + +++  
Sbjct: 70   KLPFS-NKQHPKVIHGSENLHRQTAQLSNEFCSSSVEENSPTIKDYMDIIDSDDRKDDQS 128

Query: 125  QRELSLENGSYXXXXXXXXXXXQIAYSEDAITQENNGLNECTRLLSPTSAAATDLEYGTS 184
             R +                       E+ I +E    +E +RLL               
Sbjct: 129  MRTI-----------------------EENIDEEYA--DEYSRLL--------------- 148

Query: 185  PTNLSPPSSQYEQEQYVSLVADHSPSSAVYDQATGDGDNAFNTYHSLR-QPVVRSYYDYA 243
               LSP SS  + E+  +L    SP+S + D   G G  + +  H LR  P  RS + + 
Sbjct: 149  ---LSPASSNVDDERNRALQG--SPTSDLED-GHGGGYQSVHPSHDLRFGP--RSVWQWF 200

Query: 244  KGWSIKTLNYMPAVILGLLLNVLDALSYGMIIFPITEPVFSHLGPTGLSMFYVSTILSQL 303
              +  K   Y+PA +LGLLLN+LDALSYGMIIFPITEPVFSHLGPTG+SMFY+STI+SQ 
Sbjct: 201  TSFPSKFAQYLPAAVLGLLLNILDALSYGMIIFPITEPVFSHLGPTGISMFYISTIISQS 260

Query: 304  VYSCGFSAFGNGIGSEMIEITPFFHTMALSIMNSLPGHDDEIISTTIVCYALSSIFTGLA 363
            VYS G+S+F +G+GSEMIEITPF+HTMAL I  +L G DDEII+TTI CY +SS+ TG+ 
Sbjct: 261  VYSGGWSSFPSGVGSEMIEITPFYHTMALGIKEALVGSDDEIITTTIFCYVISSMLTGVV 320

Query: 364  FFLLGKLRLGKIVGFFPRHILIGCVGGVGYFLLITGIEVCTRVSKFEYSWPFLRELFYNT 423
            F++LGKLRLGKIVGFFPRHILIGC+GGVGYFL+ITGIEV TRV+KFEYSWPF+  LF N 
Sbjct: 321  FYVLGKLRLGKIVGFFPRHILIGCIGGVGYFLIITGIEVTTRVAKFEYSWPFVSGLFTNY 380

Query: 424  EVLGKWMLPLILTLSLIVTQHYFNNSLVLPSFYIITLALFHFVVAIVPNLSLNSLRESGW 483
            + L KW+LP++LT+ LI TQ  F NSLVLP+FYI+TL LFHF+VAI+P LSL++LR+SGW
Sbjct: 381  DTLAKWLLPVLLTVVLIGTQRCFKNSLVLPTFYILTLVLFHFIVAIIPTLSLDTLRDSGW 440

Query: 484  IFPMAGSSNHWYDFYKLYDFQNVHWTLVLKQVPTMLALTFFGILHVPINVPALAMSIGMD 543
            IFP+A S + WYD YKL++   VHWTLVL+Q+PTM+ALTFFGILHVPINVPALAMS+ MD
Sbjct: 441  IFPIASSDSKWYDHYKLFNIHKVHWTLVLQQIPTMMALTFFGILHVPINVPALAMSLQMD 500

Query: 544  KFDVDKELIAHGYSNLLSGFSGSIQNYLVYTNSFLFIRAGSDSSWAGFLLALGTFVVMXX 603
            K+DVDKELIAHGYSN  SG  GS+QNYLVYTNS LFIRAG+DSS+AGFLL   T  +M  
Sbjct: 501  KYDVDKELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGADSSFAGFLLVALTVCIMVI 560

Query: 604  XXXXXXXXXXXXXXXLIFLLGYELIKEALFDTWGKLNRFEYITIVIIVFTMGVFDFVLGI 663
                           LIFLLGYEL+ EAL DTW KLNRFEY+T+VIIVFTMG+FDFVLGI
Sbjct: 561  GPVIISFIPICIVGSLIFLLGYELLVEALVDTWSKLNRFEYLTVVIIVFTMGIFDFVLGI 620

Query: 664  IVGILIACFSFLVDSTKLQTINGEFNGQVARSTVYRDYIQTKFLNKVGEQIHVLKLQNLL 723
            IVGILIACFSFLVDSTKLQT+NGE+NG VA+STVYRDY+QTKFL+ +GEQI+VLKLQN+L
Sbjct: 621  IVGILIACFSFLVDSTKLQTVNGEYNGNVAKSTVYRDYVQTKFLDGIGEQIYVLKLQNVL 680

Query: 724  FFGTIISIEEKIDGLLEISDKDSSRQRIKYLILDFKNINADNIDYSAAEGFNRIKRFTET 783
            FFGTIISIEEKI+ LLEIS+KDS+++RIKYLILDFKNINADNIDYSAAEGFNRIKRFTET
Sbjct: 681  FFGTIISIEEKIERLLEISNKDSTKRRIKYLILDFKNINADNIDYSAAEGFNRIKRFTET 740

Query: 784  KRIQLIISSITEKDRIYNAFNKVGLLQDVELFADLNSALEWCENEFLLQYKQIRTRTXXX 843
            KRI+LIISSI E+D IYNAFN VGLL DVELFADLN ALEWCENEFL QYKQ+R +    
Sbjct: 741  KRIKLIISSIKERDHIYNAFNNVGLLNDVELFADLNGALEWCENEFLFQYKQLREKAKKR 800

Query: 844  XXXXXX------------------------------XXXHLSKSLLPINTPRNNQIVTVA 873
                                                   HL    LP NTPRN+Q+++VA
Sbjct: 801  LEERKQNNVVSAIMAATQNKKIDRSGIDLNKGGNRDQARHLMS--LPTNTPRNHQMLSVA 858

Query: 874  QKIFP-DEQNVTHLRTQYQKREXXXXXXXXXXXXFRPQIMSYDKDVKQAEEDFWSKLCPY 932
            Q +F  DEQ V +L+ +Y++ E            +RP I+S  + V++ E  FW++LCPY
Sbjct: 859  QNVFANDEQAVKNLKKEYKEDEPVLPILLFALKQYRPDIVSEVQKVREKEIKFWAQLCPY 918

Query: 933  FVRKRFAPGSXXXXXXXXXXXVESGMLKITYDLHQGQFYETMSSKTCYGRI--SGNAEFT 990
            F R+R A  S           +E+GMLK  Y+L QG  YE MS+ TC+G+I   GN    
Sbjct: 919  FSRRRLASQSLLLHADNVFFLIETGMLKAVYELPQGSLYEIMSNGTCFGKIIAPGNT-MP 977

Query: 991  TNLYVNIKTETDCAVWIIDXXXXXXXXXXXXXXXXELLLVVMSINQYRSKELLGYSLVSS 1050
                + I+TETD  +W+ID                E+ L++M I   R KELLGY+LVS+
Sbjct: 978  REQKLTIETETDSILWVIDSSSLKKMKEENLALYVEVTLMIMCIKDTRFKELLGYTLVSA 1037

>NCAS0E00950 Chr5 complement(171346..174504) [3159 bp, 1052 aa] {ON}
            Anc_3.485 YGR125W
          Length = 1052

 Score = 1075 bits (2780), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 590/1089 (54%), Positives = 738/1089 (67%), Gaps = 89/1089 (8%)

Query: 4    KKNRK-SISEAITISLGLHSDNIKQPSQANRRSSMNPEN-SSNYYLGRSYVGSF--SSPS 59
            KKN++ SIS +I++SLGL      Q  +  R    + EN ++N Y+GRSYV  F   SP+
Sbjct: 11   KKNKQQSISGSISVSLGL------QQEEEPRDDYFDDENVNNNNYMGRSYVSGFLSVSPA 64

Query: 60   FL----QRESSADTGHILSLHKDASKSIHESVKLHRQTAALSNNFDDSSDGK--SDEIDV 113
             +    Q E S    +     +  ++ IH S KLH+QTAA+S +F+D  D     D I +
Sbjct: 65   LMGSMKQDEESLPMAYNGG-QRLFNRPIHASEKLHKQTAAISEDFEDDEDDTRIKDYITL 123

Query: 114  AASQEF-----QNEALQRELSLENGSYXXXXXXXXXXXQIAYSEDAI--TQENNGLNECT 166
               ++      +N++L + L L                     ED I    E   ++E +
Sbjct: 124  FQGEDNGLMADKNDSLDQRLGLGQDE--------------EAEEDFIEPVAEAADVDESS 169

Query: 167  RLL-SPTSAAATDLEYGTSPTNLSPPSSQYEQEQYVSLVADHSPSSAVYDQATGDGDNAF 225
            RLL SP S+         +  +L P  +  +   Y S+    +PS +             
Sbjct: 170  RLLISPLSS-----NINPNIDDLLPTVTGEDVSSYQSIYRTATPSLS------------- 211

Query: 226  NTYHSLRQPVVRSYYDYAKGWSIKTLNYMPAVILGLLLNVLDALSYGMIIFPITEPVFSH 285
                ++ Q +    Y +        ++Y+PA +LGLLLN+LDALSYGMIIFPITEP+FSH
Sbjct: 212  RNSETIWQNIADFPYQF--------IHYLPAAVLGLLLNILDALSYGMIIFPITEPIFSH 263

Query: 286  LGPTGLSMFYVSTILSQLVYSCGFSAFGNGIGSEMIEITPFFHTMALSIMNSLPGHDDEI 345
            LGPTGLSMFY+STI+SQ +YS G+S+F +GIGSEMIE+TPFFHTMAL+I  +LPG DDEI
Sbjct: 264  LGPTGLSMFYISTIISQTIYSSGWSSFPSGIGSEMIEVTPFFHTMALAIKETLPGRDDEI 323

Query: 346  ISTTIVCYALSSIFTGLAFFLLGKLRLGKIVGFFPRHILIGCVGGVGYFLLITGIEVCTR 405
            I+TTI CY +SS+ TGL F+ LGKL LGKIVGFFPRHILIGC+GGVGYFLL+TGIEV TR
Sbjct: 324  ITTTIFCYVISSMLTGLTFYSLGKLHLGKIVGFFPRHILIGCIGGVGYFLLVTGIEVTTR 383

Query: 406  VSKFEYSWPFLRELFYNTEVLGKWMLPLILTLSLIVTQHYFNNSLVLPSFYIITLALFHF 465
            V+KFEYS PFL  LF +   L KW+LP++LT+ LIVTQ  F NSLVLPSFYI+TL LFHF
Sbjct: 384  VAKFEYSIPFLASLFSDWATLWKWLLPVLLTVILIVTQRCFKNSLVLPSFYILTLILFHF 443

Query: 466  VVAIVPNLSLNSLRESGWIFPMAGSSNHWYDFYKLYDFQNVHWTLVLKQVPTMLALTFFG 525
            +VAI+P+L+LN LR+SGWIFP+A S++ WYD YKL+DF+ VHWTLV KQ+PTMLALTFFG
Sbjct: 444  IVAIIPSLTLNQLRDSGWIFPIAISNSKWYDHYKLFDFKKVHWTLVFKQIPTMLALTFFG 503

Query: 526  ILHVPINVPALAMSIGMDKFDVDKELIAHGYSNLLSGFSGSIQNYLVYTNSFLFIRAGSD 585
            ILHVPINVPALAMS+ +DK+DVDKELIAHG SN +SG  GSIQNYLVYTNS LFIRAG+D
Sbjct: 504  ILHVPINVPALAMSLHLDKYDVDKELIAHGLSNFISGAVGSIQNYLVYTNSVLFIRAGAD 563

Query: 586  SSWAGFLLALGTFVVMXXXXXXXXXXXXXXXXXLIFLLGYELIKEALFDTWGKLNRFEYI 645
            S+ AG++L + T +VM                 LIFLLGYEL+ EAL+D WGK++ FEYI
Sbjct: 564  SAMAGYILIILTAIVMFIGPVIISFIPICIVGSLIFLLGYELLVEALWDPWGKISNFEYI 623

Query: 646  TIVIIVFTMGVFDFVLGIIVGILIACFSFLVDSTKLQTINGEFNGQVARSTVYRDYIQTK 705
            TIVIIV TMG+FDFVLGIIVGILIACFSFL+DSTKLQTINGE++G VA+STVYRD IQTK
Sbjct: 624  TIVIIVLTMGIFDFVLGIIVGILIACFSFLIDSTKLQTINGEYDGTVAKSTVYRDLIQTK 683

Query: 706  FLNKVGEQIHVLKLQNLLFFGTIISIEEKIDGLLEISDKDSSRQRIKYLILDFKNINADN 765
            FLN +GEQI+VLKLQNLLFFGTIISIEEKID LLEI  KDSSR RIKYLILDFKNINADN
Sbjct: 684  FLNGIGEQIYVLKLQNLLFFGTIISIEEKIDELLEICHKDSSRLRIKYLILDFKNINADN 743

Query: 766  IDYSAAEGFNRIKRFTETKRIQLIISSITEKDRIYNAFNKVGLLQDVELFADLNSALEWC 825
            IDYSAAEGFNRIKRFT+TK+IQL+ISSI E+D IY AF+ VGLL+ VELF DLNSALEWC
Sbjct: 744  IDYSAAEGFNRIKRFTQTKKIQLLISSIKERDHIYKAFDNVGLLKGVELFNDLNSALEWC 803

Query: 826  ENEFLLQYKQIRTRTXXXXXXXXXXXXHLS---------------------KSL--LPIN 862
            ENEFL +YKQ+R +             + S                     ++L  LPIN
Sbjct: 804  ENEFLFKYKQLRDKAKSRLHRKQIIDINASIGSQKYQFTAGNDKKSNLDIPRNLMSLPIN 863

Query: 863  TPRNNQIVTVAQKIFP-DEQNVTHLRTQYQKREXXXXXXXXXXXXFRPQIMSYDKDVKQA 921
            TPRN+QI++VAQ +F  +EQ V +L+T+ + +             +RP I+S DK VK+ 
Sbjct: 864  TPRNHQILSVAQNVFQNEEQTVKNLKTELKDQAPFLPLLLFTLKQYRPGIISTDKTVKEN 923

Query: 922  EEDFWSKLCPYFVRKRFAPGSXXXXXXXXXXXVESGMLKITYDLHQGQFYETMSSKTCYG 981
            E  FWS+LCPYFV+   A  S           VE+G+LK T++L QG  YETMS++TCYG
Sbjct: 924  EIKFWSQLCPYFVKLPLASQSTLIHNNNIFFIVETGILKATFNLPQGNIYETMSNRTCYG 983

Query: 982  RISGNAEFTTNLYVNIKTETDCAVWIIDXXXXXXXXXXXXXXXXELLLVVMSINQYRSKE 1041
            +I+G    +T   + I+ E D  +W+ID                EL L++M++   R KE
Sbjct: 984  KITGQHNESTLKTLTIRAEIDSILWVIDSGSLIKMRAENAELFTELTLLIMAVKDNRFKE 1043

Query: 1042 LLGYSLVSS 1050
            LLGY+LVS+
Sbjct: 1044 LLGYTLVSA 1052

>YGR125W Chr7 (742325..745435) [3111 bp, 1036 aa] {ON} Putative
            protein of unknown function; deletion mutant has
            decreased rapamycin resistance but normal wormannin
            resistance; green fluorescent protein (GFP)-fusion
            protein localizes to the vacuole
          Length = 1036

 Score = 1073 bits (2775), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 583/1077 (54%), Positives = 725/1077 (67%), Gaps = 94/1077 (8%)

Query: 12   EAITISLGLHSDNIKQPSQANRRSSMNPENSSNYYLGRSYV-GSFSSPSFLQRESSADTG 70
            EAI++SLG++ D+          S+M+P       L RSY+ G F+  +     + +D+ 
Sbjct: 16   EAISVSLGINQDSSVNKMHRASVSAMSPP------LCRSYMSGFFTGGNSPMINNLSDSK 69

Query: 71   HILSLHKDASKSIHESVKLHRQTAALSNNF-----DDSSDGKSDEIDVAASQEFQNEALQ 125
              +S +K   K IH S  LHRQTA LSN F     +++S    D +D+  + + +++   
Sbjct: 70   LPIS-NKQHPKVIHGSENLHRQTAQLSNEFCSSSVEENSPTIKDYMDIIGNGDRKDDQSM 128

Query: 126  RELSLENGSYXXXXXXXXXXXQIAYSEDAITQENNGLNECTRLLSPTSAAATDLEYGTSP 185
            R +                       E+ I +E +  +E +RLL                
Sbjct: 129  RTI-----------------------EENIDEEYS--DEYSRLL---------------- 147

Query: 186  TNLSPPSSQYEQEQYVSLVADHSPSSAVYDQATGDGDNAFNTYHSLR-QPVVRSYYDYAK 244
              LSP SS  + ++   L     P     +     G  +    H+LR +P  R+ +    
Sbjct: 148  --LSPASSNVDDDRNRGLQNSSLPE---LEDGYAGGYQSLRPSHNLRFRP--RNLWHMCT 200

Query: 245  GWSIKTLNYMPAVILGLLLNVLDALSYGMIIFPITEPVFSHLGPTGLSMFYVSTILSQLV 304
             +  K  +Y+PA +LGLLLN+LDALSYGMIIFPITEPVFSHLGPTG+SMFY+STI+SQ V
Sbjct: 201  SFPSKFAHYLPAAVLGLLLNILDALSYGMIIFPITEPVFSHLGPTGISMFYISTIISQAV 260

Query: 305  YSCGFSAFGNGIGSEMIEITPFFHTMALSIMNSLPGHDDEIISTTIVCYALSSIFTGLAF 364
            YS G+S+F +GIGSEMIEITPF+HTMAL+I  +L G+DDEII+TTI CY +SS+ TG+ F
Sbjct: 261  YSGGWSSFPSGIGSEMIEITPFYHTMALAIKEALAGNDDEIITTTIFCYVISSMLTGVVF 320

Query: 365  FLLGKLRLGKIVGFFPRHILIGCVGGVGYFLLITGIEVCTRVSKFEYSWPFLRELFYNTE 424
            + LGKLRLGKIVGFFPRHILIGC+GGVGYFL+ITGIEV TRV+KFEYSWPF   LF + +
Sbjct: 321  YALGKLRLGKIVGFFPRHILIGCIGGVGYFLIITGIEVTTRVAKFEYSWPFFSGLFTDYD 380

Query: 425  VLGKWMLPLILTLSLIVTQHYFNNSLVLPSFYIITLALFHFVVAIVPNLSLNSLRESGWI 484
             L KW+LP++LT+ LI TQ YF NSLVLPSFYI+TL LFHF+VAI+P LSL++LR++GWI
Sbjct: 381  TLAKWLLPVLLTVVLIGTQRYFKNSLVLPSFYILTLVLFHFIVAIIPTLSLDALRQAGWI 440

Query: 485  FPMAGSSNHWYDFYKLYDFQNVHWTLVLKQVPTMLALTFFGILHVPINVPALAMSIGMDK 544
            FP+A S + WYD Y+L++   VHW+LVL+Q+PTM+ALTFFGILHVPINVPALAMS+ MDK
Sbjct: 441  FPIANSDSKWYDHYRLFNVHKVHWSLVLQQIPTMMALTFFGILHVPINVPALAMSLQMDK 500

Query: 545  FDVDKELIAHGYSNLLSGFSGSIQNYLVYTNSFLFIRAGSDSSWAGFLLALGTFVVMXXX 604
            +DVD+ELIAHGYSN  SG  GS+QNYLVYTNS LFIRAG+DS +AGFLL   T  +M   
Sbjct: 501  YDVDRELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGADSPFAGFLLIALTICIMIIG 560

Query: 605  XXXXXXXXXXXXXXLIFLLGYELIKEALFDTWGKLNRFEYITIVIIVFTMGVFDFVLGII 664
                          LIFLLGYEL+ EAL DTW KLNRFEY+T+VIIVFTMG+FDFVLGII
Sbjct: 561  PVIISFIPICIVGSLIFLLGYELLVEALVDTWNKLNRFEYLTVVIIVFTMGIFDFVLGII 620

Query: 665  VGILIACFSFLVDSTKLQTINGEFNGQVARSTVYRDYIQTKFLNKVGEQIHVLKLQNLLF 724
            VGILIACFSFLVDSTKLQTINGE+NG VARSTVYRDY+QTKFL+ +GEQI+VLKLQNLLF
Sbjct: 621  VGILIACFSFLVDSTKLQTINGEYNGNVARSTVYRDYVQTKFLDGIGEQIYVLKLQNLLF 680

Query: 725  FGTIISIEEKIDGLLEISDKDSSRQRIKYLILDFKNINADNIDYSAAEGFNRIKRFTETK 784
            FGTIISIEEKI+ LL+IS+KD++++RIKYLILDFKNINADNIDYSAAEGFNRIKRFTETK
Sbjct: 681  FGTIISIEEKIERLLQISNKDATKRRIKYLILDFKNINADNIDYSAAEGFNRIKRFTETK 740

Query: 785  RIQLIISSITEKDRIYNAFNKVGLLQDVELFADLNSALEWCENEFLLQYKQIRTR----- 839
            RI+LIISSI E+DRIYNAFN VGLL DVELFADLNSALEWCENEFL QYKQ+R +     
Sbjct: 741  RIKLIISSIKERDRIYNAFNNVGLLNDVELFADLNSALEWCENEFLFQYKQLRKKAKERL 800

Query: 840  ---------TXXXXXXXXXXXXHLSKSL--------------LPINTPRNNQIVTVAQKI 876
                     +             +   L              LP NTPRN QI++VAQ +
Sbjct: 801  EEGKQNNVVSAVIAATKNKKIDTIGNGLNRGSNGDTARNLMSLPTNTPRNYQILSVAQNV 860

Query: 877  F-PDEQNVTHLRTQYQKREXXXXXXXXXXXXFRPQIMSYDKDVKQAEEDFWSKLCPYFVR 935
            F  DEQ V + + +Y+  E            +RP I+S  + V++ E  FW++LCPYF R
Sbjct: 861  FVNDEQAVKNFKKEYKDDEPVLPILLFALKQYRPDIISEVQKVREKEIKFWAQLCPYFTR 920

Query: 936  KRFAPGSXXXXXXXXXXXVESGMLKITYDLHQGQFYETMSSKTCYGRI--SGNAEFTTNL 993
            +R A  S           VE+GMLK TY+L QG  YE  S+ TC+G+I   GNA      
Sbjct: 921  RRLASQSHLLHADNIFFLVETGMLKATYELPQGTLYEIFSNGTCFGKIIAPGNA-MPREQ 979

Query: 994  YVNIKTETDCAVWIIDXXXXXXXXXXXXXXXXELLLVVMSINQYRSKELLGYSLVSS 1050
             + I+TETD  +W+ID                E+ L+VM I   R KELLGY+LVS+
Sbjct: 980  KLTIETETDSVLWVIDSSSLNKLKEDNLALYVEVALMVMCIKDTRFKELLGYTLVSA 1036

>NDAI0G00990 Chr7 complement(205221..208385) [3165 bp, 1054 aa] {ON}
            Anc_3.485 YGR125W
          Length = 1054

 Score = 1061 bits (2744), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 584/1081 (54%), Positives = 732/1081 (67%), Gaps = 65/1081 (6%)

Query: 4    KKNRKSISEAITISLGLHSDN---IKQPSQANRRSSMNPENSSNYYLGRSYVGSFSSPS- 59
            K NR SIS+ I++SLGL + +   ++QP+     +  N  ++SNY LGRSYV  F S S 
Sbjct: 5    KNNRHSISDTISVSLGLQNQDPQILQQPNGGPTVTLGNMSDTSNY-LGRSYVSGFLSASP 63

Query: 60   FLQRESSADTGHILSLHKDASKSIHESVKLHRQTAALSNNFDDSSDGKSDEIDVAASQEF 119
             +  +++ +T  I + H   +KSIH S  LHRQTAA+S +F++     + E D+   +  
Sbjct: 64   AINHDNNNNTLPIANQH--LNKSIHASQNLHRQTAAISEDFNND---PTFEDDINMKEYI 118

Query: 120  QNEALQRELSLENGS-YXXXXXXXXXXXQIAYSEDA-------ITQENNGLNECTRLLSP 171
             N  L+ + +  NG  Y               +E+A          EN+ L     LLSP
Sbjct: 119  SN--LEDDATGNNGKRYTAYYIDNEDRIDNILTEEAEPVTDFYPQDENSRL-----LLSP 171

Query: 172  TSAAATDLEYGTSPTNLSPPSSQYEQEQYVSLVADHSPSSAVYDQATGDGDNAFNTYHSL 231
              + +       +  NL P  S+ EQE      A    +SA   Q+    ++    Y S+
Sbjct: 172  IPSDSL-----LAGENLLPSISEQEQE-----TAQRRRTSAY--QSIRHRNSESTEYSSI 219

Query: 232  RQPVVRSYYDYAKGWSIKTLNYMPAVILGLLLNVLDALSYGMIIFPITEPVFSHLGPTGL 291
              P  R Y         + + Y+PA ILGLLL +LDALSYGMIIFPITEP+FSHLGPTG+
Sbjct: 220  --PTWRKYIATPS----EIIQYLPASILGLLLTILDALSYGMIIFPITEPIFSHLGPTGI 273

Query: 292  SMFYVSTILSQLVYSCGFSAFGNGIGSEMIEITPFFHTMALSIMNSLP-GHDDEIISTTI 350
            SMFY+STI+SQ ++S G+S+F  GIGSEMIE+TPFFHTMA +I ++LP G +D+II+TT+
Sbjct: 274  SMFYISTIISQSIFSGGWSSFPCGIGSEMIEVTPFFHTMAFAIKDALPEGSNDDIITTTL 333

Query: 351  VCYALSSIFTGLAFFLLGKLRLGKIVGFFPRHILIGCVGGVGYFLLITGIEVCTRVSKFE 410
             CY +SS+ TGL F+ LGKL LGKIVGFFPRHILIGC+GGVGYFL+ITGIEV TRV+KF+
Sbjct: 334  FCYVISSMLTGLTFYSLGKLHLGKIVGFFPRHILIGCIGGVGYFLIITGIEVSTRVAKFQ 393

Query: 411  YSWPFLRELFYNTEVLGKWMLPLILTLSLIVTQHYFNNSLVLPSFYIITLALFHFVVAIV 470
            Y+ PF+  LF +   L +W+LP +LT+ LI+ Q    NSLVLPSFYI+TL LFHF+VAI+
Sbjct: 394  YTIPFITHLFTDVVTLWQWLLPTLLTVILIIAQKCAQNSLVLPSFYILTLILFHFMVAII 453

Query: 471  PNLSLNSLRESGWIFPMAGSSNHWYDFYKLYDFQNVHWTLVLKQVPTMLALTFFGILHVP 530
            P+LSLN LR+SGWIFP A + + WYD YKL++   VHWTL+LKQ+PTMLALTFFGILHVP
Sbjct: 454  PSLSLNQLRDSGWIFPQAATDSKWYDHYKLFNLHKVHWTLILKQIPTMLALTFFGILHVP 513

Query: 531  INVPALAMSIGMDKFDVDKELIAHGYSNLLSGFSGSIQNYLVYTNSFLFIRAGSDSSWAG 590
            INVPALAMS+ MD++DVDKELIAHG SN +SG  GSIQNYLVYTNS LFIRAG+DS+ AG
Sbjct: 514  INVPALAMSLQMDRYDVDKELIAHGVSNFVSGMFGSIQNYLVYTNSVLFIRAGADSALAG 573

Query: 591  FLLALGTFVVMXXXXXXXXXXXXXXXXXLIFLLGYELIKEALFDTWGKLNRFEYITIVII 650
             +L + T ++M                 LIFLLGYEL+ EAL D  GK+++FEYITIVII
Sbjct: 574  HILIVLTIIIMIIGPVIISFIPICIVGSLIFLLGYELLVEALVDPLGKISKFEYITIVII 633

Query: 651  VFTMGVFDFVLGIIVGILIACFSFLVDSTKLQTINGEFNGQVARSTVYRDYIQTKFLNKV 710
            VFTMG+FDFVLG+IVGILIACFSFL+DSTKLQTINGEF+G VA+STVYRD IQTKFLN +
Sbjct: 634  VFTMGIFDFVLGVIVGILIACFSFLIDSTKLQTINGEFDGTVAKSTVYRDLIQTKFLNGI 693

Query: 711  GEQIHVLKLQNLLFFGTIISIEEKIDGLLEISDKDSSRQRIKYLILDFKNINADNIDYSA 770
            GEQI+VLKLQNLLFFGTIISIEEKID LLEISD DSS+ RIKYLILDFKNINADNIDYSA
Sbjct: 694  GEQIYVLKLQNLLFFGTIISIEEKIDKLLEISDMDSSKHRIKYLILDFKNINADNIDYSA 753

Query: 771  AEGFNRIKRFTETKRIQLIISSITEKDRIYNAFNKVGLLQDVELFADLNSALEWCENEFL 830
            AEGFNRIKRFT+TKRI+LIISSI E+D IYNAFN VGLL+ VELF DLNSALEWCENEFL
Sbjct: 754  AEGFNRIKRFTQTKRIRLIISSIRERDHIYNAFNNVGLLEGVELFNDLNSALEWCENEFL 813

Query: 831  LQYKQIRTRTXXXXXXXXXXXXHLSKS-----------------LLPINTPRNNQIVTVA 873
             +YK +R +T             ++                    LP+NTPRNNQ+++VA
Sbjct: 814  FKYKTLREKTRQKRKNKIDINLAITNGNPTEERNMHLEIPRNIMSLPMNTPRNNQMLSVA 873

Query: 874  QKIFP-DEQNVTHLRTQYQKREXXXXXXXXXXXXFRPQIMSYDKDVKQAEEDFWSKLCPY 932
            Q +F  +EQ    L+ Q++               +RP+I+S DK +++ E  FWS+LCPY
Sbjct: 874  QNVFRNEEQAAKALKQQFKNEPSVLPLLLFVLKQYRPRIVSNDKSIEEKEIKFWSQLCPY 933

Query: 933  FVRKRFAPGSXXXXXXXXXXXVESGMLKITYDLHQGQFYETMSSKTCYGRISGNAEFTTN 992
               +     S           VESG+LK T+ L  G  YETMS++TCYG+I G+   TT 
Sbjct: 934  LSERFLVAQSTLKHNNNFFFIVESGILKATFTLPSGTLYETMSNRTCYGKILGSNNETTV 993

Query: 993  LY---VNIKTETDCAVWIIDXXXXXXXXXXXXXXXXELLLVVMSINQYRSKELLGYSLVS 1049
            L    + IKTETDC +W+ID                EL+L++MSI   R KELLGY+LVS
Sbjct: 994  LNEQDLTIKTETDCNLWVIDMDALTRMRAENLELYIELVLLIMSIRDTRFKELLGYTLVS 1053

Query: 1050 S 1050
            +
Sbjct: 1054 A 1054

>CAGL0I10626g Chr9 complement(1048818..1052030) [3213 bp, 1070 aa]
            {ON} similar to uniprot|P53273 Saccharomyces cerevisiae
            YGR125w
          Length = 1070

 Score = 1059 bits (2739), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 561/1065 (52%), Positives = 709/1065 (66%), Gaps = 70/1065 (6%)

Query: 21   HSDNIKQPSQANRRSSMNPENSSNYYLGRSYVGSFSSPSFLQRESSADTGHILSLHKDAS 80
             S+++   ++ N ++   P N +N +LGRSYV      S  Q     +   +   +K  S
Sbjct: 41   ESNSLNVNARPNTKNVGIPNNDTNTFLGRSYVSGILGSSLPQ---GGERNTLPVSNKFGS 97

Query: 81   KSIHESVKLHRQTAALSNNFDDSSDGKSDEIDVAASQEFQN---EALQRELSLENGSYXX 137
            ++IHE  KLHRQTAA++  FDD + G+S     ++ +E+ N   EA + EL L N     
Sbjct: 98   RAIHEQNKLHRQTAAIAEEFDDGTIGESP----SSLKEYLNLLDEAQEEELDLRNRRDLD 153

Query: 138  XXXXXXXXXQIAYSEDAITQENNGLNECTRLLSPTSAAATDLEYGTSPTNLSPPSSQYEQ 197
                      ++ +    T       +   LL+P+S+   +    +   N    +S YEQ
Sbjct: 154  NDLITDNKTPVSINLKRATDPELE-QQTVALLTPSSSNNDNYGSVSPEENFLSATSNYEQ 212

Query: 198  E---QYVSLVADHSPSSAVYDQATGDGDNAFNTYHSLRQPVVRSYYDYAKGWSI--KTLN 252
            E   Q +++V    PS+      T                        AK W    +  N
Sbjct: 213  ESTYQSITVV----PSAGFRQMPTSTT---------------------AKAWMTLKRVTN 247

Query: 253  YMPAVILGLLLNVLDALSYGMIIFPITEPVFSHLGPTGLSMFYVSTILSQLVYSCGFSAF 312
            YMPA ILGLLLN+LDALSYGMIIFPITEP+F+ LGPTG+SMFY+STI+SQ +YS G+S+F
Sbjct: 248  YMPAAILGLLLNILDALSYGMIIFPITEPIFAQLGPTGISMFYISTIISQFIYSSGWSSF 307

Query: 313  GNGIGSEMIEITPFFHTMALSIMNSLPGHDDEIISTTIVCYALSSIFTGLAFFLLGKLRL 372
             +GIGSEMIEITPF+HTMAL+I  +LPG DDEII+TTI CY +SS+ TGL F+LLGKLRL
Sbjct: 308  PSGIGSEMIEITPFYHTMALAISQALPGRDDEIITTTIFCYVISSVITGLTFYLLGKLRL 367

Query: 373  GKIVGFFPRHILIGCVGGVGYFLLITGIEVCTRVSKFEYSWPFLRELFYNTEVLGKWMLP 432
            GKIVGFFPRHILIGC+GGVGYFL+ITG+EV TR++KFEYS PFL +LF ++ +L KW+LP
Sbjct: 368  GKIVGFFPRHILIGCIGGVGYFLIITGLEVTTRIAKFEYSIPFLTKLFLDSSMLFKWLLP 427

Query: 433  LILTLSLIVTQHYFNNSLVLPSFYIITLALFHFVVAIVPNLSLNSLRESGWIFPMAGSSN 492
             ILT+ LIVTQ  F NSLVLPSFYIITL LFHFVVAI PNLSL+ LR++GWIFP    S+
Sbjct: 428  TILTIILIVTQKCFKNSLVLPSFYIITLILFHFVVAIAPNLSLHQLRKTGWIFPAPEVSS 487

Query: 493  HWYDFYKLYDFQNVHWTLVLKQVPTMLALTFFGILHVPINVPALAMSIGMDKFDVDKELI 552
             WYD Y+ +D    HW+LV+KQ+PTMLALTFFGILHVPINVPALAMS+ MDK+DVDKELI
Sbjct: 488  KWYDHYRYFDIGKAHWSLVVKQIPTMLALTFFGILHVPINVPALAMSLQMDKYDVDKELI 547

Query: 553  AHGYSNLLSGFSGSIQNYLVYTNSFLFIRAGSDSSWAGFLLALGTFVVMXXXXXXXXXXX 612
            AHGYSN  SG  GS+QNYLVYTNS LFIRAG+DS+ AG++L + T +VM           
Sbjct: 548  AHGYSNFFSGLFGSVQNYLVYTNSVLFIRAGADSAIAGYVLIVLTIMVMVIGPVIISFIP 607

Query: 613  XXXXXXLIFLLGYELIKEALFDTWGKLNRFEYITIVIIVFTMGVFDFVLGIIVGILIACF 672
                  LIFLLGYEL+ EA+ D +GK+  FEY TI IIV TMG+FDFVLGI+VGILIACF
Sbjct: 608  ICIVGSLIFLLGYELLVEAMIDPFGKVTTFEYATIGIIVLTMGIFDFVLGIVVGILIACF 667

Query: 673  SFLVDSTKLQTINGEFNGQVARSTVYRDYIQTKFLNKVGEQIHVLKLQNLLFFGTIISIE 732
            SFLVDSTKLQT+NGEF+G VA+STVYRD+ QT+FL+++GEQI+VLKLQN+LFFGTIISIE
Sbjct: 668  SFLVDSTKLQTVNGEFDGTVAKSTVYRDFTQTRFLSQIGEQIYVLKLQNILFFGTIISIE 727

Query: 733  EKIDGLLEISDKDSSRQRIKYLILDFKNINADNIDYSAAEGFNRIKRFTETKRIQLIISS 792
            EKI+ LLEISD D S+ RIK+LILDFKNINADNIDYSAAEGFNRIKR+TE KRI+LIIS+
Sbjct: 728  EKIERLLEISDNDVSKHRIKFLILDFKNINADNIDYSAAEGFNRIKRYTEAKRIKLIIST 787

Query: 793  ITEKDRIYNAFNKVGLLQDVELFADLNSALEWCENEFLLQYKQIRT-------------- 838
            I E DRIY+ FN+VGLLQD+ELF DLNSALEWCENEFL QYK++R               
Sbjct: 788  IRESDRIYHVFNQVGLLQDIELFNDLNSALEWCENEFLYQYKELREKARNKLQRRSKNIN 847

Query: 839  -------RTXXXXXXXXXXXXHLSKSLLPI--NTPRNNQIVTVAQKIFPDEQNV-THLRT 888
                   R              L ++L+ +  NTPRN Q+V+ AQ+ F +EQ + T + T
Sbjct: 848  AAIGNQLRRYDQTNKNQGPTSSLMQNLMSLSNNTPRNYQLVSAAQQAFSNEQQISTEIDT 907

Query: 889  QYQKREXXXXXXXXXXXXFRPQIMSYDKDVKQAEEDFWSKLCPYFVRKRFAPGSXXXXXX 948
            + +  +            +RP I+S D + +  E +FW +LCPYF RK F   +      
Sbjct: 908  KLKIPDPLLKVLLFALKLYRPNIVSMDTEKRTDEVEFWKQLCPYFTRKVFTANTTFLHNN 967

Query: 949  XXXXXVESGMLKITYDLHQGQFYETMSSKTCYGRI---SGNAEFTTNLYVNIKTETDCAV 1005
                 V++G+LK+ Y+L  G  YET+S+ TCYG+I     N     NL V +  ETD  +
Sbjct: 968  NFFFLVDAGILKVIYNLPAGSVYETLSNGTCYGKILSKRDNENINQNLRVQV--ETDTIL 1025

Query: 1006 WIIDXXXXXXXXXXXXXXXXELLLVVMSINQYRSKELLGYSLVSS 1050
            WIID                EL+L++++I   R KELLGY+LVS+
Sbjct: 1026 WIIDEKSMEIMKMDNIVLYTELVLLILAIRDTRFKELLGYTLVSA 1070

>KLLA0E04731g Chr5 complement(418094..421276) [3183 bp, 1060 aa] {ON}
            similar to uniprot|P53273 Saccharomyces cerevisiae
            YGR125W Hypothetical ORF
          Length = 1060

 Score = 1058 bits (2735), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 574/1069 (53%), Positives = 713/1069 (66%), Gaps = 74/1069 (6%)

Query: 29   SQANRRSSMNPENSSNYYLGRSYVGSFSSPSFLQRESSADTGHIL-----------SLHK 77
            +  NR+ S     +S Y LGRSYVGSF SP    R +S  T +                 
Sbjct: 17   TAKNRKYSFQMPTTSTY-LGRSYVGSFISPPMEYRSNSNTTSNNNNNSNVGDPFKSPFSS 75

Query: 78   DASKSIHESVKLHRQTAALSNNFDDSS----------DGKSDEID---------VAASQE 118
            + SK IHES  LH+QTA LSN FD+ +          DG  DE +         V   Q 
Sbjct: 76   EGSKLIHESGNLHKQTAFLSNTFDNDAGNDEGAGFPLDGNDDEFNLEQNDIDMIVEEDQM 135

Query: 119  FQNEALQRE----------------LSLENGSYXXXXXXXXXXXQIAYSEDAITQENNGL 162
             QN   +R                 + LE+ +                 +D+   + +  
Sbjct: 136  LQNSQRRRGRMSVDAAADIEADAHLMDLEDMALKRADDVGIFSTSFPGKDDSSFLDVSDS 195

Query: 163  NECTRLLSPTSAAATDLEYGTSPTNLSPPSSQYEQEQYVSLVADHSPSSAVYDQATGDGD 222
             E   LL   S  +  +EYGT      P +      QY+SL+ D + S     Q      
Sbjct: 196  TENLALLPTNSHNSMYVEYGTFDEENQPAT------QYISLLPDGASSGGFTSQG----- 244

Query: 223  NAFNTYHSLRQPVVRSYYDYAKGWSIKTLNYMPAVILGLLLNVLDALSYGMIIFPITEPV 282
                     R  +  S+YD A+   ++   Y PAV LGLLLN+LDALSYGMIIFPITEP+
Sbjct: 245  --------FRSSM--SHYDKARDLMLRIFQYTPAVGLGLLLNILDALSYGMIIFPITEPL 294

Query: 283  FSHLGPTGLSMFYVSTILSQLVYSCGFSAFGNGIGSEMIEITPFFHTMALSIMNSLP-GH 341
            FSHLGPTGLSMFYVST++ QL +S G S+F + IGSEMIEITPFFHTMALSIMNS+P G+
Sbjct: 295  FSHLGPTGLSMFYVSTVICQLCFSLGLSSFPSAIGSEMIEITPFFHTMALSIMNSIPEGN 354

Query: 342  DDEIISTTIVCYALSSIFTGLAFFLLGKLRLGKIVGFFPRHILIGCVGGVGYFLLITGIE 401
            D+++ISTTIVCYALSSI TGL FFLLGK+RLGKIVGFFPRHILIGC+GGVGYFL+ITG+E
Sbjct: 355  DNKVISTTIVCYALSSIITGLTFFLLGKMRLGKIVGFFPRHILIGCIGGVGYFLIITGLE 414

Query: 402  VCTRVSKFEYSWPFLRELFYNTEVLGKWMLPLILTLSLIVTQHYFNNSLVLPSFYIITLA 461
            VCTRV +F+YSW FL  LF + ++L KW+ P+ILTL LI  Q   +NSLVLPSFYIITL 
Sbjct: 415  VCTRVPEFKYSWQFLSSLFTDFDILLKWLTPVILTLILISVQSRIHNSLVLPSFYIITLL 474

Query: 462  LFHFVVAIVPNLSLNSLRESGWIFPMAGSSNHWYDFYKLYDFQNVHWTLVLKQVPTMLAL 521
            LFHFVVA+VP+LSL+ LR+ GWIF    +  +WYDFYKLYDF+NV W+L+ KQVPTMLAL
Sbjct: 475  LFHFVVALVPSLSLDKLRDFGWIFAKVNAKENWYDFYKLYDFKNVQWSLIPKQVPTMLAL 534

Query: 522  TFFGILHVPINVPALAMSIGMDKFDVDKELIAHGYSNLLSGFSGSIQNYLVYTNSFLFIR 581
            TFFGILHVPINVPALAMS+ +DK+DVDKELIAHGYSNL+SGF GSIQNYLVYTNS LFIR
Sbjct: 535  TFFGILHVPINVPALAMSLNVDKYDVDKELIAHGYSNLISGFLGSIQNYLVYTNSVLFIR 594

Query: 582  AGSDSSWAGFLLALGTFVVMXXXXXXXXXXXXXXXXXLIFLLGYELIKEALFDTWGKLNR 641
            AG+DS  AG +L +GTF+VM                 LIFLLGYELI+EA+ DTWGKL  
Sbjct: 595  AGADSPIAGIMLTIGTFIVMVIGPVIISFIPICIVGSLIFLLGYELIQEAVIDTWGKLQP 654

Query: 642  FEYITIVIIVFTMGVFDFVLGIIVGILIACFSFLVDSTKLQTINGEFNGQVARSTVYRDY 701
            FEY+TI IIV TMGV DFV+GIIVGIL+ACFSFLV+ST+LQTINGE++G+VA+STVYRDY
Sbjct: 655  FEYLTIWIIVITMGVVDFVIGIIVGILLACFSFLVNSTQLQTINGEYDGKVAKSTVYRDY 714

Query: 702  IQTKFLNKVGEQIHVLKLQNLLFFGTIISIEEKIDGLLEISDKDSSRQRIKYLILDFKNI 761
            IQ+KFL  +GEQI+VLKLQN+LFFGTIISIEEK++ LLEI + DSS++RIKYLILDFKNI
Sbjct: 715  IQSKFLRNIGEQIYVLKLQNILFFGTIISIEEKVNSLLEICESDSSKKRIKYLILDFKNI 774

Query: 762  NADNIDYSAAEGFNRIKRFTETKRIQLIISSITEKDRIYNAFNKVGLLQDVELFADLNSA 821
             A +IDYSAAEGFNRIKRF E +RI LIISSI ++D+IY AF+KV L ++VELF+DLN A
Sbjct: 775  RAKSIDYSAAEGFNRIKRFLEKERIHLIISSIDKEDQIYLAFDKVRLFENVELFSDLNGA 834

Query: 822  LEWCENEFLLQYKQIRTRTXXXXXXXXXXXXHLSKSLLPINTPRNNQIVTVAQKIFPDEQ 881
            LEWCENEFL++YK+IRT+T            +   S LP+NTPRN+Q V+  + I+ +E 
Sbjct: 835  LEWCENEFLMRYKRIRTKTRARKLAQLKKSQN-RMSKLPVNTPRNHQFVSEVRNIYTEEM 893

Query: 882  NVTHLRTQYQKREXXXXXXXXXXXXFRPQIMSYDKDVKQAEEDFWSKLCPYFVRKRFAPG 941
             +  L  + ++R+            FR  I S ++  +  E D W +L  YF +K+F P 
Sbjct: 894  EIQKLSNELKERQQFLPIFLMSIRKFRNAIQSPNELKRTNELDLWKRLISYFQQKKFPPN 953

Query: 942  SXXXXXXXXXXXVESGMLKITYDLHQGQFYETMSSKTCYGRISG-NAEFTTNLYVNIKTE 1000
            +           VESG+L +T+ L QG+FYETMS KT YG IS  N++    L V+I T+
Sbjct: 954  TEIRHRNNMFIVVESGVLNLTHHLIQGEFYETMSPKTAYGVISNVNSD---PLAVSITTD 1010

Query: 1001 TDCAVWIIDXXXXXXXXXXXXXXXXELLLVVMSINQYRSKELLGYSLVS 1049
            T+C +  ID                ELL++VM+I++ R +ELLGYSL+S
Sbjct: 1011 TECVLRYIDAESLADLKLTDPELFTELLILVMAIHRDRFRELLGYSLIS 1059

>Kpol_480.18 s480 complement(36794..39967) [3174 bp, 1057 aa] {ON}
            complement(36794..39967) [3174 nt, 1058 aa]
          Length = 1057

 Score = 1054 bits (2726), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 579/1084 (53%), Positives = 723/1084 (66%), Gaps = 76/1084 (7%)

Query: 3    NKKNRKSISEAITISLGLHSDNIKQPSQANRRSSMNPENSSNY--------------YLG 48
            N++ R S SEA+++SLGLH   I        RS++ P + S Y               +G
Sbjct: 14   NRRVRPSFSEALSVSLGLHEQGI---GAGRTRSNLAPNSYSGYNDNTTSSVSNREFGRIG 70

Query: 49   RSYVGSFSSPSFLQRESSADTGHILSLHKDASKSIHESVKLHRQTAALSNNFDDSSDGKS 108
            RSY GS SS S     +++ T  +L + K  SKSI     LHRQTA +SN+F+D+S    
Sbjct: 71   RSYAGSISSNSPSLYLNTSRTDELLPIRKMPSKSILGPDALHRQTAEISNDFNDTS---M 127

Query: 109  DEIDVAASQEFQNEALQRELSLENGSYXXXXXXXXXXXQIAYSEDAITQENNGLNECTRL 168
            DE  +    E  N                         +    E A+    +   E    
Sbjct: 128  DEAKIKRYIELLNRK-------------------QIEAEEEGEESAVHLRPHTFIEGKSF 168

Query: 169  LSPTSAAATDLEYGTSPTNLSPPSSQYEQEQYVSLVADHSPSSAVYDQATGDGDNAFNTY 228
            LSP  ++A+ L+ G     L  PSS        S+V +     + YD+   D    +N+ 
Sbjct: 169  LSPIGSSASQLD-GLEQRALLTPSS--------SIVGNEFDLESTYDEINND----YNSI 215

Query: 229  HSLRQPVVRSYYDYAKGWSIKTLNYMPAVILGLLLNVLDALSYGMIIFPITEPVFSHLGP 288
              ++   + S     KG  ++ LNY+PA ILGLLLN+LDALSYGMIIFPITEP+FS LGP
Sbjct: 216  LRIQSRELTSSSFATKG--LELLNYLPAAILGLLLNILDALSYGMIIFPITEPLFSGLGP 273

Query: 289  TGLSMFYVSTILSQLVYSCGFSAFGNGIGSEMIEITPFFHTMALSIMNSLPGHDDEIIST 348
            TG+SMFY+STI+ QLV S GFS+F  GIGSEMIEITPF+HTMA +I ++LP  D+E+I+T
Sbjct: 274  TGISMFYISTIVCQLVLSGGFSSFPCGIGSEMIEITPFYHTMAFAIKDALPNQDNEVITT 333

Query: 349  TIVCYALSSIFTGLAFFLLGKLRLGKIVGFFPRHILIGCVGGVGYFLLITGIEVCTRVSK 408
            TI CY +SS+ TGL FF+LGKL++GKIVGFFPRHILIGC+GGVGYFL+ITGIEV TR+ K
Sbjct: 334  TIFCYVISSVVTGLVFFMLGKLKMGKIVGFFPRHILIGCIGGVGYFLIITGIEVSTRIGK 393

Query: 409  FEYSWPFLRELFYNTEVLGKWMLPLILTLSLIVTQHYFNNSLVLPSFYIITLALFHFVVA 468
            FEY+W FL  L  N + LGKW+LP +LTLSLI+ Q    NSLVLPSFYI+T+ LFHF+VA
Sbjct: 394  FEYNWEFLLSLLTNLDTLGKWLLPTLLTLSLILIQRQVQNSLVLPSFYILTIILFHFIVA 453

Query: 469  IVPNLSLNSLRESGWIFPMAGSSNHWYDFYKLYDFQNVHWTLVLKQVPTMLALTFFGILH 528
            I+PNLSL+ LRE+GWIFP+  S N WYD YK ++  ++HW LVLKQ+PTMLALTFFGILH
Sbjct: 454  ILPNLSLDHLRENGWIFPVTDSKNSWYDHYKYFNLHDIHWGLVLKQIPTMLALTFFGILH 513

Query: 529  VPINVPALAMSIGMDKFDVDKELIAHGYSNLLSGFSGSIQNYLVYTNSFLFIRAGSDSSW 588
            VPINVPALAMS+ MDK+DVD+ELIAHGYSNL+SG  GS+QNYLVYTNS LFIRAG+DSS 
Sbjct: 514  VPINVPALAMSLHMDKYDVDRELIAHGYSNLISGLLGSVQNYLVYTNSVLFIRAGADSSS 573

Query: 589  AGFLLALGTFVVMXXXXXXXXXXXXXXXXXLIFLLGYELIKEALFDTWGKLNRFEYITIV 648
            AGFLL   T VVM                 LIFLLGYEL+ EAL DT G +  FEYITI+
Sbjct: 574  AGFLLVALTVVVMVAGSVIVSFIPVCIVGSLIFLLGYELMVEALVDTIGTVTSFEYITIL 633

Query: 649  IIVFTMGVFDFVLGIIVGILIACFSFLVDSTKLQTINGEFNGQVARSTVYRDYIQTKFLN 708
            IIVF MG++DFVLGIIVGILIAC SF+VD TKL+TINGE++GQVA+STVYRDYIQTKFLN
Sbjct: 634  IIVFIMGIYDFVLGIIVGILIACLSFMVDGTKLETINGEYDGQVAKSTVYRDYIQTKFLN 693

Query: 709  KVGEQIHVLKLQNLLFFGTIISIEEKIDGLLEISDKDSSRQRIKYLILDFKNINADNIDY 768
             + +QI++LKLQN+LFFGTIISIEEKID LLEISDKD S++RIKYLILDFKNINADNIDY
Sbjct: 694  GIRQQIYLLKLQNVLFFGTIISIEEKIDKLLEISDKDPSKRRIKYLILDFKNINADNIDY 753

Query: 769  SAAEGFNRIKRFTETKRIQLIISSITEKDRIYNAFNKVGLLQDVELFADLNSALEWCENE 828
            SAAEGFNRIKRFT+ KRIQLIISSI EKD+IY+ FN V LL+DVELF DLNSALEWCENE
Sbjct: 754  SAAEGFNRIKRFTQGKRIQLIISSIKEKDKIYSVFNMVRLLEDVELFDDLNSALEWCENE 813

Query: 829  FLLQYKQIRTRT-----XXXXXXXXXXXXHLSKSL---------------LPINTPRNNQ 868
            FL QY Q+  +                  + S++                LPINTPRNNQ
Sbjct: 814  FLYQYMQLHEKAKDRIHKRISISKDSGSTYFSRNRSDSGLSAADQQMLMSLPINTPRNNQ 873

Query: 869  IVTVAQKIFPDE-QNVTHLRTQYQKREXXXXXXXXXXXXFRPQIMSYDKDVKQAEEDFWS 927
            +++VA+K+F +E Q  +  +T  +  +            FRP + S D  +++ E +FW 
Sbjct: 874  VLSVARKVFKNEAQTASKFKTHNETDKPVLSLLLYSIRLFRPDVFSEDVSIREKEINFWG 933

Query: 928  KLCPYFVRKRFAPGSXXXXXXXXXXXVESGMLKITYDLHQGQFYETMSSKTCYGRISGNA 987
            +L PYF R  F  GS           VESG++++T+DL QG   ETMS++TCYG++ G+ 
Sbjct: 934  QLSPYFRRSLFPTGSTLVNSSNFFFVVESGVVRVTHDLPQGIVSETMSNRTCYGKVVGHR 993

Query: 988  EFTTNL-YVNIKTETDCAVWIIDXXXXXXXXXXXXXXXXELLLVVMSINQYRSKELLGYS 1046
               TNL  +  KTET+  +W+ID                ELLL+VM+I +YR K L+GY+
Sbjct: 994  GTVTNLPKIIFKTETESIIWMIDDDTMSRIKKENLNLYTELLLLVMTIREYRYKGLIGYT 1053

Query: 1047 LVSS 1050
            LVS+
Sbjct: 1054 LVSA 1057

>KNAG0B00860 Chr2 complement(156225..159491) [3267 bp, 1088 aa] {ON}
            Anc_3.485 YGR125W
          Length = 1088

 Score = 1053 bits (2724), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 570/1099 (51%), Positives = 724/1099 (65%), Gaps = 73/1099 (6%)

Query: 4    KKNRKSISEAITISLGLHSDNIKQPSQANRRSSMNPENSSNYYLGRSYVGSFSSPSFLQR 63
            +  R+SISE+I++SLGL +++ +Q    N    +  E+S   YLGRSYV    SP+  QR
Sbjct: 11   RPARQSISESISVSLGLQNNDARQSDNENPLQVLPGESS---YLGRSYVSGLWSPT--QR 65

Query: 64   ESSADTGHILSLHKDA-SKSIHESVKLHRQTAALSNNFDDSS-DGKSDEIDVAASQEFQN 121
             + +    + + ++ A SK IH+S  LHRQT A+  NF DS+ D  S+  D+    +   
Sbjct: 66   NNKSGYDLLPTSNEQAYSKPIHKSQMLHRQTQAIGENFSDSNGDEGSENKDLNEYIDLVE 125

Query: 122  EALQRELSLEN----GSYXXXXXXXXXXXQIAYSEDAITQENNGLNECTRLL-SPTSAAA 176
               ++  +++N    G             +       ++ E    +E +RLL +P S+ +
Sbjct: 126  HNERKTANIDNVDQIGGLATGPQTTVPGNKTHPVTSPLSDEYGIPDENSRLLLTPVSSLS 185

Query: 177  TDLEYGTSPTNLSPPSSQYEQEQYVSLVADHSPSSAVYDQATGDGDNAFNTYHSLRQ--- 233
              +   +S   L+P       E Y       SP + + +   G      ++Y S      
Sbjct: 186  VAISDASS---LTP-------EDYNGRA--RSPLNGI-NSTYGSQIPTLSSYSSAGMKIG 232

Query: 234  PVVRSYYDYAKGWSIKTLNYMPAVILGLLLNVLDALSYGMIIFPITEPVFSHLGPTGLSM 293
            P + S +DY    S   ++Y+PA ILGLLLN+LDALSYGMIIFPITEP+FS LGP+GLSM
Sbjct: 233  PPITSKWDYISALSHDIVHYLPASILGLLLNILDALSYGMIIFPITEPIFSQLGPSGLSM 292

Query: 294  FYVSTILSQLVYSCGFSAFGNGIGSEMIEITPFFHTMALSIMNSL-PGHDDEIISTTIVC 352
            FY+ST++SQ  YS G+S+F  GIGSEMIE+TPFFHTMAL+IM +L     +EII+TTI C
Sbjct: 293  FYISTVISQFTYSSGWSSFPCGIGSEMIEVTPFFHTMALTIMKTLGEERKNEIITTTIFC 352

Query: 353  YALSSIFTGLAFFLLGKLRLGKIVGFFPRHILIGCVGGVGYFLLITGIEVCTRVSKFEYS 412
            Y +SS+FTGL FF LGKL+LGK+VGFFPRHILIGC+GGVGYFLLITGIEVCTR++KFEYS
Sbjct: 353  YVISSMFTGLTFFTLGKLKLGKLVGFFPRHILIGCIGGVGYFLLITGIEVCTRIAKFEYS 412

Query: 413  WPFLRELFYNTEVLGKWMLPLILTLSLIVTQHYFNNSLVLPSFYIITLALFHFVVAIVPN 472
             PFL  LF + + L +W+LP +LT+ LI TQ+ F NSLVLPSFYI+TL LFHF+VAIVPN
Sbjct: 413  IPFLLNLFTDEKTLFQWLLPTMLTIILIFTQNRFRNSLVLPSFYILTLILFHFIVAIVPN 472

Query: 473  LSLNSLRESGWIFPMAGSSNHWYDFYKLYDFQNVHWTLVLKQVPTMLALTFFGILHVPIN 532
            LSL  LR SGWIFP+A S+  WYD YK ++F +VHW LV+KQ+PTM+ALTFFGILHVPIN
Sbjct: 473  LSLTKLRNSGWIFPVAASNVTWYDHYKYFNFSDVHWALVIKQIPTMMALTFFGILHVPIN 532

Query: 533  VPALAMSIGMDKFDVDKELIAHGYSNLLSGFSGSIQNYLVYTNSFLFIRAGSDSSWAGFL 592
            VPALAMS+ MDK+DVD+ELIAHGYSN  SG  GSI+NYLVYTNS LFIRAG+DS+ AG++
Sbjct: 533  VPALAMSLQMDKYDVDRELIAHGYSNFFSGLFGSIENYLVYTNSVLFIRAGADSALAGYI 592

Query: 593  LALGTFVVMXXXXXXXXXXXXXXXXXLIFLLGYELIKEALFDTWGKLNRFEYITIVIIVF 652
            L + T +VM                 LIFLLGYEL+ EAL DTWGKLN FEY+T+ II+ 
Sbjct: 593  LIVLTIIVMLIGPVIISFIPICIVGSLIFLLGYELLMEALVDTWGKLNTFEYVTVGIIIL 652

Query: 653  TMGVFDFVLGIIVGILIACFSFLVDSTKLQTINGEFNGQVARSTVYRDYIQTKFLNKVGE 712
            TMG+FDFVLGIIVGILIACF FL+DST LQT+NGEF+G+VA+STVYRD IQT FL+ VGE
Sbjct: 653  TMGIFDFVLGIIVGILIACFKFLIDSTHLQTVNGEFSGEVAKSTVYRDPIQTTFLDGVGE 712

Query: 713  QIHVLKLQNLLFFGTIISIEEKIDGLLEISDKDSSRQRIKYLILDFKNINADNIDYSAAE 772
            QI+VLKLQNLLFFGTIISIEEKID LLEIS+ DSS++RIKYLILDFKNIN DNIDYSAAE
Sbjct: 713  QIYVLKLQNLLFFGTIISIEEKIDKLLEISNNDSSKRRIKYLILDFKNINTDNIDYSAAE 772

Query: 773  GFNRIKRFTETKRIQLIISSITEKDRIYNAFNKVGLLQDVELFADLNSALEWCENEFLLQ 832
            GFNRI+RFT+TK IQLIISSI EKD IY AFN VGLL+DVELF DLNS+LEWCENE L  
Sbjct: 773  GFNRIRRFTQTKGIQLIISSIREKDGIYRAFNNVGLLEDVELFQDLNSSLEWCENELLHW 832

Query: 833  YKQIRTRTXXXXXXXXXXXXHLSKSL-----------------------------LPINT 863
            Y ++RT+              +   L                             LP NT
Sbjct: 833  YNELRTKAKARLRKLNNTANSVVSRLPVSASKQMDSRAITSADQSGRAAISNLMSLPTNT 892

Query: 864  PRNNQIVTVAQKIFP-DEQNVTHLRTQYQKREXXXXXXXXXXXXFRPQIMSYDKDVKQAE 922
            PRN+Q++TVAQ +F  DEQ V+ LR Q + ++            +RP I S DK  +  E
Sbjct: 893  PRNHQMLTVAQDVFKNDEQTVSSLRKQLKTKDPLLPLLLLTLKQYRPDIGSNDKLARDKE 952

Query: 923  EDFWSKLCPYFVRKRFAPGSXXXXXXXXXXXVESGMLKITYDLHQGQFYETMSSKTCYGR 982
               WS+LCPYF +K     +           V++G+LK  + L QG  YETM+++TCYG+
Sbjct: 953  IAIWSRLCPYFAKKTMMAQTTLQHCNKIFFLVQTGVLKAVFKLPQGCVYETMANRTCYGK 1012

Query: 983  I-----------SGNAEFTTNLYVNIKTETDCAVWIIDXXXXXXXXXXXXXXXXELLLVV 1031
            I           + N +F+    + I TETD  +W+ID                +L L+V
Sbjct: 1013 IIDSGTTVDDADTSNPDFSK---LFITTETDSELWVIDAAAMGRLEREDPELFIQLALLV 1069

Query: 1032 MSINQYRSKELLGYSLVSS 1050
            M I   R K+LLG++L+S+
Sbjct: 1070 MLIKDKRFKDLLGHALISA 1088

>KAFR0C01910 Chr3 (382140..385202) [3063 bp, 1020 aa] {ON} Anc_3.485
            YGR125W
          Length = 1020

 Score = 1038 bits (2684), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 571/1061 (53%), Positives = 709/1061 (66%), Gaps = 72/1061 (6%)

Query: 7    RKSISEAITISLGLHSDNIKQPSQANRRSSMNP-ENSSNYYLGRSYVGSFSSPSFLQRES 65
            R S+S++I+ SLGL      Q  ++N   + N   NS + YL RSY+      +    E 
Sbjct: 15   RLSLSDSISRSLGL------QDQESNIAGTDNELSNSKSNYLSRSYMYGLLPSATPVEEL 68

Query: 66   SADTGHILSLHKD-ASKSIHESVKLHRQTAALSNNFDDSSDGK-SDEIDVAASQEFQNEA 123
              +T   L L  D  +KSIH+S  LH+QTAA+  +F++S +G   D +D   + +  N  
Sbjct: 69   ETNT---LPLSNDLRNKSIHQSRILHKQTAAICEDFNESDEGSMKDYLDFIENTDRDNIN 125

Query: 124  LQRELSLENGSYXXXXXXXXXXXQIAYSEDAITQENNGLNECTRLL-SPTSAAATDLEYG 182
              +E                    ++   D + +++    E +RLL +P+S+ A   E  
Sbjct: 126  EHKE-------------SLPVTVVLSTPADEVEEQD----ESSRLLLTPSSSNA---EVS 165

Query: 183  TSPTNLSPPSSQYEQEQYVSLVADHSPSSAVYDQATGDGDNAFNTYHSLRQPVVRSYYDY 242
            +    L        +  Y S+ +    +  + +Q     +   +T+          +Y+ 
Sbjct: 166  SIAEGL--------RHHYSSIESTKDNNMPIEEQQDNTINEKLSTF----------FYN- 206

Query: 243  AKGWSIKTLNYMPAVILGLLLNVLDALSYGMIIFPITEPVFSHLGPTGLSMFYVSTILSQ 302
                   TL Y PA +LGLLLN+LDALSYGMIIFPI+EP+FSHLGPTG+SMFY+STI+ Q
Sbjct: 207  -------TLQYFPASVLGLLLNILDALSYGMIIFPISEPIFSHLGPTGMSMFYISTIICQ 259

Query: 303  LVYSCGFSAFGNGIGSEMIEITPFFHTMALSIMNSLPGHD--DEIISTTIVCYALSSIFT 360
             +YS G+S+F + IGSEMIEITPFFHTMA +IM SLPG +  D II+TTI CY +SS+FT
Sbjct: 260  FIYSSGWSSFPSCIGSEMIEITPFFHTMAFAIMRSLPGEENQDAIITTTIFCYVISSMFT 319

Query: 361  GLAFFLLGKLRLGKIVGFFPRHILIGCVGGVGYFLLITGIEVCTRVSKFEYSWPFLRELF 420
            GL F  LGKLRLGKIVGFFPRHILIGC+GGVGYFLLITGIEV TR++KFEYS P ++ELF
Sbjct: 320  GLTFLTLGKLRLGKIVGFFPRHILIGCIGGVGYFLLITGIEVTTRIAKFEYSLPLIKELF 379

Query: 421  YNTEVLGKWMLPLILTLSLIVTQHYFNNSLVLPSFYIITLALFHFVVAIVPNLSLNSLRE 480
             +T +L KW+ P +LT+ LI+TQ  F  SLVLPSFYI TL LFHF+VAI+P LSL  LRE
Sbjct: 380  TDTSMLWKWLTPTLLTVVLILTQKCFKRSLVLPSFYIATLILFHFIVAIIPRLSLTQLRE 439

Query: 481  SGWIFPMAGSSNHWYDFYKLYDFQNVHWTLVLKQVPTMLALTFFGILHVPINVPALAMSI 540
            +GWIF     ++ WYD YKL+DF  VHW LV KQ+PTMLALTFFGILHVPINVPALAMS+
Sbjct: 440  AGWIFSNTAPNSAWYDHYKLFDFHKVHWLLVFKQIPTMLALTFFGILHVPINVPALAMSV 499

Query: 541  GMDKFDVDKELIAHGYSNLLSGFSGSIQNYLVYTNSFLFIRAGSDSSWAGFLLALGTFVV 600
             MDK+DVDKELIAHG SNL+SG  GSIQNYLVYTNS LFIRAG+DS +AG+LL   T VV
Sbjct: 500  QMDKYDVDKELIAHGLSNLVSGMFGSIQNYLVYTNSVLFIRAGADSPFAGYLLIFLTIVV 559

Query: 601  MXXXXXXXXXXXXXXXXXLIFLLGYELIKEALFDTWGKLNRFEYITIVIIVFTMGVFDFV 660
            M                 LIFLLGYEL+ EAL DTW KL  FEY+T+V+IV TMG+ DFV
Sbjct: 560  MLIGPVIISFIPICIVGSLIFLLGYELLVEALLDTWDKLTTFEYVTVVVIVLTMGIVDFV 619

Query: 661  LGIIVGILIACFSFLVDSTKLQTINGEFNGQVARSTVYRDYIQTKFLNKVGEQIHVLKLQ 720
            LGIIVGILIACF FL+DS+KLQTINGEF+G+VA+STV RD IQ+KFLN +G+QI+VLKLQ
Sbjct: 620  LGIIVGILIACFKFLIDSSKLQTINGEFSGKVAKSTVNRDLIQSKFLNGIGDQIYVLKLQ 679

Query: 721  NLLFFGTIISIEEKIDGLLEISDKDSSRQRIKYLILDFKNINADNIDYSAAEGFNRIKRF 780
            NLLFFGTIISIEEKID LLE+SD++SS+++IKYLILDF+NINADNIDYSAAEGFNRIKR 
Sbjct: 680  NLLFFGTIISIEEKIDKLLEMSDRNSSKRQIKYLILDFRNINADNIDYSAAEGFNRIKRL 739

Query: 781  TETKRIQLIISSITEKDRIYNAFNKVGLLQDVELFADLNSALEWCENEFLLQYKQIRTRT 840
            TE+K IQLIISSI  +DRIYN+FNKVGLL  VELF DLN ALEWCENEFL QYK IR R 
Sbjct: 740  TESKNIQLIISSIKVRDRIYNSFNKVGLLVGVELFNDLNGALEWCENEFLYQYKMIRERI 799

Query: 841  XXXXXXXXXXXX--HLSKS---LLPINTPRNNQIVTVAQKIFP-DEQNVTHLRTQYQKRE 894
                          +LSK     L INTPRN QI +VAQ IF  +EQ V  L+ ++Q + 
Sbjct: 800  KIKNVKTATHSSDGNLSKPSAMTLSINTPRNYQIYSVAQNIFKNEEQTVDRLKNRFQDQT 859

Query: 895  XXXXXXXXXXXXFRPQIMSYDKDVKQAEEDFWSKLCPYFVRKRFAPGSXXXXXXXXXXXV 954
                        +RP I+S DK  K  E +FWS+L PYF +KR A  S           V
Sbjct: 860  PVLPLLLFALKQYRPDIVSVDKVKKGKEIEFWSQLAPYFSKKRIASQSILYHGNNIFFLV 919

Query: 955  ESGMLKITYDLHQGQFYETMSSKTCYGRISGN-----AEFTTNLYVNIKTETDCAVWIID 1009
            E G+LK+T+DL QG+ YETMS + CYG+I G      A+  ++  + IKTE D  +WIID
Sbjct: 920  EIGVLKVTFDLPQGKVYETMSKRACYGKIMGKIPVSEADAPSSQAMIIKTEADTVIWIID 979

Query: 1010 XXXXXXXXXXXXXXXXELLLVVMSINQYRSKELLGYSLVSS 1050
                            EL+L+VM+I   R K LLG++LVS+
Sbjct: 980  SSALKKMKDENIELYLELVLLVMTIKDIRFKSLLGHALVST 1020

>ZYRO0C07986g Chr3 complement(609503..612577) [3075 bp, 1024 aa] {ON}
            similar to uniprot|P53273 Saccharomyces cerevisiae
            YGR125W Hypothetical ORF
          Length = 1024

 Score = 1009 bits (2609), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 507/830 (61%), Positives = 617/830 (74%), Gaps = 30/830 (3%)

Query: 251  LNYMPAVILGLLLNVLDALSYGMIIFPITEPVFSHLGPTGLSMFYVSTILSQLVYSCGFS 310
            L+Y P+ +LGLLLN+LD LSYGMIIFPITEP+FSHLG TGLSMFY+STI+SQ +YS G S
Sbjct: 195  LHYFPSAVLGLLLNILDGLSYGMIIFPITEPIFSHLGSTGLSMFYISTIISQCLYSGGLS 254

Query: 311  AFGNGIGSEMIEITPFFHTMALSIMNSLPGHDDEIISTTIVCYALSSIFTGLAFFLLGKL 370
            +F +GIGSEMIE+TPFFHTMA +I +++PG DD+II+TTI CYA+SS+ TG+ F+LLGKL
Sbjct: 255  SFTSGIGSEMIEVTPFFHTMAFAIRDAIPGQDDDIITTTIFCYAISSVVTGITFYLLGKL 314

Query: 371  RLGKIVGFFPRHILIGCVGGVGYFLLITGIEVCTRVSKFEYSWPFLRELFYNTEVLGKWM 430
            RLGKIVGFFPRHILIGC+GGVGYFLLITG+ V TR++K EY+W FL++LF +T++L KW+
Sbjct: 315  RLGKIVGFFPRHILIGCIGGVGYFLLITGLGVTTRLAKIEYTWEFLKKLFLDTDILWKWL 374

Query: 431  LPLILTLSLIVTQHYFNNSLVLPSFYIITLALFHFVVAIVPNLSLNSLRESGWIFPMAGS 490
            LP++LT+ L+ TQ  F NSLVLPSFYI+TL LFHFVVAIVP++SL+ LR+ GWIFP A S
Sbjct: 375  LPVVLTILLVNTQKCFQNSLVLPSFYIVTLILFHFVVAIVPSISLDQLRDLGWIFPAATS 434

Query: 491  SNHWYDFYKLYDFQNVHWTLVLKQVPTMLALTFFGILHVPINVPALAMSIGMDKFDVDKE 550
             + W+D YKL+D+  VHW LVL Q+PTMLALTFFGILHVPINVPALA+S+ MDKFDVDKE
Sbjct: 435  KDRWFDHYKLFDWHKVHWNLVLAQIPTMLALTFFGILHVPINVPALAISLHMDKFDVDKE 494

Query: 551  LIAHGYSNLLSGFSGSIQNYLVYTNSFLFIRAGSDSSWAGFLLALGTFVVMXXXXXXXXX 610
            LIAHGYSN +SG  GSIQNYLVYTNS LFIRAG+DS +AG++LA+ TF VM         
Sbjct: 495  LIAHGYSNFISGMVGSIQNYLVYTNSVLFIRAGADSPFAGYMLAILTFAVMVIGPVIVSF 554

Query: 611  XXXXXXXXLIFLLGYELIKEALFDTWGKLNRFEYITIVIIVFTMGVFDFVLGIIVGILIA 670
                    LIFLLGYEL+ EAL DT GK+  FEYITIVIIV TMG++DFVLG+IVGILIA
Sbjct: 555  IPICIVGSLIFLLGYELLVEALLDTRGKVTNFEYITIVIIVLTMGIYDFVLGVIVGILIA 614

Query: 671  CFSFLVDSTKLQTINGEFNGQVARSTVYRDYIQTKFLNKVGEQIHVLKLQNLLFFGTIIS 730
            CFSFLVDSTKLQTINGEF+G+VARSTV RDY+Q+ FLN VGEQI+VLKLQN+LFFGTIIS
Sbjct: 615  CFSFLVDSTKLQTINGEFDGKVARSTVNRDYVQSNFLNGVGEQIYVLKLQNVLFFGTIIS 674

Query: 731  IEEKIDGLLEISD-KDSSRQRIKYLILDFKNINADNIDYSAAEGFNRIKRFTETKRIQLI 789
            IEEKID LLEI+D K SS++RIKYLILDFKNINADNIDYSAAEGFNRIKRFT+TKRI+LI
Sbjct: 675  IEEKIDKLLEITDSKSSSKRRIKYLILDFKNINADNIDYSAAEGFNRIKRFTQTKRIKLI 734

Query: 790  ISSITEKDRIYNAFNKVGLLQDVELFADLNSALEWCENEFLLQYKQIRTRT--------- 840
            ISSI E+D IYN F+ VGLL DVELF DLN ALEWCENEFL +YK++R R          
Sbjct: 735  ISSIKERDHIYNVFSNVGLLDDVELFNDLNGALEWCENEFLGEYKKLRDRAREKMQHSYN 794

Query: 841  ------XXXXXXXXXXXXHLSK-----------SLLPINTPRNNQIVTVAQKIFPDEQNV 883
                               +SK           S LP+NTPRN+Q+++VAQ +F DE++V
Sbjct: 795  VTSAIEAAAAKKVPTDNNQISKKNLSLLNFRNLSSLPMNTPRNHQMLSVAQNMFNDEEDV 854

Query: 884  THLRTQY--QKREXXXXXXXXXXXXFRPQIMSYDKDVKQAEEDFWSKLCPYFVRKRFAPG 941
              L  +     ++            +R  I S D  +++ E   WS+L PYFV++R    
Sbjct: 855  DALEDESCNDGQQPVLPLLLFALKSYRKNITSTDPHLRERETQLWSQLVPYFVKRRLTTQ 914

Query: 942  SXXXXXXXXXXXVESGMLKITYDLHQGQFYETMSSKTCYGRISGNAEFTTNLY-VNIKTE 1000
            S           VESG+LKI  DL QG  YETMS++TC G I G+   ++  + V I TE
Sbjct: 915  SILLHNQDFFFVVESGLLKIALDLPQGVVYETMSNRTCCGNIVGSDYKSSEEHKVTIVTE 974

Query: 1001 TDCAVWIIDXXXXXXXXXXXXXXXXELLLVVMSINQYRSKELLGYSLVSS 1050
            TD  +W+ID                EL+L+ + I   R ++LLGY+LVS+
Sbjct: 975  TDTCLWLIDVDGLQKLRAENLQLYTELVLLCLLIKSRRFEQLLGYTLVSA 1024

 Score = 66.2 bits (160), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 48/150 (32%), Positives = 74/150 (49%), Gaps = 22/150 (14%)

Query: 5   KNRKSISEAITISLGLH------SDN--------------IKQPSQANRRSSMNPENSSN 44
           +NR+SIS AI++SLGL+      SD               I Q   ++      P  +SN
Sbjct: 10  RNRQSISGAISVSLGLNRQVHRNSDGEFTNYNNTNNNGGRINQNDSSSIEIVSPPFYNSN 69

Query: 45  YYLGRSYVGS--FSSPSFLQRESSADTGHILSLHKDASKSIHESVKLHRQTAALSNNFDD 102
            Y GRSY+G    S+   +  +   D   +L + +  SKSIH S  +HRQTA LSNNF D
Sbjct: 70  NYAGRSYLGGGFLSASPKMNLQQRNDDSSVLPIDRSRSKSIHGSQIIHRQTAELSNNFSD 129

Query: 103 SSDGKSDEIDVAASQEFQNEALQRELSLEN 132
            + G  +  +   + E +N +L   ++ ++
Sbjct: 130 DTTGMEEVRNRYDAMEDENSSLHHYMTHQD 159

>TDEL0D05530 Chr4 (999021..1002116) [3096 bp, 1031 aa] {ON} Anc_3.485
            YGR125W
          Length = 1031

 Score =  993 bits (2566), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 495/825 (60%), Positives = 619/825 (75%), Gaps = 21/825 (2%)

Query: 247  SIKTLNYMPAVILGLLLNVLDALSYGMIIFPITEPVFSHLGPTGLSMFYVSTILSQLVYS 306
            S K ++Y+PA ILGLLLNVLD LSYGMIIFPITEP+FSHLGP+GLSMFYVSTI+SQ++YS
Sbjct: 207  SSKLVHYLPATILGLLLNVLDGLSYGMIIFPITEPIFSHLGPSGLSMFYVSTIISQVIYS 266

Query: 307  CGFSAFGNGIGSEMIEITPFFHTMALSIMNSLPGHDDEIISTTIVCYALSSIFTGLAFFL 366
             GFS F  G+GSEMIE+TPFFH+MAL+I ++LPG DDEI++TTI CY +SS+ TGL F++
Sbjct: 267  SGFSNFPTGVGSEMIEVTPFFHSMALAIKDALPGRDDEILTTTIFCYVISSLVTGLTFYV 326

Query: 367  LGKLRLGKIVGFFPRHILIGCVGGVGYFLLITGIEVCTRVSKFEYSWPFLRELFYNTEVL 426
            LGK++LGKIVGFFPRHILIGC+GGVGYFL++TG+EV TRV+K EY+WPF+  +F +   L
Sbjct: 327  LGKMKLGKIVGFFPRHILIGCIGGVGYFLVVTGLEVTTRVAKLEYTWPFISHMFTDVSTL 386

Query: 427  GKWMLPLILTLSLIVTQHYFNNSLVLPSFYIITLALFHFVVAIVPNLSLNSLRESGWIFP 486
             KW+LP++LT+ LIVTQ +F NSLVLP+FYI TL  FHFVVAI+PN+SL  LR  GWIFP
Sbjct: 387  VKWVLPVLLTVLLIVTQRHFQNSLVLPTFYIATLVAFHFVVAIIPNVSLGKLRNMGWIFP 446

Query: 487  MAGSSNHWYDFYKLYDFQNVHWTLVLKQVPTMLALTFFGILHVPINVPALAMSIGMDKFD 546
            +A S + WYD YKL+    VHW L+ KQ PTMLAL+FFGILHVPINVPALA+S+ MDK+D
Sbjct: 447  VAASKDQWYDHYKLFQPHRVHWGLIAKQAPTMLALSFFGILHVPINVPALAISLQMDKYD 506

Query: 547  VDKELIAHGYSNLLSGFSGSIQNYLVYTNSFLFIRAGSDSSWAGFLLALGTFVVMXXXXX 606
            VDKELIAHGYSNLLSG  GSIQNYLVYTNS LFIRAG+DS+ AG+LLA  TF++M     
Sbjct: 507  VDKELIAHGYSNLLSGALGSIQNYLVYTNSLLFIRAGADSAMAGYLLAFLTFIMMVIGPV 566

Query: 607  XXXXXXXXXXXXLIFLLGYELIKEALFDTWGKLNRFEYITIVIIVFTMGVFDFVLGIIVG 666
                        LIFLLGYEL+ EAL +T GK+  FEYITI IIV TMG+FDFVLG+IVG
Sbjct: 567  IISYIPICIVGSLIFLLGYELLYEALIETRGKVTNFEYITICIIVLTMGIFDFVLGVIVG 626

Query: 667  ILIACFSFLVDSTKLQTINGEFNGQVARSTVYRDYIQTKFLNKVGEQIHVLKLQNLLFFG 726
            ILIACFSFLVDSTKLQTINGE++G++A+STVYRDY+Q++FL+ +GEQI+VLKLQ+LLFFG
Sbjct: 627  ILIACFSFLVDSTKLQTINGEYDGKIAKSTVYRDYVQSRFLDGIGEQIYVLKLQSLLFFG 686

Query: 727  TIISIEEKIDGLLEISD-KDSSRQRIKYLILDFKNINADNIDYSAAEGFNRIKRFTETKR 785
            TIISIEEKI+ LLEISD + +S++RIK LILD KNINADNIDYSAAEGFNRIKRFT++K 
Sbjct: 687  TIISIEEKINKLLEISDDQKNSKRRIKCLILDLKNINADNIDYSAAEGFNRIKRFTQSKH 746

Query: 786  IQLIISSITEKDRIYNAFNKVGLLQDVELFADLNSALEWCENEFLLQYKQIRTRTXXXXX 845
            IQLIISSI+E D IY AF+KV LL DVELF DLN ALEWCENE L +YK++R +      
Sbjct: 747  IQLIISSISETDHIYTAFSKVKLLDDVELFGDLNGALEWCENELLFKYKELRAKARDRLQ 806

Query: 846  XXXXXX----------------XHLSKSL--LPINTPRNNQIVTVAQKIFPDEQN-VTHL 886
                                   H  ++L  LP NTPRN+Q+++VAQ++F +EQ  V  L
Sbjct: 807  NKMQMANLAANNDTKAIDGVPKSHHMQNLMSLPFNTPRNDQMLSVAQRVFKNEQKTVDSL 866

Query: 887  RTQYQKREXXXXXXXXXXXXFRPQIMSYDKDVKQAEEDFWSKLCPYFVRKRFAPGSXXXX 946
            +  Y++              +RP I+S D +VK +E + WSKLCPYF R+R A  S    
Sbjct: 867  KVNYKELPPVLPLLLFALKPYRPGILSEDTNVKNSELELWSKLCPYFTRRRLASQSILLH 926

Query: 947  XXXXXXXVESGMLKITYDLHQGQFYETMSSKTCYGRI-SGNAEFTTNLYVNIKTETDCAV 1005
                   +E+G+LKI YDL QG  YE++S++TCYG + +      +   V IKTET+  +
Sbjct: 927  NSDIFFVMETGILKIVYDLPQGIVYESLSNRTCYGIVLNPGTRPCSESKVTIKTETEVVL 986

Query: 1006 WIIDXXXXXXXXXXXXXXXXELLLVVMSINQYRSKELLGYSLVSS 1050
            W+ID                EL+L++ ++ + R +++LGY+LVS+
Sbjct: 987  WVIDSSILARLKQENLSLYTELILLIATVKEQRYRQILGYTLVSA 1031

 Score = 63.9 bits (154), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 46/127 (36%), Positives = 67/127 (52%), Gaps = 15/127 (11%)

Query: 2   PNKKNRKSISEAITISLGL---------HSDNIKQPSQANRRSSMNPENSSNYYLGRSYV 52
           P  + R SISEAI++SLGL         H  N   P  +     M+P N+   YLGRSYV
Sbjct: 10  PRNRGRHSISEAISVSLGLQNTNTPRDHHDGNHSNPYDSQNDQFMSPRNN---YLGRSYV 66

Query: 53  GSFSSPSFLQRESSADTGHILSLHKDASKSIHESVKLHRQTAALSNNFDDSSDGKSDEID 112
             F S S     S++     L + +  +KSIH +  LHRQTA L  +F++ +   ++  D
Sbjct: 67  SGFLSCS--PYGSNSLESDRLPIARMRTKSIHAAKNLHRQTAKLCEDFNEPNVEDNNIQD 124

Query: 113 -VAASQE 118
            V+A++E
Sbjct: 125 YVSATEE 131

>AFR304W Chr6 (991645..994692) [3048 bp, 1015 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YGR125W
          Length = 1015

 Score =  988 bits (2555), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 539/1060 (50%), Positives = 684/1060 (64%), Gaps = 73/1060 (6%)

Query: 6    NRKSISEAITISLGLHSD-----NIKQPSQANRRSSMNPENSSNYYLGRSYVGSFS-SPS 59
            +R SISEA+ I L +        N   P      + M PE     YLGRSYVGSFS S S
Sbjct: 12   HRPSISEALNIQLNIPDSPSGGANAGGPVSERIPTLMRPEA----YLGRSYVGSFSNSGS 67

Query: 60   FLQRESSA---DTGHILSLHKDASKSIHESVKLHRQTAALSNNFDDSS--DGKSDEIDVA 114
             + RE+ A   D+  +      AS  +H    LHRQTAAL    DDS   DG  +E +  
Sbjct: 68   LMSREAGAAGPDSPPLPRFRDQASSYVHNGSHLHRQTAALC---DDSRAYDGGPEEEEAL 124

Query: 115  ASQEFQNEALQRELSLEN---GSYXXXXXXXXXXXQIAYSEDAITQENNGLNECTRLLSP 171
                F+   + +E +      G Y            +   ++A+   ++     TRL   
Sbjct: 125  V---FEGNMILQEGAPPRFGVGPYNLCKVDSNISEVLLNVDEAVDDSDSDQEAGTRLF-- 179

Query: 172  TSAAATDLEYGTSPTNLSPPSSQYEQEQYVSLVADHSPSSAVYDQATGDGDNAFNTYHSL 231
                            LSP ++ Y    Y ++  + S S       TG            
Sbjct: 180  ----------------LSPITTDYIH-SYGAINEEQSASETASRAETGP----------- 211

Query: 232  RQPVVRSYYDYAKGWSIKTLNYMPAVILGLLLNVLDALSYGMIIFPITEPVFSHLGPTGL 291
              P+        + W  +T+ Y+PAVILGLLLN+LDALSYGMIIFPI EP+FSHLGP GL
Sbjct: 212  -SPL--------RLWGTRTVRYIPAVILGLLLNILDALSYGMIIFPIAEPIFSHLGPHGL 262

Query: 292  SMFYVSTILSQLVYSCGFSAFGNGIGSEMIEITPFFHTMALSIMNSLPGH-DDEIISTTI 350
            SMFYVSTI+SQLVYS GFS+FG G GSEMIE+TPFFHTMALSI NSL     D+II+TTI
Sbjct: 263  SMFYVSTIISQLVYSGGFSSFGYGTGSEMIEVTPFFHTMALSIKNSLSAEKSDDIITTTI 322

Query: 351  VCYALSSIFTGLAFFLLGKLRLGKIVGFFPRHILIGCVGGVGYFLLITGIEVCTRVSKFE 410
            VCYALS+I TG  F  LGKLRLGK+V FFP HILIGC+GGV YFL+ITGIEV TRV+KFE
Sbjct: 323  VCYALSTIITGAVFLTLGKLRLGKLVSFFPLHILIGCIGGVAYFLIITGIEVSTRVTKFE 382

Query: 411  YSWPFLRELFYNTEVLGKWMLPLILTLSLIVTQHYFNNSLVLPSFYIITLALFHFVVAIV 470
            YS  FLR LF + ++L KW++P +L +S+I+ Q   +NS++LP FY+   ALFHF+VA++
Sbjct: 383  YSLAFLRNLFMDPDILAKWLIPALLAVSIILLQRRIHNSMLLPLFYLSAFALFHFIVALI 442

Query: 471  PNLSLNSLRESGWIFPMAGSSNHWYDFYKLYDFQNVHWTLVLKQVPTMLALTFFGILHVP 530
            P+LSL++LR+ GWIFP+  S   WYD+ +LY+ Q +HW LVL ++PTMLALTFFGILHVP
Sbjct: 443  PSLSLDTLRDKGWIFPLTESGGRWYDYLELYNPQRIHWELVLGEIPTMLALTFFGILHVP 502

Query: 531  INVPALAMSIGMDKFDVDKELIAHGYSNLLSGFSGSIQNYLVYTNSFLFIRAGSDSSWAG 590
            INVPALA+S G+DK DVDKELIAHGYSN+ SG +GSIQNYLVYTNS LFIRAG+DS +AG
Sbjct: 503  INVPALAISCGIDKIDVDKELIAHGYSNIFSGCAGSIQNYLVYTNSVLFIRAGADSRYAG 562

Query: 591  FLLALGTFVVMXXXXXXXXXXXXXXXXXLIFLLGYELIKEALFDTWGKLNRFEYITIVII 650
            FLLA+ TF+ M                 LIFLLGYEL+KE L+D++ +L+ FEYIT+VII
Sbjct: 563  FLLAIATFMTMTAGPWIISIIPVCIVSSLIFLLGYELLKEVLYDSYNRLSNFEYITVVII 622

Query: 651  VFTMGVFDFVLGIIVGILIACFSFLVDSTKLQTINGEFNGQVARSTVYRDYIQTKFLNKV 710
            + TMG+FDFVLGIIVG+L+ACFSFLV+ST+ +TI+ EF+G+VA+S  +RDY+Q+ FL KV
Sbjct: 623  ILTMGIFDFVLGIIVGVLVACFSFLVESTRAKTISSEFDGKVAKSACHRDYLQSNFLEKV 682

Query: 711  GEQIHVLKLQNLLFFGTIISIEEKIDGLLEISDKDSSRQRIKYLILDFKNINADNIDYSA 770
             EQI+VLKLQN LFFGTIISIEEKI  LLE  +    ++ IKYLILDFK+IN DNIDYSA
Sbjct: 683  AEQIYVLKLQNNLFFGTIISIEEKIGNLLE-PNGSEYKKIIKYLILDFKHINIDNIDYSA 741

Query: 771  AEGFNRIKRFTETKRIQLIISSITEKDRIYNAFNKVGLLQDVELFADLNSALEWCENEFL 830
            AEGFNRIKR  E KRI+LI+SSI+E D+IY  F+K+GLLQDVELF DLNSALEWCENE L
Sbjct: 742  AEGFNRIKRVMEIKRIKLIVSSISECDKIYTIFSKIGLLQDVELFQDLNSALEWCENELL 801

Query: 831  LQYKQIRTRTXXXXXXXXXXXXHLSKSLLPI-NTPRNNQIVTVAQKIFPDEQNVTHLRTQ 889
             +Y+ + +R              + K+ +P+ NTPRN QI+T AQ ++  EQ +    ++
Sbjct: 802  CEYRSLLSRAHRVKVRRRSKDI-VPKAQIPLENTPRNAQIMTAAQAVYSGEQQLNKTLSK 860

Query: 890  YQKREXXXXXXXXXXXXFRPQIMSYDKDVKQAEEDFWSKLCPYFVRKRFAPGSXXXXXXX 949
            Y+               +R    S     +  E   W  LCPYFVRK F+P +       
Sbjct: 861  YKASHPALALLLVALKTYR----SGHAYKETKEIRLWKHLCPYFVRKSFSPQTSISDEGD 916

Query: 950  XXXXVESGMLKITYDLHQGQFYETMSSKTCYGRISGNAEFTTNLYVNIKTETDCAVWIID 1009
                VESG+LKITY L QG   E ++SKTCYG ISG    + +  V  +TET+C +W+ID
Sbjct: 917  MFFVVESGLLKITYMLPQGSLQEAIASKTCYGNISGPGSLSYSSVV--RTETECVLWMID 974

Query: 1010 XXXXXXXXXXXXXXXXELLLVVMSINQYRSKELLGYSLVS 1049
                            ELL+V +S+ Q+R KELLG+SL++
Sbjct: 975  APGLQKLQEENLPLYTELLVVYISVIQHRFKELLGHSLIN 1014

>TBLA0C04440 Chr3 (1075482..1078934) [3453 bp, 1150 aa] {ON} Anc_3.485
            YGR125W
          Length = 1150

 Score =  988 bits (2555), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 556/1143 (48%), Positives = 715/1143 (62%), Gaps = 101/1143 (8%)

Query: 4    KKNRKSISEAITISLGLHSDN-----------------IKQPSQANRRS-SMNPENSSNY 45
             + R  +SEAI+ISLGL                     +    Q  + S S++P  S N 
Sbjct: 13   NRERNKLSEAISISLGLQEQQGNDNDKYNNDNSNIHGTLNNSRQRRKPSISLDPTLSRNI 72

Query: 46   ---------YLGRSY------VGSFSSPSFLQRESS--------ADTGHILSLHKDASKS 82
                     +L RS          F+S +F    S+        ++  H+  ++     S
Sbjct: 73   GARSFNCGAFLSRSIDNNLPTTDMFNSSTFRSSNSNNYFTHGLNSNNDHLPVINPFPKSS 132

Query: 83   IHESVKLHRQTAALSNNFDDS-SDGKSDEIDV------AASQEFQNEALQRELSLE-NGS 134
            IH S  LH++TA +SN F++S +D + D  +       + +Q   N     +  +E +G+
Sbjct: 133  IHGSDNLHKRTAEISNEFNNSPTDTEDDNANTETPNIPSTAQSSNNLNDSNDFMIELDGN 192

Query: 135  YXXXXXXXXXXXQIAYSEDAITQENN-----------GLNECTRLLS----------PTS 173
                        ++  +  ++    N           G NE  + +S          P  
Sbjct: 193  NNTNNSNNIVSSELPPTATSMFNNTNSTATSVQSLKIGNNEILKTISGDNGGIVNRLPIQ 252

Query: 174  AAATDLEYGTSPTNL--SPPSSQYEQEQYVSLVADHSPSSAVYDQATGDGDN----AFNT 227
                D+      + L  +P  S Y+ E      A    SS  YD    + +N    +  T
Sbjct: 253  ELDEDIIDNDEYSRLLPTPSPSIYDDEN-----ALFFSSSNNYDSTDLENNNYISSSIPT 307

Query: 228  YHSLRQPVVRSYYDYAKGWSIKTLNYMPAVILGLLLNVLDALSYGMIIFPITEPVFSHLG 287
               + Q    S+ D     S++ L+ +PA ILGLLLN+LDALSYGMI+FPIT+ VF HLG
Sbjct: 308  TTDVTQSTSLSFKDMLTKHSLQILHDIPACILGLLLNILDALSYGMILFPITDSVFGHLG 367

Query: 288  PTGLSMFYVSTILSQLVYSCGFSAFGNGIGSEMIEITPFFHTMALSIMNSLPGHD-DEII 346
            PTGLSMFY+STI+SQLVYS GFSAF +G+G EMIEI PFFHTMAL++ NS+P  D +EII
Sbjct: 368  PTGLSMFYISTIISQLVYSGGFSAFPSGLGGEMIEIVPFFHTMALTVKNSIPSKDQNEII 427

Query: 347  STTIVCYALSSIFTGLAFFLLGKLRLGKIVGFFPRHILIGCVGGVGYFLLITGIEVCTRV 406
            +TTI CY +S IFTG+ FF LGK +LGK+VGFFPRHILIGC+GGVGYFL++TGIEV TRV
Sbjct: 428  TTTIFCYVISCIFTGIVFFCLGKFKLGKLVGFFPRHILIGCIGGVGYFLIVTGIEVTTRV 487

Query: 407  SKFEYSWPFLRELFYNTEVLGKWMLPLILTLSLIVTQHYFNNSLVLPSFYIITLALFHFV 466
             K EYS  FL  +  N   L K +LP+ L++ L + Q  +++SL+LPSFYIIT   FHF+
Sbjct: 488  KKLEYSLEFLLSVITNMSTLFKLVLPISLSVLLNILQKIYSHSLLLPSFYIITFIAFHFI 547

Query: 467  VAIVPNLSLNSLRESGWIFPMAGSSNHWYDFYKLYDFQNVHWTLVLKQVPTMLALTFFGI 526
            VA+VPNLSL+SLR +GWIFP+A SS+ WY  YK ++F N HW LV KQ+PTM ALTFFGI
Sbjct: 548  VALVPNLSLDSLRATGWIFPVAESSDTWYSHYKYFNFFNCHWDLVFKQIPTMFALTFFGI 607

Query: 527  LHVPINVPALAMSIGMDKFDVDKELIAHGYSNLLSGFSGSIQNYLVYTNSFLFIRAGSDS 586
            LHVPINVPALAMS+ MDK+DVDKELIAHGYSNL+SG  GS+QNYLVYTNS LFIRAG ++
Sbjct: 608  LHVPINVPALAMSVQMDKYDVDKELIAHGYSNLISGLFGSVQNYLVYTNSVLFIRAGGNT 667

Query: 587  SWAGFLLALGTFVVMXXXXXXXXXXXXXXXXXLIFLLGYELIKEALFDTWGKLNRFEYIT 646
            + AG +LA  T +++                 LIFLLG+ELI EAL DTWGK+ +FEYIT
Sbjct: 668  ASAGLVLAGFTAIILFIGPVIISFIPVCIVGSLIFLLGWELIVEALLDTWGKVTKFEYIT 727

Query: 647  IVIIVFTMGVFDFVLGIIVGILIACFSFLVDSTKLQTINGEFNGQVARSTVYRDYIQTKF 706
            I+IIVFTMG++DFVLGI+VGILIACFSFLVDSTKLQT+NGEFNG VA+STVYRDY+Q++F
Sbjct: 728  IMIIVFTMGIYDFVLGILVGILIACFSFLVDSTKLQTVNGEFNGTVAKSTVYRDYVQSQF 787

Query: 707  LNKVGEQIHVLKLQNLLFFGTIISIEEKIDGLLEISDKDSSRQRIKYLILDFKNINADNI 766
            L+ + EQI+VLKLQN+LFFGTIISIEEKID LLEISD DSS++RIKYLILD KN+N+DNI
Sbjct: 788  LSGIAEQIYVLKLQNVLFFGTIISIEEKIDMLLEISDNDSSKRRIKYLILDLKNVNSDNI 847

Query: 767  DYSAAEGFNRIKRFTETKRIQLIISSITEKDRIYNAFNKVGLLQDVELFADLNSALEWCE 826
            DYSAAEGFNRIKRFT++KRIQLIISSI + D+IY  FN V LL++VELF+DLN ALEWCE
Sbjct: 848  DYSAAEGFNRIKRFTQSKRIQLIISSIKDTDKIYKMFNNVNLLENVELFSDLNGALEWCE 907

Query: 827  NEFLLQYKQIRT---------RTXXXXXXXXXXXXHLSKSL--------LPINTPRNNQI 869
            NEFL QY+Q++           T             +S +L        LPINTPRN+Q+
Sbjct: 908  NEFLYQYRQVKNKARARAKRKATSRDVVRTGYLSTSVSNTLNDRKSSGNLPINTPRNHQM 967

Query: 870  VTVAQKIFPD-EQNVTHLRTQYQKREXXXXXXXXXXXXFRPQIMSYDKDVKQAEEDFWSK 928
            V+VA+ IF + EQ V    T   K              +R  I S D  V+  E +FWS+
Sbjct: 968  VSVAKNIFQNIEQPVRSFSTNLNKSIPVLELLVFALKQYRSDIFSDDNKVRDKEVEFWSQ 1027

Query: 929  LCPYFVRKRFAPGSXXXXXXXXXXXVESGMLKITYDLHQGQFYETMSSKTCYGRISGNAE 988
            LCPYF ++  A  +           VESG+LK+ ++L QG  YETMS++TCYGRI G   
Sbjct: 1028 LCPYFTKQPLANKTSLLHNNNVFFIVESGVLKMEFNLPQGSVYETMSNRTCYGRILGKGY 1087

Query: 989  FTTNLY-VNIKTETDCAVWIIDXXXXXXXXXXXXXXXXELLLVVMSINQYRSKELLGYSL 1047
               +   +NIK ETDC +W+I+                EL L+VMS+   R   LLGY+L
Sbjct: 1088 LKKSTSPLNIKAETDCIIWLINSEGLDKMKAENLELYTELTLLVMSVKDDRFNNLLGYAL 1147

Query: 1048 VSS 1050
            +S+
Sbjct: 1148 ISA 1150

>TPHA0D04210 Chr4 (908861..912010) [3150 bp, 1049 aa] {ON} Anc_3.485
            YGR125W
          Length = 1049

 Score =  947 bits (2447), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 523/1097 (47%), Positives = 696/1097 (63%), Gaps = 95/1097 (8%)

Query: 1    MPNKKNRK----SISEAITISLGLHSD-NIKQPSQAN-RRSSMN---PENSSNYYLGRSY 51
            MP++K  +    S SEA+++SLGL    N++   +AN +R+++    P  S+N       
Sbjct: 1    MPSRKKERRVSSSFSEALSVSLGLQEQGNLRSTERANVKRNAIFDEFPLESTNSLTLPDS 60

Query: 52   VGSFSSPSFLQRESSADTGHILSLHKDA---------SKSIHESVKLHRQTAALSNNFDD 102
            +   ++   +  +   D     + + D+          KSI  +  LHRQTA LS  F D
Sbjct: 61   MSMKNNTVNINDKLVPDNSKNRTFYNDSIYPPENKTSMKSITVADILHRQTAELSKTFYD 120

Query: 103  SSDGKSDEIDVAASQEFQNEALQRELSLENGSYXXXXXXXXXXXQIAYSEDAI-TQENNG 161
            S+    D  D         + +  +++  N S            +      AI TQ++  
Sbjct: 121  SNFTDKDVKDYI-------DIIDNDVATSNESDSNSTPEPYLGDEYDQHRLAIRTQKSPN 173

Query: 162  L--NECTRLLSPTSA---AATDLEYGTSPTNLSPPSSQYEQEQYVSLVADHSPSSAVYDQ 216
            +  +E +RLL+P+S+   A  DLE            + Y++ + V + A           
Sbjct: 174  IADDEQSRLLTPSSSIIGAELDLE------------AHYDEFEPVRMDAS---------- 211

Query: 217  ATGDGDNAFNTYHSLRQPVVRSYYDYAKGWSIKTLNYMPAVILGLLLNVLDALSYGMIIF 276
                         S+ +       D+++      L+Y PA +LGLLLN+LDALSYGMIIF
Sbjct: 212  -------------SINRQNESKLIDFSQ-----ILHYFPAAVLGLLLNILDALSYGMIIF 253

Query: 277  PITEPVFSHLGPTGLSMFYVSTILSQLVYSCGFSAFGNGIGSEMIEITPFFHTMALSIMN 336
            PITEP+F+++G  G+SMFY+S+I+ Q + S GFS+F  GIGSEMIEITPF+HTMAL+I N
Sbjct: 254  PITEPIFANMGTAGISMFYISSIICQYILSGGFSSFPTGIGSEMIEITPFYHTMALAIKN 313

Query: 337  SLPGHDDEIISTTIVCYALSSIFTGLAFFLLGKLRLGKIVGFFPRHILIGCVGGVGYFLL 396
            SL   + EIISTTI CY +SS+ TGL F+ LGKL+LGKIV FFPRHILIGC+GGVGYFL+
Sbjct: 314  SLDVQE-EIISTTIFCYVISSLVTGLVFYSLGKLKLGKIVAFFPRHILIGCIGGVGYFLV 372

Query: 397  ITGIEVCTRVSKFEYSWPFLRELFYNTEVLGKWMLPLILTLSLIVTQHYFNNSLVLPSFY 456
            +TG+EV TRV+K EYSW FL  L  +  ++GKW+ P++LT  LI TQH+F NSLVLPSFY
Sbjct: 373  VTGLEVTTRVAKVEYSWEFLSYLLSDFNIIGKWLTPILLTTILIFTQHHFQNSLVLPSFY 432

Query: 457  IITLALFHFVVAIVPNLSLNSLRESGWIFPMAGSSNHWYDFYKLYDFQNVHWTLVLKQVP 516
            IIT+ LFHF+VA+VP LSLN LR+SGWIFP+  S++ W+D YK ++  NV W L+LKQ+P
Sbjct: 433  IITIILFHFIVALVPMLSLNKLRDSGWIFPLTNSNDKWFDHYKYFNVYNVSWVLILKQMP 492

Query: 517  TMLALTFFGILHVPINVPALAMSIGMDKFDVDKELIAHGYSNLLSGFSGSIQNYLVYTNS 576
            TMLALTFFGILHVPINVPALAMS+ +DKFDVD+E IAHGYSN LSG  GS+QNYLVYTNS
Sbjct: 493  TMLALTFFGILHVPINVPALAMSLNIDKFDVDREFIAHGYSNFLSGLFGSVQNYLVYTNS 552

Query: 577  FLFIRAGSDSSWAGFLLALGTFVVMXXXXXXXXXXXXXXXXXLIFLLGYELIKEALFDTW 636
             LFIRAG+DS  AG+LL + T +VM                 LIFLLGYEL+ EAL DT 
Sbjct: 553  VLFIRAGADSPIAGYLLIVLTAIVMLIGPVIISFIPICIVGSLIFLLGYELLIEALLDTV 612

Query: 637  GKLNRFEYITIVIIVFTMGVFDFVLGIIVGILIACFSFLVDSTKLQTINGEFNGQVARST 696
            GK+  FEY TI+IIVFTMG++DFVLGIIVGIL+AC  F+VD TKLQTIN E++G +A+ST
Sbjct: 613  GKVTFFEYTTIIIIVFTMGIYDFVLGIIVGILLACIKFMVDGTKLQTINTEYDGTIAKST 672

Query: 697  VYRDYIQTKFLNKVGEQIHVLKLQNLLFFGTIISIEEKIDGLLEISDKDSSRQRIKYLIL 756
            VYRD+IQ+KFL+ +GEQI+++KLQN+LFFGTIISIEEKID LL++SD DSS+ RI+YLIL
Sbjct: 673  VYRDFIQSKFLDGIGEQIYLIKLQNVLFFGTIISIEEKIDTLLQLSDSDSSKHRIRYLIL 732

Query: 757  DFKNINADNIDYSAAEGFNRIKRFTETKRIQLIISSITEKDRIYNAFNKVGLLQDVELFA 816
            DFKNIN DNIDYSAAEGFNRIKRFT  + I+LIISSIT  D+IY AFNK+GLLQD+ELF+
Sbjct: 733  DFKNINDDNIDYSAAEGFNRIKRFTHGRHIKLIISSITHTDKIYKAFNKIGLLQDIELFS 792

Query: 817  DLNSALEWCENEFLLQYKQIRTRTXXXXXXXXXXXX-------------------HLSKS 857
            DLN+ LEWCEN++L +Y+++  +                                  S+ 
Sbjct: 793  DLNNGLEWCENKYLEKYRELHEKAKKRLHSRMSILQDKNISSRQINSTSSDGNEYQSSQR 852

Query: 858  L--LPINTPRNNQIVTVAQKIFPDE-QNVTHLRTQYQKREXXXXXXXXXXXXFRPQIMSY 914
            L  LP+NTPRN+Q+++VA+ +F +E Q V+  +      +            FRP + S 
Sbjct: 853  LMSLPLNTPRNHQLLSVARNVFKNETQAVSRFKNLDNGEDAFTQLLLQSIRRFRPDVFSE 912

Query: 915  DKDVKQAEEDFWSKLCPYFVRKRFAPGSXXXXXXXXXXXVESGMLKITYDLHQGQFYETM 974
             KD++  E  FW++L PYF +      S           ++SG++K+T+DL  G+  ETM
Sbjct: 913  SKDIRAQEIKFWTQLAPYFNKIFVETNSTFLNENNFFFLLDSGVIKVTHDLAPGKLSETM 972

Query: 975  SSKTCYGRISGNAEFTTNLY-VNIKTETDCAVWIIDXXXXXXXXXXXXXXXXELLLVVMS 1033
             S+T YG +S     T   + V    ET   +W+ID                EL L++MS
Sbjct: 973  LSRTSYGILSSKNNRTYKTHKVTFIPETKSVIWLIDSEGLKKMEKENLKLYSELTLLIMS 1032

Query: 1034 INQYRSKELLGYSLVSS 1050
            I+ YR K LLGY+LV++
Sbjct: 1033 ISDYRFKALLGYTLVNA 1049

>Skud_16.286 Chr16 complement(525800..528037) [2238 bp, 745 aa] {ON}
           YPR003C (REAL)
          Length = 745

 Score = 50.1 bits (118), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 56/286 (19%), Positives = 123/286 (43%), Gaps = 23/286 (8%)

Query: 548 DKELIAHGYSNLLSGFSGSIQNYLVYTNSFLFIRAGSDSSWAGFLLALGTFVVMXXXXXX 607
           ++EL+A G+ N++    G++ ++  Y  S +   +G+ S  +G  + + T + M      
Sbjct: 398 NRELVALGFMNIVISLFGALPSFGGYGRSKINALSGAQSVMSGVFVGIITLITMNLLLQF 457

Query: 608 XXXXXXXXXXXLIFLLGYELIKEALFDTWGKLNRFEYITIVIIVFTMGVFDFVLGIIVGI 667
                      +  ++G  L++E   D    L    Y  + +   T GV   +  I  GI
Sbjct: 458 VHYIPNCVLSVITTVIGISLLEEVPGDIKFHLRCGGYSELFVFAVTFGV-TILCSIEAGI 516

Query: 668 LIACFSFLVDSTKLQTING-EFNGQVARSTVYR---DYIQTKFLNKVG--------EQIH 715
            I C   +++  K    +  +   +VA ++ +    DY++T   N +G        E   
Sbjct: 517 CIGCVYSILNIIKHSAKSRIQILARVAGTSNFTNLDDYLRTMKKNPLGGENRLEEVEGCM 576

Query: 716 VLKLQNLLFFGTIISIEEKIDGLLEISDKD--------SSRQRIKYLILDFKNINADNID 767
           ++++   L F     +++++D +                S+  IKY+I D   + +  ID
Sbjct: 577 IVRIPEPLTFTNSEDLKQRLDRIERFGSSKIHPGRKSFRSKDSIKYVIFDLGGMTS--ID 634

Query: 768 YSAAEGFNRIKRFTETKRIQLIISSITEKDRIYNAFNKVGLLQDVE 813
            SAA+  + I    + + + + +++++  D+I     K G++ ++E
Sbjct: 635 SSAAQVLDEIITSYKRRNVFIYVANVSINDKIRTRLLKAGVIPNLE 680

>Smik_16.241 Chr16 complement(438048..440282) [2235 bp, 744 aa] {ON}
           YPR003C (REAL)
          Length = 744

 Score = 45.8 bits (107), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 53/287 (18%), Positives = 122/287 (42%), Gaps = 26/287 (9%)

Query: 548 DKELIAHGYSNLLSGFSGSIQNYLVYTNSFLFIRAGSDSSWAGFLLALGTFVVMXXXXXX 607
           ++EL+A G+ N++    G++ ++  Y  S +   +G+ S  +G  + + T + M      
Sbjct: 398 NRELVALGFMNIVISLFGALPSFGGYGRSKINALSGAQSVISGVFVGVITLITMNLLLQF 457

Query: 608 XXXXXXXXXXXLIFLLGYELIKEALFDTWGKLNRFEYITIVIIVFTMGV---FDFVLGII 664
                      +  ++G  L++E   D    L    Y  + +   T GV   +    GI 
Sbjct: 458 VHYIPNCVLSVITTVIGISLLEEVPSDIKFHLRCGGYSELFVFAVTFGVTIFYSIEAGIC 517

Query: 665 VGILIACFSFLVDSTKLQTINGEFNGQVARSTVYR---DYIQTKFLNKVG-------EQI 714
           +G + +  + +  S K +    +   +VA ++ +    DY+     N +        E  
Sbjct: 518 IGCVYSILNIIKHSAKSRI---QILARVAGTSNFTNLDDYLMNMKRNPLSIENTEEIEGC 574

Query: 715 HVLKLQNLLFFGTIISIEEKIDGLLEISDKD--------SSRQRIKYLILDFKNINADNI 766
            ++++   L F     +++++D +                S+  IKY+I D   + +  +
Sbjct: 575 MIVRIPEPLTFTNSEDLKQRLDRIERFGSSKIHPGRKSFRSKDSIKYVIFDLGGMTS--L 632

Query: 767 DYSAAEGFNRIKRFTETKRIQLIISSITEKDRIYNAFNKVGLLQDVE 813
           D SAA+  + I    + + + + +++++  D+I    +K G++ +VE
Sbjct: 633 DSSAAQVLDEIITSYKRRNVFIYLANVSINDKIRTRLSKAGVIPNVE 679

>Suva_16.322 Chr16 complement(565605..567833) [2229 bp, 742 aa] {ON}
           YPR003C (REAL)
          Length = 742

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 58/290 (20%), Positives = 116/290 (40%), Gaps = 31/290 (10%)

Query: 548 DKELIAHGYSNLLSGFSGSIQNYLVYTNSFLFIRAGSDSSWAGFLLALGTFVVMXXXXXX 607
           ++EL+A G  N+     G++ ++  Y  S +   +G+ S  +G  + + T + M      
Sbjct: 398 NRELVALGCINMFISLFGALPSFGGYGRSKINALSGAQSVMSGVFVGIITLITMKLLLQF 457

Query: 608 XXXXXXXXXXXLIFLLGYELIKEALFDTWGKLNRFEYITIVIIVFTMGV---FDFVLGII 664
                      +  ++G  L++E   D    L    Y  + +   T GV   +    GI 
Sbjct: 458 VHYIPNCVLSVITTVIGISLLEEVPGDIKFHLQCGGYSELFVFAVTFGVTIFYSIESGIC 517

Query: 665 VGILIACFSFLVDSTK-----LQTINGEFNGQVARSTVYRDYIQTKFLNKVG-------- 711
           +G + +  + +  S K     L  I G  N      T   DY++T   N           
Sbjct: 518 IGCVYSILNIIKHSAKSRIQILARIAGTSN-----FTNLDDYLRTTKKNPPAVEGRIEEI 572

Query: 712 EQIHVLKLQNLLFFGTIISIEEKIDGLLEISDKD--------SSRQRIKYLILDFKNINA 763
           E   ++++   L F     +++++D +                S+  IKY+I D   + +
Sbjct: 573 EGCMIVRIPEPLTFTNSEDLKQRLDRIERFGSSKIHPGRKSFRSKDSIKYVIFDLGGMTS 632

Query: 764 DNIDYSAAEGFNRIKRFTETKRIQLIISSITEKDRIYNAFNKVGLLQDVE 813
             ID SAA+  + I    + + + + +++++  D+I     K G+  +VE
Sbjct: 633 --IDSSAAQVLDEIISCYKRRNVFIYLANVSINDKIRTRLLKAGVTPNVE 680

>SAKL0H08800g Chr8 (753145..755007) [1863 bp, 620 aa] {ON} similar
           to uniprot|Q74ZI9 Ashbya gossypii AGR213C AGR213Cp and
           weakly similar to YPR003C uniprot|P53394 Saccharomyces
           cerevisiae YPR003C Hypothetical ORF
          Length = 620

 Score = 37.4 bits (85), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 53/261 (20%), Positives = 99/261 (37%), Gaps = 44/261 (16%)

Query: 548 DKELIAHGYSNLLSGFSGSIQNYLVYTNSFLFIRAGSDSSWAGFLLALGTFVVMXXXXXX 607
           ++EL++ G  NL+S    ++  +  Y  S + I  G+ + ++G  ++L   + M      
Sbjct: 272 NRELVSLGVVNLVSSIFSALPAFGGYGRSKMNISCGAQTQFSGVFVSLLAIICMNFLMNA 331

Query: 608 XXXXXXXXXXXLIFLLGYELIKEALFDT---WGKLNRFEYITIVIIVFTMGVFDFVLGII 664
                      +I  + + L++EA  D    W      E    +IIV T  V+    G+ 
Sbjct: 332 FHHLPICILAVIISTVAFSLLEEAPADLMFYWSVGGYQELFIFIIIVVTTLVWSPQFGVT 391

Query: 665 VGILIACFSFLVDSTKLQTINGEFNGQVARSTVYRDYIQTKFLN-----------KVGEQ 713
           +G+ +     L  ST+ +              + RD I   F N           +  E+
Sbjct: 392 MGMCLTMIRLLKHSTRSRV-----------QILGRDPITYTFKNIDDDENSDIPLEEIEK 440

Query: 714 IHVLKLQNLLFFGTIISIEEKID-----GLLEI------------SDKDSSRQRIKYLIL 756
           + V+K+   L F  +  +   +      G L++            S   S +  +KYL++
Sbjct: 441 VMVVKIPEPLIFSNVSDLRTSLKRMEKYGSLKVHPSYPLPLRQMLSPTTSGQVSLKYLVI 500

Query: 757 DFKNINADNIDYSAAEGFNRI 777
           D   +    ID SA +    I
Sbjct: 501 DLFGMT--YIDISALQALREI 519

>YPR003C Chr16 complement(561504..563768) [2265 bp, 754 aa] {ON}
           Putative sulfate permease; physically interacts with
           Hsp82p; green fluorescent protein (GFP)-fusion protein
           localizes to the ER; YPR003C is not an essential gene
          Length = 754

 Score = 37.4 bits (85), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 55/291 (18%), Positives = 118/291 (40%), Gaps = 34/291 (11%)

Query: 548 DKELIAHGYSNLLSGFSGSIQNYLVYTNSFLFIRAGSDSSWAGFLLALGTFVVMXXXXXX 607
           ++EL+A G+ N++    G++  +  Y  S +   +G+ S  +G  + + T + M      
Sbjct: 408 NRELVALGFMNIVISLFGALPAFGGYGRSKINALSGAQSVMSGVFMGVITLITMNLLLQF 467

Query: 608 XXXXXXXXXXXLIFLLGYELIKEALFDTWGKL--NRFEYITIVIIVFTMGVF-DFVLGII 664
                      +  ++G  L++E   D    L    F  + +  + F   +F     GI 
Sbjct: 468 VHYIPNCVLSVITTIIGISLLEEVPGDIKFHLRCGGFSELFVFAVTFCTTIFYSIEAGIC 527

Query: 665 VGILIACFSFLVDSTKLQTINGEFNGQVARSTVYR---DYIQTKFLNKVG-------EQI 714
           +G + +  + +  S K +    +   +VA ++ +    DY+     N +        E  
Sbjct: 528 IGCVYSIINIIKHSAKSRI---QILARVAGTSNFTNLDDYMMNMKRNSLDVEGTEEIEGC 584

Query: 715 HVLKLQNLLFFGTIISIEEKID------------GLLEISDKDSSRQRIKYLILDFKNIN 762
            ++++   L F     +++++D            G   +  KDS    IKY+I D   + 
Sbjct: 585 MIVRIPEPLTFTNSEDLKQRLDRIERYGSSKIHPGRKSLRSKDS----IKYVIFDLGGMT 640

Query: 763 ADNIDYSAAEGFNRIKRFTETKRIQLIISSITEKDRIYNAFNKVGLLQDVE 813
           +  ID SAA+    I    + + + + + +++  D++     K G+   VE
Sbjct: 641 S--IDSSAAQVLEEIITSYKRRNVFIYLVNVSINDKVRRRLFKAGVAASVE 689

>Suva_11.314 Chr11 (569449..571194) [1746 bp, 581 aa] {ON} YKR078W
           (REAL)
          Length = 581

 Score = 35.8 bits (81), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 33/63 (52%), Gaps = 10/63 (15%)

Query: 458 ITLALFHFVVAIVPNLSLNSLRESGWIFPMAGSSN-------HWYDFYKLY-DFQNVHWT 509
           +T  L+H  + I+P   LNSL++S W+  ++   N        + DFY LY   QN HW 
Sbjct: 113 MTGQLYH--IKILPGSDLNSLKDSLWVVKISTEHNAEKTIARSFADFYWLYHQLQNNHWG 170

Query: 510 LVL 512
            V+
Sbjct: 171 KVI 173

>SAKL0B03124g Chr2 complement(288006..290240) [2235 bp, 744 aa] {ON}
           similar to uniprot|P53394 Saccharomyces cerevisiae
           YPR003C Hypothetical ORF
          Length = 744

 Score = 35.0 bits (79), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 56/294 (19%), Positives = 121/294 (41%), Gaps = 23/294 (7%)

Query: 548 DKELIAHGYSNLLSGFSGSIQNYLVYTNSFLFIRAGSDSSWAGFLLALGTFVVMXXXXXX 607
           ++EL+A G  NL+    G++ ++  Y  S +   +G+ +  +G  +   T   +      
Sbjct: 400 NRELVALGSLNLIGSLFGALPSFGGYGRSKINAYSGAQTVVSGACMGTITMFTIKFLLKF 459

Query: 608 XXXXXXXXXXXLIFLLGYELIKEALFDTWGKLNRFEY---ITIVIIVFTMGVFDFVLGII 664
                      +  ++G  L++EA  D    +    Y   I+ +I V T   +    GI 
Sbjct: 460 IRYIPVCVLSVITTVVGLSLLEEAPADLRFHIRCRGYNELISFIITVLTTFFYSVEAGIT 519

Query: 665 VGILIACFSFLVDSTKLQT-INGEFNG--QVARSTVY--RDYIQTKFLNKVGEQIH---V 716
           VG   +    +  STK +  I G+  G  +   +  Y  ++    + +N   E+I    +
Sbjct: 520 VGCGYSIIRVIKHSTKSRIQILGKLAGTNKFVNADEYEGKNSTSERRVNPQLEEIEGCLI 579

Query: 717 LKLQNLLFFGTIISIEEKIDGL--------LEISDKDSSRQRIKYLILDFKNINADNIDY 768
           +++   L F     ++ +++ L           + +   ++  KY+I D   +    ID 
Sbjct: 580 VRIPEPLTFTNTDDLKTRLNRLELYGSTKTHPAAPRSRDQEMTKYVIFDLHGMT--TIDS 637

Query: 769 SAAEGFNRIKRFTETKRIQLIISSITEKDRIYNAFNKVGLLQDVELFADLNSAL 822
           SA +    I    + + + + +  +    ++ N F   G+L+ VE  +D++ +L
Sbjct: 638 SAIQILQEIISSYKRRHVHVFLVRVPSARKVRNRFVNSGILEMVE--SDIHRSL 689

>ZYRO0F04796g Chr6 (399222..401429) [2208 bp, 735 aa] {ON} similar
           to uniprot|P53394 Saccharomyces cerevisiae YPR003C
           Hypothetical ORF
          Length = 735

 Score = 35.0 bits (79), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 55/285 (19%), Positives = 111/285 (38%), Gaps = 21/285 (7%)

Query: 548 DKELIAHGYSNLLSGFSGSIQNYLVYTNSFLFIRAGSDSSWAGFLLALGTFVVMXXXXXX 607
           ++EL+A G  NL S   GS+  +  Y  S +   +G+ +  +G  + L   + +      
Sbjct: 393 NRELVALGSMNLFSSILGSLPAFGGYGRSKINAFSGAQTVMSGAFMGLLVLLTIKFLLPM 452

Query: 608 XXXXXXXXXXXLIFLLGYELIKEALFDTWGKLNRFEY---ITIVIIVFTMGVFDFVLGII 664
                      +  ++G  L++EA  D       F Y   +   + V T   +   +GI 
Sbjct: 453 IHYIPICVLSVVTTMVGISLLEEAPADLMFHFRCFGYDELLVFTLTVLTTMFYSVEVGIC 512

Query: 665 VGILIACFSFLVDSTK-----LQTINGE---FNGQVARSTVYRDYIQTKFLNKVGEQIHV 716
           +G   +  S +  S K     L  + G     N         R++       +  E   +
Sbjct: 513 IGCGYSVISIIKHSAKSRIQILARVQGTSRFVNSDDYLKQTNREHANENLELEELEGCLI 572

Query: 717 LKLQNLLFFGTIISIEEKIDGLLEI--------SDKDSSRQRIKYLILDFKNINADNIDY 768
           +K+   L F     ++E+++ L +         +    SR   +Y+I+D   +   ++D 
Sbjct: 573 VKIPEPLTFTNTEDLKERLNRLEKFGSTRVHPGARGRRSRSSTRYVIIDLHGMT--HMDS 630

Query: 769 SAAEGFNRIKRFTETKRIQLIISSITEKDRIYNAFNKVGLLQDVE 813
           SAA+    I      + +++ ++ +T   R+     K G++  VE
Sbjct: 631 SAAQILLEIVSSYRKRDVRVFLARVTIDARVRERLEKSGVVDLVE 675

>TDEL0H03730 Chr8 (623125..625518) [2394 bp, 797 aa] {ON} Anc_7.78
           YAL021C
          Length = 797

 Score = 33.5 bits (75), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 41/82 (50%), Gaps = 8/82 (9%)

Query: 29  SQANRRSSMNPENSSNYYLGRSYVGSFSSPSFLQ------RESSADTGHILSLHKDASK- 81
           ++ N  ++ NP  S+N Y   +  GS SSPS  +      R+ +  T  +L  HK  S+ 
Sbjct: 211 TKDNSATNNNPPGSANTYATGNTSGSISSPSTPKTELHHLRDQNTGTPTLLLQHKKLSQF 270

Query: 82  SIHESVKL-HRQTAALSNNFDD 102
           +I E  +  HR TA  +  FDD
Sbjct: 271 NIDEDDETEHRMTAPKNTKFDD 292

>TBLA0H00560 Chr8 complement(107440..114090) [6651 bp, 2216 aa] {ON}
           Anc_8.442 YDR227W
          Length = 2216

 Score = 33.1 bits (74), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 48/196 (24%), Positives = 87/196 (44%), Gaps = 19/196 (9%)

Query: 22  SDNIKQPSQANRRSSMNPENSSNYYLGRSYVGSFSSPSFLQRESSADTGHILSLHKDASK 81
           S N+++P+Q  ++S+ N  NSS     ++   + +S S  Q ++S+    I    +   K
Sbjct: 268 SQNVERPTQKVKKSTENEANSSTQN-KKASTQNKASTSLQQVKNSSGQNEINEASQKVEK 326

Query: 82  SIHESVKLHRQTA---ALSNNFDDSSD----GKSDEIDVAASQEFQNEALQR-ELSLENG 133
           S  ++VK   Q     +L N  DDSS       +  I + +S    ++++Q+ E S+ N 
Sbjct: 327 STQDTVKSSSQNGIKHSLPNGEDDSSQTMPKPSTKNIVITSSAMDGDDSVQKMEKSMANS 386

Query: 134 SYXXXXXXXXXXXQIAYSEDAITQENNGLNECTRLLSPTSAAATDLEYGTSPTNLSPPSS 193
           S            + A +   I ++++  NE T        A+T +E   S  ++   S+
Sbjct: 387 STPYETKHSTQTEKNATT--PIVEKSSAQNEAT--------ASTPIEPNNSTEDIPKSST 436

Query: 194 QYEQEQYVSLVADHSP 209
           Q E     S V + SP
Sbjct: 437 QKEANASTSNVPNSSP 452

>YKR078W Chr11 (584952..586709) [1758 bp, 585 aa] {ON} Cytoplasmic
           protein of unknown function, has similarity to Vps5p;
           potential Cdc28p substrate; contains a Phox homology
           (PX) domain and specifically binds phosphatidylinositol
           3-phosphate (PtdIns-3-P)
          Length = 585

 Score = 32.7 bits (73), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 27/52 (51%), Gaps = 8/52 (15%)

Query: 465 FVVAIVPNLSLNSLRESGWIFPMAGSSN-------HWYDFYKLY-DFQNVHW 508
           F + I+P   LNSL++S WI  ++   +        + DFY LY   QN HW
Sbjct: 117 FSLRILPGSDLNSLKDSLWIIKISTQPDVEKTIARAFSDFYWLYHQLQNNHW 168

>KLLA0E17535g Chr5 complement(1557680..1558669) [990 bp, 329 aa]
          {ON} similar to uniprot|P41910 Saccharomyces cerevisiae
          YDR005C MAF1 Negative regulator of RNA polymerase III
          component of several signaling pathways that repress
          polymerase III transcription in response to changes in
          cellular environment targets the initiation factor
          TFIIIB
          Length = 329

 Score = 32.3 bits (72), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 32/85 (37%), Positives = 39/85 (45%), Gaps = 11/85 (12%)

Query: 3  NKKNRKSISEAITISLGLHSDNIKQPSQANRRSSMNPENSSNYYLGRSYVGS------FS 56
          NK N +++ E +   L   S N       N  SS    NS+N YL  S + S        
Sbjct: 20 NKLNDQNLKEFV---LSTDSTNFVTNGHNNSNSSTTNANSNNGYLSSSSMESGPLGIASQ 76

Query: 57 SPSFLQRESSADTGHILSLHKDASK 81
           PSFL+R SSA  G I S H D SK
Sbjct: 77 RPSFLRRTSSA--GSIASNHTDTSK 99

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.137    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 101,843,239
Number of extensions: 4319464
Number of successful extensions: 13438
Number of sequences better than 10.0: 67
Number of HSP's gapped: 13774
Number of HSP's successfully gapped: 87
Length of query: 1050
Length of database: 53,481,399
Length adjustment: 120
Effective length of query: 930
Effective length of database: 39,721,479
Effective search space: 36940975470
Effective search space used: 36940975470
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 71 (32.0 bits)