Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0F02904g3.486ON2222229501e-131
KLTH0F14696g3.486ON2191353198e-36
CAGL0I10604g3.486ON2111422995e-33
Skud_7.4373.486ON2302122902e-31
TDEL0D055403.486ON2161212701e-28
Kwal_55.212153.486ON142902544e-27
YGR126W3.486ON2301512614e-27
NCAS0E008503.486ON2302042553e-26
Suva_7.4143.486ON2301012511e-25
Smik_6.2223.486ON2301512492e-25
NDAI0G009803.486ON2342102396e-24
KNAG0B008503.486ON2252112352e-23
KLLA0E04709g3.486ON1661382077e-20
KAFR0C019203.486ON2231082082e-19
Kpol_1017.103.486ON234801602e-12
CAGL0I10384g3.503ON630631384e-09
KNAG0B007303.503ON622841375e-09
TPHA0D032503.486ON219831336e-09
KAFR0C020303.503ON624641359e-09
NDAI0I027703.503ON626631304e-08
AFR322C3.503ON592821286e-08
Kwal_47.189193.503ON640641289e-08
KLLA0E03829g3.503ON609641271e-07
TDEL0D057103.503ON616631242e-07
Suva_16.4843.503ON622631242e-07
Skud_16.4503.503ON622631243e-07
TBLA0D029003.503ON691891233e-07
YPR156C (TPO3)3.503ON622631224e-07
Smik_16.4083.503ON622631215e-07
TPHA0D033103.503ON613631181e-06
NCAS0E007503.503ON620631182e-06
Kpol_1017.33.503ON621581172e-06
KLTH0G02266g3.503ON644641153e-06
NCAS0F036203.503ON634631111e-05
Smik_6.2333.503ON614641102e-05
SAKL0F02442g3.503ON610631092e-05
Skud_7.4483.503ON611631074e-05
YGR138C (TPO2)3.503ON614641074e-05
Suva_7.4253.503ON613641065e-05
ZYRO0G19646g3.503ON594621012e-04
Skud_14.2092.150ON99756692.7
Kpol_1031.361.247ON70698674.2
KLTH0B02882g5.224ON51783656.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0F02904g
         (222 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0F02904g Chr6 complement(244726..245394) [669 bp, 222 aa] {O...   370   e-131
KLTH0F14696g Chr6 (1205320..1205979) [660 bp, 219 aa] {ON} weakl...   127   8e-36
CAGL0I10604g Chr9 complement(1047516..1048151) [636 bp, 211 aa] ...   119   5e-33
Skud_7.437 Chr7 (725052..725744) [693 bp, 230 aa] {ON} YGR126W (...   116   2e-31
TDEL0D05540 Chr4 (1002467..1003117) [651 bp, 216 aa] {ON} Anc_3....   108   1e-28
Kwal_55.21215 s55 (733385..733813) [429 bp, 142 aa] {ON} YGR126W...   102   4e-27
YGR126W Chr7 (745835..746527) [693 bp, 230 aa] {ON} Putative pro...   105   4e-27
NCAS0E00850 Chr5 complement(155265..155957) [693 bp, 230 aa] {ON...   102   3e-26
Suva_7.414 Chr7 (715894..716586) [693 bp, 230 aa] {ON} YGR126W (...   101   1e-25
Smik_6.222 Chr6 (363652..364344) [693 bp, 230 aa] {ON} YGR126W (...   100   2e-25
NDAI0G00980 Chr7 complement(203951..204655) [705 bp, 234 aa] {ON...    97   6e-24
KNAG0B00850 Chr2 complement(155105..155782) [678 bp, 225 aa] {ON...    95   2e-23
KLLA0E04709g Chr5 complement(417351..417851) [501 bp, 166 aa] {O...    84   7e-20
KAFR0C01920 Chr3 (385431..386102) [672 bp, 223 aa] {ON} Anc_3.48...    85   2e-19
Kpol_1017.10 s1017 complement(30565..31269) [705 bp, 234 aa] {ON...    66   2e-12
CAGL0I10384g Chr9 (1027883..1029775) [1893 bp, 630 aa] {ON} high...    58   4e-09
KNAG0B00730 Chr2 (138284..140152) [1869 bp, 622 aa] {ON} Anc_3.5...    57   5e-09
TPHA0D03250 Chr4 (670720..671379) [660 bp, 219 aa] {ON} Anc_3.48...    56   6e-09
KAFR0C02030 Chr3 complement(401836..403710) [1875 bp, 624 aa] {O...    57   9e-09
NDAI0I02770 Chr9 (652149..654029) [1881 bp, 626 aa] {ON} Anc_3.503     55   4e-08
AFR322C Chr6 complement(1017689..1019467) [1779 bp, 592 aa] {ON}...    54   6e-08
Kwal_47.18919 s47 complement(1026638..1028560) [1923 bp, 640 aa]...    54   9e-08
KLLA0E03829g Chr5 (349784..351613) [1830 bp, 609 aa] {ON} highly...    54   1e-07
TDEL0D05710 Chr4 complement(1025468..1027318) [1851 bp, 616 aa] ...    52   2e-07
Suva_16.484 Chr16 complement(834235..836103) [1869 bp, 622 aa] {...    52   2e-07
Skud_16.450 Chr16 complement(791420..793288) [1869 bp, 622 aa] {...    52   3e-07
TBLA0D02900 Chr4 (714553..716628) [2076 bp, 691 aa] {ON} Anc_3.5...    52   3e-07
YPR156C Chr16 complement(837909..839777) [1869 bp, 622 aa] {ON} ...    52   4e-07
Smik_16.408 Chr16 complement(709761..711629) [1869 bp, 622 aa] {...    51   5e-07
TPHA0D03310 Chr4 complement(680299..682140) [1842 bp, 613 aa] {O...    50   1e-06
NCAS0E00750 Chr5 (137737..139599) [1863 bp, 620 aa] {ON}               50   2e-06
Kpol_1017.3 s1017 (12526..14391) [1866 bp, 621 aa] {ON} (12526.....    50   2e-06
KLTH0G02266g Chr7 (178663..180597) [1935 bp, 644 aa] {ON} highly...    49   3e-06
NCAS0F03620 Chr6 complement(720240..722144) [1905 bp, 634 aa] {O...    47   1e-05
Smik_6.233 Chr6 complement(381679..383523) [1845 bp, 614 aa] {ON...    47   2e-05
SAKL0F02442g Chr6 (211990..213822) [1833 bp, 610 aa] {ON} highly...    47   2e-05
Skud_7.448 Chr7 complement(742873..744708) [1836 bp, 611 aa] {ON...    46   4e-05
YGR138C Chr7 complement(763762..765606) [1845 bp, 614 aa] {ON}  ...    46   4e-05
Suva_7.425 Chr7 complement(733993..735834) [1842 bp, 613 aa] {ON...    45   5e-05
ZYRO0G19646g Chr7 (1631114..1632898) [1785 bp, 594 aa] {ON} simi...    44   2e-04
Skud_14.209 Chr14 (384798..387791) [2994 bp, 997 aa] {ON} YNL123...    31   2.7  
Kpol_1031.36 s1031 complement(87105..89225) [2121 bp, 706 aa] {O...    30   4.2  
KLTH0B02882g Chr2 (225842..227395) [1554 bp, 517 aa] {ON} weakly...    30   6.9  

>SAKL0F02904g Chr6 complement(244726..245394) [669 bp, 222 aa] {ON}
           similar to gnl|GLV|CAGL0I10604g Candida glabrata
           CAGL0I10604g and weakly similar to YGR126W
           uniprot|P53274 Saccharomyces cerevisiae YGR126W
           Hypothetical ORF
          Length = 222

 Score =  370 bits (950), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 187/222 (84%), Positives = 187/222 (84%)

Query: 1   MQEELEGKTTGGTDMXXXXXXXXXXFEPQAFTGADPSVEQPTIDHELEDEIDPEPLSGNP 60
           MQEELEGKTTGGTDM          FEPQAFTGADPSVEQPTIDHELEDEIDPEPLSGNP
Sbjct: 1   MQEELEGKTTGGTDMELSSLSSTESFEPQAFTGADPSVEQPTIDHELEDEIDPEPLSGNP 60

Query: 61  VRPNSEEILSVRSSNTLKKLDSNAIEKVLTHNAVEGNTETLESLKTRGLDLRKKAIPDYN 120
           VRPNSEEILSVRSSNTLKKLDSNAIEKVLTHNAVEGNTETLESLKTRGLDLRKKAIPDYN
Sbjct: 61  VRPNSEEILSVRSSNTLKKLDSNAIEKVLTHNAVEGNTETLESLKTRGLDLRKKAIPDYN 120

Query: 121 NPAMHTDRSQFPEEYQIETETGLVKVKTLQSLNRLDTRVSLGNKPSTNQNMEAESAHDEQ 180
           NPAMHTDRSQFPEEYQIETETGLVKVKTLQSLNRLDTRVSLGNKPSTNQNMEAESAHDEQ
Sbjct: 121 NPAMHTDRSQFPEEYQIETETGLVKVKTLQSLNRLDTRVSLGNKPSTNQNMEAESAHDEQ 180

Query: 181 RPVGYDXXXXXXXXXXXXXXXXXXXXXXXXXGIKGFMSRLFG 222
           RPVGYD                         GIKGFMSRLFG
Sbjct: 181 RPVGYDEEKLKKAVDKNKKKIEKYQKHKHEKGIKGFMSRLFG 222

>KLTH0F14696g Chr6 (1205320..1205979) [660 bp, 219 aa] {ON} weakly
           similar to uniprot|P53274 Saccharomyces cerevisiae
           YGR126W Hypothetical ORF
          Length = 219

 Score =  127 bits (319), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 68/135 (50%), Positives = 92/135 (68%), Gaps = 10/135 (7%)

Query: 26  FEPQAFTGADPSVEQPTIDHELEDEIDPEPLSGNPVRPNSEEILSVRSSNTLKKLDSNAI 85
           FEP+AF G  P  E  +++ E   +  P          +S++   V+S+ TL+K DSNAI
Sbjct: 26  FEPRAFEG--PPSEIKSLEPEGSVQASPSI--------DSKDFHRVKSNGTLRKQDSNAI 75

Query: 86  EKVLTHNAVEGNTETLESLKTRGLDLRKKAIPDYNNPAMHTDRSQFPEEYQIETETGLVK 145
           E+++THNA EG +ET+ESLK  GL+L+KKAIPD NNPA +     FPEEYQ+ET+TGLVK
Sbjct: 76  EQIMTHNATEGRSETVESLKKNGLNLQKKAIPDINNPAANYKNCAFPEEYQMETDTGLVK 135

Query: 146 VKTLQSLNRLDTRVS 160
            +TL  LNRL++R S
Sbjct: 136 AQTLHGLNRLESRTS 150

>CAGL0I10604g Chr9 complement(1047516..1048151) [636 bp, 211 aa]
           {ON} similar to uniprot|P53274 Saccharomyces cerevisiae
           YGR126w
          Length = 211

 Score =  119 bits (299), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 69/142 (48%), Positives = 91/142 (64%), Gaps = 27/142 (19%)

Query: 44  DHELED--------EIDPEPLSGNPVRPNSEEILSVRSSN-----------------TLK 78
           D+E+ED           PEP +G  +     E LS +++N                 TLK
Sbjct: 11  DYEVEDISSFSSVDSYKPEPFTG--LEHTKNENLSRKATNASQGTYMDDATSKHSGATLK 68

Query: 79  KLDSNAIEKVLTHNAVEGNTETLESLKTRGLDLRKKAIPDYNNPAMHTDRSQFPEEYQIE 138
           KLDS AIEKV+T NAV GN+ET+ESLK +GLD+++KAIPDYN P   T  +QFPEEY++E
Sbjct: 69  KLDSLAIEKVVTQNAVAGNSETIESLKAKGLDMQRKAIPDYNAPLTTTGTNQFPEEYRLE 128

Query: 139 TETGLVKVKTLQSLNRLDTRVS 160
           T+TGLVK+KTL++L R  T+VS
Sbjct: 129 TDTGLVKMKTLETLKRKSTQVS 150

>Skud_7.437 Chr7 (725052..725744) [693 bp, 230 aa] {ON} YGR126W
           (REAL)
          Length = 230

 Score =  116 bits (290), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 78/212 (36%), Positives = 112/212 (52%), Gaps = 24/212 (11%)

Query: 26  FEPQAFTGADPSV--EQPTIDH---------ELEDEIDPEPLSGNPVRPNSEEILSVRSS 74
           ++P+ FTG   S   EQP + +         E E+ ID +            ++ S  SS
Sbjct: 26  YKPEPFTGFKDSQAPEQPLLKNDTIVGKAQSENEENIDEQHRHS--------DVYSHHSS 77

Query: 75  NTLKKLDSNAIEKVLTHNAVEGNTETLESLKTRGLDLRKKAIPDYNNPAMHTDRS-QFPE 133
           +TLK+  SN+IEK++THNA+EGN+ET +SLK  GL+L KKA+PD   P  ++  +  FPE
Sbjct: 78  STLKRPSSNSIEKMITHNALEGNSETADSLKREGLNLNKKALPDITAPVTNSAHNGAFPE 137

Query: 134 EYQIETETGLVKVKTLQSLNRLDTRVSLGNKPSTNQNMEAESAHDE----QRPVGYDXXX 189
           EY++ETETGLVK+KTL++L R D+RVS   K  TN + +A S   +     +    +   
Sbjct: 138 EYRLETETGLVKLKTLETLKREDSRVSSAKKEHTNDHADAHSTRSKVTTYSQGSSLESDK 197

Query: 190 XXXXXXXXXXXXXXXXXXXXXXGIKGFMSRLF 221
                                 GIKGF  R+F
Sbjct: 198 LNMAVEKNKKKIEQYRKHKSEKGIKGFFHRIF 229

>TDEL0D05540 Chr4 (1002467..1003117) [651 bp, 216 aa] {ON} Anc_3.486
           YGR126W
          Length = 216

 Score =  108 bits (270), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 63/121 (52%), Positives = 79/121 (65%), Gaps = 6/121 (4%)

Query: 49  DEIDPEPLSGNP-----VRPNSEEILSVRSSNTLKKLDSNAIEKVLTHNAVEGNTETLES 103
           D   P+P +G         P+S    S +S  TL   DSN IEK +THNA+ G +ET +S
Sbjct: 26  DSYQPQPFTGQEELPQEKNPDSSSRRSSKSGTTLNHQDSNTIEKEVTHNAMNGTSETAKS 85

Query: 104 LKTRGLDLRKKAIPDYNNPAM-HTDRSQFPEEYQIETETGLVKVKTLQSLNRLDTRVSLG 162
           L+  GLD  KKAIPD N P   + D SQFPEEY+IET+TGLVK+KTL  L+R DTRVS+G
Sbjct: 86  LQQAGLDTEKKAIPDINGPITGNADTSQFPEEYRIETQTGLVKLKTLNDLSRSDTRVSIG 145

Query: 163 N 163
           +
Sbjct: 146 S 146

>Kwal_55.21215 s55 (733385..733813) [429 bp, 142 aa] {ON} YGR126W -
           Hypothetical ORF [contig 131] PARTIAL
          Length = 142

 Score =  102 bits (254), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 47/90 (52%), Positives = 69/90 (76%)

Query: 89  LTHNAVEGNTETLESLKTRGLDLRKKAIPDYNNPAMHTDRSQFPEEYQIETETGLVKVKT 148
           +THNA EG +ET++SL+  GL++ +KA+PDYNNPA +    +FPEEYQ+ET+TGLVKV+T
Sbjct: 1   MTHNATEGRSETVDSLQRNGLNINQKAVPDYNNPAANFTNCEFPEEYQLETDTGLVKVQT 60

Query: 149 LQSLNRLDTRVSLGNKPSTNQNMEAESAHD 178
           LQ LNRL++R S+ +  S  ++M +  + D
Sbjct: 61  LQKLNRLESRTSIRSGNSQRKSMRSTPSTD 90

>YGR126W Chr7 (745835..746527) [693 bp, 230 aa] {ON} Putative
           protein of unknown function; green fluorescent protein
           (GFP)-fusion protein localizes to both the cytoplasm and
           the nucleus and is induced in response to the
           DNA-damaging agent MMS
          Length = 230

 Score =  105 bits (261), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 62/151 (41%), Positives = 86/151 (56%), Gaps = 5/151 (3%)

Query: 76  TLKKLDSNAIEKVLTHNAVEGNTETLESLKTRGLDLRKKAIPDYNNPAMHTDR-SQFPEE 134
           TLK+  SN+IEK++THNA+EGN+ET++SLK  GL+L KKA+PD   P  ++   + FPEE
Sbjct: 79  TLKRPTSNSIEKMVTHNALEGNSETVDSLKEDGLNLNKKALPDITAPVTNSAHDAAFPEE 138

Query: 135 YQIETETGLVKVKTLQSLNRLDTRVSLGNKPSTNQNMEAESAHDE----QRPVGYDXXXX 190
           Y++ETETGLVK+KTL+SL R D+RVS   K   N + +  S   +     +    +    
Sbjct: 139 YRLETETGLVKLKTLESLKREDSRVSSTKKEHINDHTDMHSTRSKVTTNSQGSSLEPNKL 198

Query: 191 XXXXXXXXXXXXXXXXXXXXXGIKGFMSRLF 221
                                GIKGF  R+F
Sbjct: 199 NMAVEKNKKRIEKYQKHKSEKGIKGFFHRIF 229

>NCAS0E00850 Chr5 complement(155265..155957) [693 bp, 230 aa] {ON}
           Anc_3.486 YGR126W
          Length = 230

 Score =  102 bits (255), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 72/204 (35%), Positives = 107/204 (52%), Gaps = 8/204 (3%)

Query: 26  FEPQAFTGA-DPSVEQPTIDHEL----EDEIDPEPLSGNPVRPNSEEILSVRSS-NTLKK 79
           ++P+ FTG  +P+  + T   +     E E+  E  +      ++++ ++ R+S +TL++
Sbjct: 26  YQPEPFTGVKEPTAYKGTDRKDTLSGDETELKQEHTNATATSSHTKDGITSRTSMSTLRR 85

Query: 80  LDSNAIEKVLTHNAVEGNTETLESLKTRGLDLRKKAIPDYNNPAMHTDRS-QFPEEYQIE 138
            DSNAIE+V+T NA EGNTETL SL  +GLDL KKA  D N P         FPEEY +E
Sbjct: 86  PDSNAIERVITSNAKEGNTETLGSLAAKGLDLNKKATLDINAPLTSNPADVAFPEEYNLE 145

Query: 139 TETGLVKVKTLQSLNRLDTRVSLGNKPSTNQNMEAESAHDEQRPV-GYDXXXXXXXXXXX 197
           TETGLVK KT+++L R  +RVS   +     + ++++    QR                 
Sbjct: 146 TETGLVKAKTIETLRRETSRVSSTRRGDDVVSHKSQATGKSQRSAQSLQAEKLNLAVEKN 205

Query: 198 XXXXXXXXXXXXXXGIKGFMSRLF 221
                         G+KGFM+RLF
Sbjct: 206 KKELEKIEKHKHQKGLKGFMNRLF 229

>Suva_7.414 Chr7 (715894..716586) [693 bp, 230 aa] {ON} YGR126W
           (REAL)
          Length = 230

 Score =  101 bits (251), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 53/101 (52%), Positives = 74/101 (73%), Gaps = 1/101 (0%)

Query: 76  TLKKLDSNAIEKVLTHNAVEGNTETLESLKTRGLDLRKKAIPDYNNPAMHTDR-SQFPEE 134
           TLK+  SN+IEK++THNA+EGN+ET++SLK  GL+L KK  PD   P  ++   + FPEE
Sbjct: 79  TLKRPTSNSIEKMVTHNALEGNSETVDSLKKEGLNLNKKGTPDITAPVTNSAHDAAFPEE 138

Query: 135 YQIETETGLVKVKTLQSLNRLDTRVSLGNKPSTNQNMEAES 175
           Y++ETETGLVK+KTL++L R D+RVS   K   + + +A S
Sbjct: 139 YRLETETGLVKLKTLETLKREDSRVSGAKKDHGHDHTDAHS 179

>Smik_6.222 Chr6 (363652..364344) [693 bp, 230 aa] {ON} YGR126W
           (REAL)
          Length = 230

 Score =  100 bits (249), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 60/151 (39%), Positives = 85/151 (56%), Gaps = 5/151 (3%)

Query: 76  TLKKLDSNAIEKVLTHNAVEGNTETLESLKTRGLDLRKKAIPDYNNPAMHTDR-SQFPEE 134
           TLK+  SN+IEK++T NA+EG +ETL+SLK  GL+L+KKA+PD   P  ++   + FPEE
Sbjct: 79  TLKRPTSNSIEKMVTQNALEGTSETLDSLKEDGLNLKKKALPDITAPVTNSAHDATFPEE 138

Query: 135 YQIETETGLVKVKTLQSLNRLDTRVSLGNKPSTNQNMEAESAHDE----QRPVGYDXXXX 190
           Y++ETETGLVK+KTL++L R D+RVS   K   N + +  S   +     +    +    
Sbjct: 139 YRLETETGLVKLKTLETLRREDSRVSSTKKEHNNDHTDIHSTRSKVTTNSQGSSLEPNKL 198

Query: 191 XXXXXXXXXXXXXXXXXXXXXGIKGFMSRLF 221
                                GIKGF  R+F
Sbjct: 199 NMAVEKNKKKIEQYQKHKSEKGIKGFFHRIF 229

>NDAI0G00980 Chr7 complement(203951..204655) [705 bp, 234 aa] {ON}
           Anc_3.486 YGR126W
          Length = 234

 Score = 96.7 bits (239), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 71/210 (33%), Positives = 104/210 (49%), Gaps = 19/210 (9%)

Query: 26  FEPQAFTG--------ADPSVEQPTIDHELEDEIDPEPLSGNPVRPNSEEILSVRSSNTL 77
           ++P+ FTG        A PS    T + + +D +    +S +       E  S  S+ TL
Sbjct: 29  YQPEPFTGLKGNELPNAQPSTTATTTEQDHDDTV----ISSHSHDTKHGEEPSRTSTATL 84

Query: 78  KKLDSNA--IEKVLTHNAVEGNTETLESLKTRGLDLRKKAIPDYNNPAMHTDRSQFPEEY 135
           KKLDSN   IEK +T N +   TETL+SL  +GL+ RKK++ D N P ++   ++FPEEY
Sbjct: 85  KKLDSNVNDIEKTMTTNIMNDKTETLDSLVKQGLNTRKKSVADINTP-LNAGTAEFPEEY 143

Query: 136 QIETETGLVKVKTLQSLNRLDTRVSLGNKPSTNQ----NMEAESAHDEQRPVGYDXXXXX 191
           +IETETGLVK KT++SL R ++  S  ++ S +Q    +    +    +     D     
Sbjct: 144 RIETETGLVKAKTIESLRRQESIASANSRRSQDQGSFKSARTNNTRKSRASSSLDPNKLN 203

Query: 192 XXXXXXXXXXXXXXXXXXXXGIKGFMSRLF 221
                               GIKGF +RLF
Sbjct: 204 MAVEKNKKELEKYSKHKQQKGIKGFFNRLF 233

>KNAG0B00850 Chr2 complement(155105..155782) [678 bp, 225 aa] {ON}
           Anc_3.486 YGR126W
          Length = 225

 Score = 95.1 bits (235), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 69/211 (32%), Positives = 106/211 (50%), Gaps = 17/211 (8%)

Query: 27  EPQAFTGADPSVEQPTIDHELEDEIDPEPLSGNPVRPNSEEIL-----------SVRSSN 75
           E  +F+  D    +P +    E+E     L  N    NSE++            S  SS 
Sbjct: 15  EVSSFSSVDSYKPEPFVGFGTEEEQHDSRLFKNDTILNSEDLAENTANTPSDLNSKASST 74

Query: 76  TLKKLDSNAIEKVLTHNAVEGNTETLESLKTRGLDL-RKKAIPDYNNPAMHTDRSQFPEE 134
           TL K DSNAIE+V+T NA+   +E+ ++L+++GLD  +++ IPD N P   T +S FPEE
Sbjct: 75  TLGKRDSNAIERVVTKNAMNNQSESADALRSKGLDTTKRRNIPDINAPLTLT-QSHFPEE 133

Query: 135 YQIETETGLVKVKTLQSLNRLDTRVSLGNKPSTNQNMEAE----SAHDEQRPVGYDXXXX 190
           YQ+ETETGLVK+KT++SL    +  +  +K S   +  ++    S+ +E    G +    
Sbjct: 134 YQVETETGLVKMKTIESLKSRHSGGTHNSKKSKGASTRSKNSLTSSMEEHGEAGLNAEKL 193

Query: 191 XXXXXXXXXXXXXXXXXXXXXGIKGFMSRLF 221
                                GIKGF+S++F
Sbjct: 194 NSAVERNRKELERYEKNRGKKGIKGFLSKMF 224

>KLLA0E04709g Chr5 complement(417351..417851) [501 bp, 166 aa] {ON}
           weakly similar to uniprot|P53274 Saccharomyces
           cerevisiae YGR126W Hypothetical ORF
          Length = 166

 Score = 84.3 bits (207), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 51/138 (36%), Positives = 70/138 (50%), Gaps = 13/138 (9%)

Query: 85  IEKVLTHNAVEGNTETLESLKTRGLDLRKKAIPDYNNPAMHTDRSQFPEEYQIETETGLV 144
           +E  +  N  +G T++++SLK   LDL KKAIP +N P    + ++FPEEY+IET TGLV
Sbjct: 42  VEDYVKDNVQKGETDSIDSLKATNLDLSKKAIPGFNQPI--AEGAEFPEEYEIETRTGLV 99

Query: 145 KVKTLQSLNRLDTRVSLGNKPSTNQNMEAESAHDEQRPVGYDXXXXXXXXXXXXXXXXXX 204
           KV TL  LNRLDTRV+         +   +S  ++    GYD                  
Sbjct: 100 KVATLHQLNRLDTRVTT--------HSSKKSTKEKNTSCGYD---NDKLQKCIERNQKEI 148

Query: 205 XXXXXXXGIKGFMSRLFG 222
                  G K F+ +LFG
Sbjct: 149 DSYHKKSGFKKFIGKLFG 166

>KAFR0C01920 Chr3 (385431..386102) [672 bp, 223 aa] {ON} Anc_3.486
           YGR126W
          Length = 223

 Score = 84.7 bits (208), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 69/108 (63%), Gaps = 8/108 (7%)

Query: 73  SSNTLKKLDSNAIEKVLTHNAVEGNTETLESLKTRGLDLRKKAIPDYNNPAMHTDRSQFP 132
           SS  LKK  S  IE+++T NA+ G  ET++SL+  GLDL K+A+PD N+P  H   S+  
Sbjct: 84  SSKNLKKQRSRDIERIVTQNAMLGKAETVDSLRATGLDLTKRAVPDINSPISH--ESKLI 141

Query: 133 EEYQIETETGLVKVKTLQSLNRLDTRVS------LGNKPSTNQNMEAE 174
           +E + ET+TGL+K KTL++LNR +TR S      LGN  S    ++ E
Sbjct: 142 DESKFETDTGLIKTKTLETLNRSNTRNSSSKRKILGNDNSNTSGLDPE 189

>Kpol_1017.10 s1017 complement(30565..31269) [705 bp, 234 aa] {ON}
           complement(30565..31269) [705 nt, 235 aa]
          Length = 234

 Score = 66.2 bits (160), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 39/80 (48%), Positives = 54/80 (67%), Gaps = 3/80 (3%)

Query: 74  SNTLKKLDSNAIEKVLTHNAVEGNTETLESLKTRGLDLRKKAIPDYNN-PAMHTDRSQFP 132
           +NTLK   SN IEK++T NA+E NTET+ +L+     L K  +P  N  PA   + + FP
Sbjct: 60  TNTLKVNSSNEIEKIVTRNALENNTETVATLRETESKLSK--VPTENVLPATMENNAAFP 117

Query: 133 EEYQIETETGLVKVKTLQSL 152
           EEY+IET+TGLV +KTL+ +
Sbjct: 118 EEYRIETKTGLVPIKTLEEM 137

>CAGL0I10384g Chr9 (1027883..1029775) [1893 bp, 630 aa] {ON} highly
           similar to uniprot|P53283 Saccharomyces cerevisiae
           YGR138c
          Length = 630

 Score = 57.8 bits (138), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 32/63 (50%), Positives = 40/63 (63%), Gaps = 1/63 (1%)

Query: 98  TETLESLKTRGLDLRKKAIPDYNNPAMHTDRSQFPEEYQIETETGLVKVKTLQSLNRLDT 157
           TET++SL+  G+  +   IPD N P   T  + FPEEY +ET TGLV V TLQSL R  T
Sbjct: 51  TETVKSLQEMGMT-QDAPIPDVNAPQTTTKNAIFPEEYTMETPTGLVPVATLQSLGRTST 109

Query: 158 RVS 160
            +S
Sbjct: 110 AIS 112

>KNAG0B00730 Chr2 (138284..140152) [1869 bp, 622 aa] {ON} Anc_3.503
           YPR156C
          Length = 622

 Score = 57.4 bits (137), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 47/84 (55%), Gaps = 1/84 (1%)

Query: 98  TETLESLKTRGLDLRKKAIPDYNNPAMHTDRSQFPEEYQIETETGLVKVKTLQSLNRLDT 157
           TET++SL+  G+  +   IPD N P      + FPEEY +ET TGLV V TLQS+ R  T
Sbjct: 51  TETVKSLQDMGMT-KNAPIPDVNAPQTAKKTAIFPEEYTMETPTGLVPVATLQSIGRTAT 109

Query: 158 RVSLGNKPSTNQNMEAESAHDEQR 181
            +S       ++++   S+H   +
Sbjct: 110 SISRTRTRQMDRSISMRSSHSNDK 133

>TPHA0D03250 Chr4 (670720..671379) [660 bp, 219 aa] {ON} Anc_3.486
           YGR126W
          Length = 219

 Score = 55.8 bits (133), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 32/83 (38%), Positives = 51/83 (61%), Gaps = 1/83 (1%)

Query: 75  NTLKKLDSNAIEKVLTHNAVEGNTETLESLKTRGLDLRKKAIPDYNNPAMHTDRSQFPEE 134
           NT+K + SN + ++++ N ++ N E+ E+LKT+  ++  +   D   PA     S FPEE
Sbjct: 68  NTIKPVTSNDVHRIVSRNIMDNNVESEEALKTQLTNMESRR-ADIILPASMEGNSNFPEE 126

Query: 135 YQIETETGLVKVKTLQSLNRLDT 157
           Y +ET TGLV VKTL+ + +  T
Sbjct: 127 YTMETTTGLVPVKTLEDIKKKKT 149

>KAFR0C02030 Chr3 complement(401836..403710) [1875 bp, 624 aa] {ON}
           Anc_3.503 YPR156C
          Length = 624

 Score = 56.6 bits (135), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 33/64 (51%), Positives = 43/64 (67%), Gaps = 4/64 (6%)

Query: 98  TETLESLKTRGLDLRKKAIPDYNNPAMHTDR-SQFPEEYQIETETGLVKVKTLQSLNRLD 156
           TET++SL+  G++    A+PD N P   ++R + FPEEY IET TGLV V TLQSL R  
Sbjct: 52  TETVKSLQDMGMN-ATPAVPDVNAP--QSNRNAIFPEEYTIETTTGLVPVATLQSLGRTS 108

Query: 157 TRVS 160
           T +S
Sbjct: 109 TAIS 112

>NDAI0I02770 Chr9 (652149..654029) [1881 bp, 626 aa] {ON} Anc_3.503
          Length = 626

 Score = 54.7 bits (130), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 39/63 (61%), Gaps = 1/63 (1%)

Query: 98  TETLESLKTRGLDLRKKAIPDYNNPAMHTDRSQFPEEYQIETETGLVKVKTLQSLNRLDT 157
           TET+++L+  G+  R   +PD N P      + FPEEY +ET TGLV V TLQSL R  T
Sbjct: 52  TETVKTLQDLGVT-RDAPVPDVNAPQTSARNTIFPEEYTMETTTGLVPVSTLQSLGRTAT 110

Query: 158 RVS 160
            ++
Sbjct: 111 SIT 113

>AFR322C Chr6 complement(1017689..1019467) [1779 bp, 592 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR138C
           (TPO2) and YPR156C (TPO3)
          Length = 592

 Score = 53.9 bits (128), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 35/82 (42%), Positives = 47/82 (57%), Gaps = 2/82 (2%)

Query: 98  TETLESLKTRGLDLRKKAIPDYNNPAMHTDRSQFPEEYQIETETGLVKVKTLQSLNRLDT 157
           TET++SL+  GL   +K IPD N P+       FPEEY +ET TGLVK+ TL SL R  +
Sbjct: 45  TETVKSLQEMGLS-SEKPIPDVNAPSTSAG-VIFPEEYTLETPTGLVKIATLVSLGRTGS 102

Query: 158 RVSLGNKPSTNQNMEAESAHDE 179
            V  G   +  +N + E+   E
Sbjct: 103 AVPRGGSGTEPENDKGETGGQE 124

>Kwal_47.18919 s47 complement(1026638..1028560) [1923 bp, 640 aa]
           {ON} YGR138C (TPO2) -  [contig 188] FULL
          Length = 640

 Score = 53.9 bits (128), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 42/64 (65%), Gaps = 2/64 (3%)

Query: 98  TETLESLKTRGLDLRKKAIPDYNNPAMHTD-RSQFPEEYQIETETGLVKVKTLQSLNRLD 156
           TET++SL+  G+   +  +PD N PA  T  ++ FPEEY +ET TGLV V TLQSL R  
Sbjct: 51  TETVKSLQEMGVT-PEAPLPDVNAPAAATSGKAIFPEEYTLETATGLVPVATLQSLGRTT 109

Query: 157 TRVS 160
           + V+
Sbjct: 110 SGVT 113

>KLLA0E03829g Chr5 (349784..351613) [1830 bp, 609 aa] {ON} highly
           similar to uniprot|Q06451 Saccharomyces cerevisiae
           YPR156C TPO3 Polyamine transport protein
          Length = 609

 Score = 53.5 bits (127), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 39/64 (60%), Gaps = 2/64 (3%)

Query: 98  TETLESLKTRGLDLRKKAIPDYNNPAMHTDR-SQFPEEYQIETETGLVKVKTLQSLNRLD 156
           TET +SL+  GL   +  IPD+N P     + + FPEEY +ET TGLV V TL SL R  
Sbjct: 48  TETAKSLQDMGLT-SEVPIPDFNAPTTSVAKNAIFPEEYTLETATGLVPVATLHSLGRTP 106

Query: 157 TRVS 160
           T +S
Sbjct: 107 TAIS 110

>TDEL0D05710 Chr4 complement(1025468..1027318) [1851 bp, 616 aa]
           {ON} Anc_3.503 YPR156C
          Length = 616

 Score = 52.4 bits (124), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 37/63 (58%), Gaps = 1/63 (1%)

Query: 98  TETLESLKTRGLDLRKKAIPDYNNPAMHTDRSQFPEEYQIETETGLVKVKTLQSLNRLDT 157
           TET++SL+  G+      +PD N P        FPEEY +ET TGLV V TLQS+ R  T
Sbjct: 45  TETVKSLQEMGMT-ATAPVPDVNAPQTTARPQIFPEEYTMETPTGLVPVATLQSIGRTST 103

Query: 158 RVS 160
            +S
Sbjct: 104 AIS 106

>Suva_16.484 Chr16 complement(834235..836103) [1869 bp, 622 aa] {ON}
           YPR156C (REAL)
          Length = 622

 Score = 52.4 bits (124), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/63 (47%), Positives = 39/63 (61%), Gaps = 2/63 (3%)

Query: 98  TETLESLKTRGLDLRKKAIPDYNNPAMHTDRSQFPEEYQIETETGLVKVKTLQSLNRLDT 157
           TET++SL+  G+  R   +PD N P    ++  FPEEY IET TGLV V TL S+ R  T
Sbjct: 50  TETVKSLQDMGVSSRAP-VPDVNAPQSSKNK-IFPEEYTIETPTGLVPVATLHSIGRTST 107

Query: 158 RVS 160
            +S
Sbjct: 108 AIS 110

>Skud_16.450 Chr16 complement(791420..793288) [1869 bp, 622 aa] {ON}
           YPR156C (REAL)
          Length = 622

 Score = 52.4 bits (124), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 30/63 (47%), Positives = 39/63 (61%), Gaps = 2/63 (3%)

Query: 98  TETLESLKTRGLDLRKKAIPDYNNPAMHTDRSQFPEEYQIETETGLVKVKTLQSLNRLDT 157
           TET++SL+  G+   K  IPD N P    ++  FPEEY +ET TGLV V TL S+ R  T
Sbjct: 50  TETVKSLQDMGVS-SKAPIPDVNAPQSSKNK-IFPEEYTLETPTGLVPVATLHSIGRTST 107

Query: 158 RVS 160
            +S
Sbjct: 108 AIS 110

>TBLA0D02900 Chr4 (714553..716628) [2076 bp, 691 aa] {ON} Anc_3.503
           YPR156C
          Length = 691

 Score = 52.0 bits (123), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 35/89 (39%), Positives = 48/89 (53%), Gaps = 14/89 (15%)

Query: 98  TETLESLKTRGLDLRKKAIPDYNNPAMHTDRSQ----FPEEYQIETETGLVKVKTLQSLN 153
           TET++SL   G+      IP   NPA++  ++     FPEEY +ETETGLV V TL SL 
Sbjct: 71  TETVKSLIDMGV---SSYIP---NPAINAPKTSKKAIFPEEYTLETETGLVPVSTLHSLG 124

Query: 154 RLDTRVSLGNKPST----NQNMEAESAHD 178
           R +T +S      T    N  + + + HD
Sbjct: 125 RTNTNLSRQRTRHTLSRRNTRIASSAQHD 153

>YPR156C Chr16 complement(837909..839777) [1869 bp, 622 aa] {ON}
           TPO3Polyamine transport protein specific for spermine;
           localizes to the plasma membrane; member of the major
           facilitator superfamily
          Length = 622

 Score = 51.6 bits (122), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 39/63 (61%), Gaps = 2/63 (3%)

Query: 98  TETLESLKTRGLDLRKKAIPDYNNPAMHTDRSQFPEEYQIETETGLVKVKTLQSLNRLDT 157
           TET++SL+  G+   K  +PD N P    ++  FPEEY +ET TGLV V TL S+ R  T
Sbjct: 50  TETVKSLQDMGVS-SKAPVPDVNAPQSSKNK-IFPEEYTLETPTGLVPVATLHSIGRTST 107

Query: 158 RVS 160
            +S
Sbjct: 108 AIS 110

>Smik_16.408 Chr16 complement(709761..711629) [1869 bp, 622 aa] {ON}
           YPR156C (REAL)
          Length = 622

 Score = 51.2 bits (121), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 39/63 (61%), Gaps = 2/63 (3%)

Query: 98  TETLESLKTRGLDLRKKAIPDYNNPAMHTDRSQFPEEYQIETETGLVKVKTLQSLNRLDT 157
           TET++SL+  G+   K  +PD N P    ++  FPEEY +ET TGLV V TL S+ R  T
Sbjct: 50  TETVKSLQDMGVS-SKAPVPDVNAPQSGKNK-IFPEEYTLETPTGLVPVATLHSIGRTST 107

Query: 158 RVS 160
            +S
Sbjct: 108 AIS 110

>TPHA0D03310 Chr4 complement(680299..682140) [1842 bp, 613 aa] {ON}
           Anc_3.503 YPR156C
          Length = 613

 Score = 50.1 bits (118), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 37/63 (58%), Gaps = 2/63 (3%)

Query: 98  TETLESLKTRGLDLRKKAIPDYNNPAMHTDRSQFPEEYQIETETGLVKVKTLQSLNRLDT 157
           TET++SL+  GL      IPD N P      S FPEEY +ET TGLV V TL SL R  T
Sbjct: 45  TETVKSLQDMGLT-SDAPIPDVNAPT-SNKHSIFPEEYTMETPTGLVPVATLHSLGRNST 102

Query: 158 RVS 160
            ++
Sbjct: 103 TIT 105

>NCAS0E00750 Chr5 (137737..139599) [1863 bp, 620 aa] {ON} 
          Length = 620

 Score = 50.1 bits (118), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/63 (42%), Positives = 38/63 (60%), Gaps = 1/63 (1%)

Query: 98  TETLESLKTRGLDLRKKAIPDYNNPAMHTDRSQFPEEYQIETETGLVKVKTLQSLNRLDT 157
           TET+++L+  G+      +PD N P      + FPEEY +ET TGLV V TLQS+ R  +
Sbjct: 46  TETVKTLQDLGVT-SHVPVPDINAPQSSKKNAIFPEEYTMETTTGLVPVATLQSMGRTAS 104

Query: 158 RVS 160
            +S
Sbjct: 105 AIS 107

>Kpol_1017.3 s1017 (12526..14391) [1866 bp, 621 aa] {ON}
           (12526..14391) [1866 nt, 622 aa]
          Length = 621

 Score = 49.7 bits (117), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 37/58 (63%), Gaps = 4/58 (6%)

Query: 98  TETLESLKTRGLDLRKKAIPDYNNPAMHTDRSQ-FPEEYQIETETGLVKVKTLQSLNR 154
           TET++SL+  G+   +  IP  N P   T R Q FPEEY +ET TGLV V TLQSL R
Sbjct: 48  TETVKSLQDMGMT-SEAPIPGVNAP--QTSRVQIFPEEYTMETPTGLVPVATLQSLGR 102

>KLTH0G02266g Chr7 (178663..180597) [1935 bp, 644 aa] {ON} highly
           similar to uniprot|P53283 Saccharomyces cerevisiae
           YGR138C TPO2 Polyamine transport protein
          Length = 644

 Score = 48.9 bits (115), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 30/64 (46%), Positives = 39/64 (60%), Gaps = 2/64 (3%)

Query: 98  TETLESLKTRGLDLRKKAIPDYNNPAM-HTDRSQFPEEYQIETETGLVKVKTLQSLNRLD 156
           TET++SL+  G+   +  +PD N P       + FPEEY +ET TGLV V TLQSL R  
Sbjct: 57  TETVKSLQDMGVT-PEAPLPDVNAPTTGKGGAAIFPEEYTLETATGLVPVATLQSLGRTQ 115

Query: 157 TRVS 160
           + VS
Sbjct: 116 SAVS 119

>NCAS0F03620 Chr6 complement(720240..722144) [1905 bp, 634 aa] {ON}
           Anc_3.503 YGR138C
          Length = 634

 Score = 47.4 bits (111), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 27/63 (42%), Positives = 38/63 (60%), Gaps = 1/63 (1%)

Query: 98  TETLESLKTRGLDLRKKAIPDYNNPAMHTDRSQFPEEYQIETETGLVKVKTLQSLNRLDT 157
           TET ++L+  G+   +  +PD N P      + FPEEY +ET TGLV V TLQS+ R  +
Sbjct: 50  TETAKTLQDMGMT-SEAPLPDINAPQGSKKPAIFPEEYTMETPTGLVPVVTLQSIGRNSS 108

Query: 158 RVS 160
            +S
Sbjct: 109 AIS 111

>Smik_6.233 Chr6 complement(381679..383523) [1845 bp, 614 aa] {ON}
           YGR138C (REAL)
          Length = 614

 Score = 47.0 bits (110), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 40/64 (62%), Gaps = 4/64 (6%)

Query: 98  TETLESLKTRGLDLRKKAIPDYNNPAMHTDRSQ-FPEEYQIETETGLVKVKTLQSLNRLD 156
           TET++SL+  G+      +PD N P   T ++  FPEEY +ET +GLV V TLQS+ R  
Sbjct: 45  TETVKSLQDLGVT-SNAPVPDINAP--QTAKNNIFPEEYTMETPSGLVPVATLQSMGRTA 101

Query: 157 TRVS 160
           T +S
Sbjct: 102 TALS 105

>SAKL0F02442g Chr6 (211990..213822) [1833 bp, 610 aa] {ON} highly
           similar to uniprot|P53283 Saccharomyces cerevisiae
           YGR138C TPO2 Polyamine transport protein
          Length = 610

 Score = 46.6 bits (109), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 37/63 (58%), Gaps = 2/63 (3%)

Query: 98  TETLESLKTRGLDLRKKAIPDYNNPAMHTDRSQFPEEYQIETETGLVKVKTLQSLNRLDT 157
           TET +SL+  G+   +  IPD N P  +     FPEEY +ET TGLV V TL S+ R  +
Sbjct: 44  TETAKSLQEMGVS-SEAPIPDINAP-QNVKSPIFPEEYTMETPTGLVPVATLHSIGRTTS 101

Query: 158 RVS 160
            VS
Sbjct: 102 AVS 104

>Skud_7.448 Chr7 complement(742873..744708) [1836 bp, 611 aa] {ON}
           YGR138C (REAL)
          Length = 611

 Score = 45.8 bits (107), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 27/63 (42%), Positives = 39/63 (61%), Gaps = 2/63 (3%)

Query: 98  TETLESLKTRGLDLRKKAIPDYNNPAMHTDRSQFPEEYQIETETGLVKVKTLQSLNRLDT 157
           TET++SL+  G+      +PD N P    + + FPEEY +ET +GLV V TLQS+ R  +
Sbjct: 45  TETVKSLQDLGVT-SAAPVPDINAPKTAKN-NIFPEEYTMETPSGLVPVATLQSMGRTAS 102

Query: 158 RVS 160
            +S
Sbjct: 103 ALS 105

>YGR138C Chr7 complement(763762..765606) [1845 bp, 614 aa] {ON}
           TPO2Polyamine transport protein specific for spermine;
           localizes to the plasma membrane; transcription of TPO2
           is regulated by Haa1p; member of the major facilitator
           superfamily
          Length = 614

 Score = 45.8 bits (107), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 28/64 (43%), Positives = 40/64 (62%), Gaps = 4/64 (6%)

Query: 98  TETLESLKTRGLDLRKKAIPDYNNPAMHTDRSQ-FPEEYQIETETGLVKVKTLQSLNRLD 156
           TET++SL+  G+      +PD N P   T ++  FPEEY +ET +GLV V TLQS+ R  
Sbjct: 45  TETVKSLQDLGVT-SAAPVPDINAP--QTAKNNIFPEEYTMETPSGLVPVATLQSMGRTA 101

Query: 157 TRVS 160
           + +S
Sbjct: 102 SALS 105

>Suva_7.425 Chr7 complement(733993..735834) [1842 bp, 613 aa] {ON}
           YGR138C (REAL)
          Length = 613

 Score = 45.4 bits (106), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 28/64 (43%), Positives = 40/64 (62%), Gaps = 4/64 (6%)

Query: 98  TETLESLKTRGLDLRKKAIPDYNNPAMHTDRSQ-FPEEYQIETETGLVKVKTLQSLNRLD 156
           TET++SL+  G+      +PD N P   T ++  FPEEY +ET +GLV V TLQS+ R  
Sbjct: 45  TETVKSLQDLGVT-SAAPVPDINAP--QTAKNNIFPEEYTMETPSGLVPVATLQSMGRTA 101

Query: 157 TRVS 160
           + +S
Sbjct: 102 SALS 105

>ZYRO0G19646g Chr7 (1631114..1632898) [1785 bp, 594 aa] {ON} similar
           to uniprot|P53283 Saccharomyces cerevisiae YGR138C TPO2
           Polyamine transport protein
          Length = 594

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/62 (41%), Positives = 36/62 (58%), Gaps = 2/62 (3%)

Query: 99  ETLESLKTRGLDLRKKAIPDYNNPAMHTDRSQFPEEYQIETETGLVKVKTLQSLNRLDTR 158
           ET E+L+T G+  R   +PD   P  +     FPEEY +ET +G+V +  L+SL R  T 
Sbjct: 41  ETAETLQTMGMA-RGTPLPDVVAPT-YAAAPVFPEEYTMETPSGIVPLAQLESLGRTVTT 98

Query: 159 VS 160
           VS
Sbjct: 99  VS 100

>Skud_14.209 Chr14 (384798..387791) [2994 bp, 997 aa] {ON} YNL123W
           (REAL)
          Length = 997

 Score = 31.2 bits (69), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 34/56 (60%)

Query: 54  EPLSGNPVRPNSEEILSVRSSNTLKKLDSNAIEKVLTHNAVEGNTETLESLKTRGL 109
           +PL  +P++P S +I+S+  +N      S+++  V T  AV  ++ + ++LKT GL
Sbjct: 519 DPLPADPLKPRSAKIISIPINNEKIANLSSSLCTVATMAAVPLDSLSADTLKTSGL 574

>Kpol_1031.36 s1031 complement(87105..89225) [2121 bp, 706 aa] {ON}
           complement(87105..89225) [2121 nt, 707 aa]
          Length = 706

 Score = 30.4 bits (67), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 29/98 (29%), Positives = 46/98 (46%), Gaps = 11/98 (11%)

Query: 51  IDPEPLSGNPVRPNSEEILSVRSSNTLKKLDSNAIEKVLTHNAVEGNTETLESLKTRGLD 110
           ID E +S    R  S + L   S + L+KL+   I++ +T   VE  +  LE LK R   
Sbjct: 197 IDTEKIS----RSYSMKYLKTLSEDVLRKLNFTLIQEDVTKEEVEDLSIKLERLKERHQS 252

Query: 111 LRKKA-------IPDYNNPAMHTDRSQFPEEYQIETET 141
             K+        +   N  ++  DR +F +EY +E E+
Sbjct: 253 ACKRLETVEQDELFLENALSLIKDRMKFIQEYDLELES 290

>KLTH0B02882g Chr2 (225842..227395) [1554 bp, 517 aa] {ON} weakly
           similar to uniprot|P47084 Saccharomyces cerevisiae
           YJR003C Hypothetical ORF
          Length = 517

 Score = 29.6 bits (65), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 42/83 (50%), Gaps = 7/83 (8%)

Query: 29  QAFTG--ADPSVEQPTIDHELEDEIDPEPLSGNPVRPNSEEILSVRSSNTLKK-LDSNAI 85
           Q ++G  ADP  +   I+  L DE++P  LS + +   S    S+ ++ ++++ + +  I
Sbjct: 24  QTYSGLLADPCFKNFNINESLNDELEPYDLSASIIGKLS----SLHAAPSVRETIHNRMI 79

Query: 86  EKVLTHNAVEGNTETLESLKTRG 108
           E +  H+   G   T E LK  G
Sbjct: 80  EALTKHDFSIGTIHTRELLKMGG 102

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.307    0.128    0.351 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 20,605,190
Number of extensions: 842792
Number of successful extensions: 2947
Number of sequences better than 10.0: 91
Number of HSP's gapped: 2926
Number of HSP's successfully gapped: 91
Length of query: 222
Length of database: 53,481,399
Length adjustment: 105
Effective length of query: 117
Effective length of database: 41,441,469
Effective search space: 4848651873
Effective search space used: 4848651873
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 63 (28.9 bits)