Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0F02882g3.487ON29829815910.0
Smik_6.2233.487ON3133167451e-97
NCAS0E008403.487ON3363147357e-96
YGR127W3.487ON3123157251e-94
Suva_7.4153.487ON3133167224e-94
Kwal_55.212173.487ON3032987214e-94
CAGL0I10582g3.487ON3193187191e-93
Skud_7.4383.487ON3133167051e-91
NDAI0G009703.487ON3323326992e-90
KLLA0E04687g3.487ON3063086945e-90
KLTH0F14718g3.487ON3002996901e-89
TDEL0D055503.487ON3103086738e-87
KAFR0C019303.487ON3133126632e-85
Kpol_1017.93.487ON3103136442e-82
KNAG0B008403.487ON3133126121e-77
TPHA0D032603.487ON3143156016e-76
ZYRO0D10098g3.487ON2762695794e-73
AFR305W3.487ON3093115791e-72
Ecym_12423.487ON3113135564e-69
TBLA0D029903.487ON3183155156e-63
Kpol_183.26.372ON1023117684.5
Kwal_26.90808.736ON142869668.1
KAFR0H029801.435ON70480669.2
ZYRO0E07546g6.247ON131952669.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0F02882g
         (298 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0F02882g Chr6 complement(243632..244528) [897 bp, 298 aa] {O...   617   0.0  
Smik_6.223 Chr6 (364603..365544) [942 bp, 313 aa] {ON} YGR127W (...   291   1e-97
NCAS0E00840 Chr5 complement(154182..155192) [1011 bp, 336 aa] {O...   287   7e-96
YGR127W Chr7 (746798..747736) [939 bp, 312 aa] {ON} Putative pro...   283   1e-94
Suva_7.415 Chr7 (716851..717792) [942 bp, 313 aa] {ON} YGR127W (...   282   4e-94
Kwal_55.21217 s55 (733995..734906) [912 bp, 303 aa] {ON} YGR127W...   282   4e-94
CAGL0I10582g Chr9 complement(1046028..1046987) [960 bp, 319 aa] ...   281   1e-93
Skud_7.438 Chr7 (726003..726944) [942 bp, 313 aa] {ON} YGR127W (...   276   1e-91
NDAI0G00970 Chr7 complement(202186..203184) [999 bp, 332 aa] {ON...   273   2e-90
KLLA0E04687g Chr5 complement(416178..417098) [921 bp, 306 aa] {O...   271   5e-90
KLTH0F14718g Chr6 (1207203..1208105) [903 bp, 300 aa] {ON} simil...   270   1e-89
TDEL0D05550 Chr4 (1003288..1004220) [933 bp, 310 aa] {ON} Anc_3....   263   8e-87
KAFR0C01930 Chr3 (386752..387693) [942 bp, 313 aa] {ON} Anc_3.48...   259   2e-85
Kpol_1017.9 s1017 complement(28899..29831) [933 bp, 310 aa] {ON}...   252   2e-82
KNAG0B00840 Chr2 complement(153939..154880) [942 bp, 313 aa] {ON...   240   1e-77
TPHA0D03260 Chr4 (672002..672946) [945 bp, 314 aa] {ON} Anc_3.48...   236   6e-76
ZYRO0D10098g Chr4 complement(851071..851901) [831 bp, 276 aa] {O...   227   4e-73
AFR305W Chr6 (995054..995983) [930 bp, 309 aa] {ON} Syntenic hom...   227   1e-72
Ecym_1242 Chr1 complement(495583..496518) [936 bp, 311 aa] {ON} ...   218   4e-69
TBLA0D02990 Chr4 complement(725170..726126) [957 bp, 318 aa] {ON...   202   6e-63
Kpol_183.2 s183 complement(2403..5474) [3072 bp, 1023 aa] {ON} c...    31   4.5  
Kwal_26.9080 s26 (1067363..1071649) [4287 bp, 1428 aa] {ON} YMR2...    30   8.1  
KAFR0H02980 Chr8 (569164..571278) [2115 bp, 704 aa] {ON}               30   9.2  
ZYRO0E07546g Chr5 (585395..589354) [3960 bp, 1319 aa] {ON} weakl...    30   9.5  

>SAKL0F02882g Chr6 complement(243632..244528) [897 bp, 298 aa] {ON}
           similar to uniprot|P53275 Saccharomyces cerevisiae
           YGR127W Hypothetical ORF
          Length = 298

 Score =  617 bits (1591), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/298 (100%), Positives = 298/298 (100%)

Query: 1   MCILLGTTAHPRYSLILISNRDEFFERETHPTCVHSDDFIVSPFDMSITTKGRNFGTWCG 60
           MCILLGTTAHPRYSLILISNRDEFFERETHPTCVHSDDFIVSPFDMSITTKGRNFGTWCG
Sbjct: 1   MCILLGTTAHPRYSLILISNRDEFFERETHPTCVHSDDFIVSPFDMSITTKGRNFGTWCG 60

Query: 61  VNKDGKVAVILNLRIASCGNPKNVECPQSRGIVPMKFLAGKDVDFNNWDSYEKFSHHYPG 120
           VNKDGKVAVILNLRIASCGNPKNVECPQSRGIVPMKFLAGKDVDFNNWDSYEKFSHHYPG
Sbjct: 61  VNKDGKVAVILNLRIASCGNPKNVECPQSRGIVPMKFLAGKDVDFNNWDSYEKFSHHYPG 120

Query: 121 IEKTGNFNLFYGDCSKGEYKLISSLSETTDGFQNDDGYMVVSNDLISSKKKWGKISLAKN 180
           IEKTGNFNLFYGDCSKGEYKLISSLSETTDGFQNDDGYMVVSNDLISSKKKWGKISLAKN
Sbjct: 121 IEKTGNFNLFYGDCSKGEYKLISSLSETTDGFQNDDGYMVVSNDLISSKKKWGKISLAKN 180

Query: 181 LLRNLVESSVDDTKDSILDKCFKLASHSTCSEKIVVKHESVTNETIYVPPLLVENGQDLD 240
           LLRNLVESSVDDTKDSILDKCFKLASHSTCSEKIVVKHESVTNETIYVPPLLVENGQDLD
Sbjct: 181 LLRNLVESSVDDTKDSILDKCFKLASHSTCSEKIVVKHESVTNETIYVPPLLVENGQDLD 240

Query: 241 VSMPCGKYYGTRSQIVILVSKDQKKMTFVERVLYTCDEDVLKYGPKNPKEQIEFEFDI 298
           VSMPCGKYYGTRSQIVILVSKDQKKMTFVERVLYTCDEDVLKYGPKNPKEQIEFEFDI
Sbjct: 241 VSMPCGKYYGTRSQIVILVSKDQKKMTFVERVLYTCDEDVLKYGPKNPKEQIEFEFDI 298

>Smik_6.223 Chr6 (364603..365544) [942 bp, 313 aa] {ON} YGR127W
           (REAL)
          Length = 313

 Score =  291 bits (745), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 149/316 (47%), Positives = 211/316 (66%), Gaps = 21/316 (6%)

Query: 1   MCILLGTTAHPRYSLILISNRDEFFERETHPTCVHSDDFIVSPFDMSITTK-GRNFGTWC 59
           MCIL+ T AHP Y LILISNRDEF  R+TH TC H+DDFI+SP+D++ T+K G+ FGTW 
Sbjct: 1   MCILMATRAHPDYELILISNRDEFLARKTHATCWHNDDFILSPYDLARTSKEGQEFGTWS 60

Query: 60  GVNKDGKVAVILNLRIASCGNPKNVECPQSRGIVPMKFLAGKDVDFNNWDSYEKFSHHYP 119
           G+NK+GK+A ILNL++   G+ ++    +SRG++P  FL+  + +F +WDSY KF +HY 
Sbjct: 61  GINKEGKLATILNLKL---GSERSTIKSKSRGLLPYIFLSNHEANFKDWDSYSKFGNHYD 117

Query: 120 GIEKTGNFNLFYGDCSKGEYKLISSLSETTDGFQND-----DGYMVVSNDLISS-----K 169
           G++ TG+FN FYGD  + +YK+I SL  T D   +      D YMV+SN    +     +
Sbjct: 118 GLKATGDFNFFYGDVIEKQYKVIDSLGRTFDVLSSTCRKDLDSYMVISNGRFYNTSSIPE 177

Query: 170 KKWGKISLAKNLLRNLVESSVDDTKDSILDKCFKLASHS----TCSEKIVVK---HESVT 222
           K W K+ LA++ L +LV  ++   +++I+  CF+LAS S    T S+  V++     +VT
Sbjct: 178 KAWEKVKLARDSLEDLVSDNIGLDEETIISSCFQLASKSSLPGTVSKPDVLQMLVDPNVT 237

Query: 223 NETIYVPPLLVENGQDLDVSMPCGKYYGTRSQIVILVSKDQKKMTFVERVLYTCDEDVLK 282
             TIYVPPL    G DL  S+P G +YGTRSQIV+L+SKD  K TF+ER++Y+ DEDV +
Sbjct: 238 MSTIYVPPLRRPPGDDLGASIPDGDFYGTRSQIVLLISKDSTKATFIERIIYSSDEDVRQ 297

Query: 283 YGPKNPKEQIEFEFDI 298
           Y    PKE+  FEF++
Sbjct: 298 YSVSAPKEEKRFEFEL 313

>NCAS0E00840 Chr5 complement(154182..155192) [1011 bp, 336 aa] {ON}
           Anc_3.487 YGR127W
          Length = 336

 Score =  287 bits (735), Expect = 7e-96,   Method: Compositional matrix adjust.
 Identities = 151/314 (48%), Positives = 200/314 (63%), Gaps = 19/314 (6%)

Query: 1   MCILLGTTAHPRYSLILISNRDEFFERETHPTCVHSDDFIVSPFDMSIT---TKGRNFGT 57
           MCILL TTAHP+Y LILISNRDEFFER+TH +C H+DDFI+SPFDM+ +    + + FGT
Sbjct: 17  MCILLATTAHPQYELILISNRDEFFERKTHVSCWHNDDFILSPFDMAKSCELHEKKIFGT 76

Query: 58  WCGVNKDGKVAVILNLRIASCGNPKNVECPQSRGIVPMKFLAGKDVDFNNWDSYEKFSHH 117
           W G+N+D K+A ILNL++ S  + K +  PQSRG++P  FL+  D DFN WD+YEKF   
Sbjct: 77  WIGINRDAKIATILNLKLESQLDLKQLVKPQSRGMIPFVFLSEHDSDFNKWDTYEKFDGK 136

Query: 118 YPGIEKTGNFNLFYGDCSKGEYKLISSLSETTDGFQNDDGYMVVSNDLISSK-------- 169
           Y  + KTG+FN FYGD    EY++I S   T       D Y+ VSND+ ++         
Sbjct: 137 YNYLRKTGDFNFFYGDPLNDEYRIIDSKGNTFKVLSG-DPYLTVSNDMFATGGITVERAS 195

Query: 170 ----KKWGKISLAKNLLRNLVESSVDDTKDSILDKCFKLASHSTCSEKIVVK---HESVT 222
                +W KI   K LL++LVE S    +D +++KCFKLAS  +   K   K   + ++ 
Sbjct: 196 NNRIAEWRKIKFGKILLQDLVEESKSLDEDMLIEKCFKLASTCSVQPKENTKFNQNSTLP 255

Query: 223 NETIYVPPLLVENGQDLDVSMPCGKYYGTRSQIVILVSKDQKKMTFVERVLYTCDEDVLK 282
            ETI+VPPL  E   D+  S+  GKYYGTRSQIVIL+SK+ +++  VE +LYT D D+  
Sbjct: 256 METIFVPPLECEVNDDIGTSLSVGKYYGTRSQIVILISKNHERVKLVEHILYTSDNDIQH 315

Query: 283 YGPKNPKEQIEFEF 296
           Y   NPKE   FEF
Sbjct: 316 YSSTNPKEVKSFEF 329

>YGR127W Chr7 (746798..747736) [939 bp, 312 aa] {ON} Putative
           protein of unknown function; expression is regulated by
           Msn2p/Msn4p, indicating a possible role in stress
           response
          Length = 312

 Score =  283 bits (725), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 148/315 (46%), Positives = 202/315 (64%), Gaps = 20/315 (6%)

Query: 1   MCILLGTTAHPRYSLILISNRDEFFERETHPTCVHSDDFIVSPFDMSITTKGRN-FGTWC 59
           MCIL+ T AHP Y LILISNRDEF  R+TH TC H++DFI+SP+D++ T+  +  FGTW 
Sbjct: 1   MCILMATRAHPDYELILISNRDEFLARKTHATCWHNNDFILSPYDLAKTSAEKQIFGTWS 60

Query: 60  GVNKDGKVAVILNLRIASCGNPKNVECPQSRGIVPMKFLAGKDVDFNNWDSYEKFSHHYP 119
           G+NK+GK+A ILNL++    N +N    +SRG++P  FL+    DF +WD+Y+KF  HY 
Sbjct: 61  GINKEGKLATILNLKL---DNEQNNTKSRSRGLLPFIFLSIHKADFEDWDNYKKFEGHYD 117

Query: 120 GIEKTGNFNLFYGDCSKGEYKLISSLSETTDGFQND-----DGYMVVSNDLISSK----- 169
           G++ TG+FN FYGD  K +YK+I SL  T D   +      D YMVVSN           
Sbjct: 118 GLKSTGDFNFFYGDVIKKQYKVIDSLGRTFDVLSSTCRKDLDSYMVVSNGKFYDSSSIPG 177

Query: 170 KKWGKISLAKNLLRNLVESSVDDTKDSILDKCFKLASHSTCSEKIV------VKHESVTN 223
           + W K+ +A++ L NLV  +++  ++ I+  CF+LAS S+    I       +   +VT 
Sbjct: 178 QAWEKVKVARDSLENLVLENIESDEEKIISSCFQLASKSSLPSTISNPDVLQMVDPNVTM 237

Query: 224 ETIYVPPLLVENGQDLDVSMPCGKYYGTRSQIVILVSKDQKKMTFVERVLYTCDEDVLKY 283
            TIYVPPL      DL  S+P G YYGTRSQIV+LVSKD  ++TF+ERVLY+ DEDV KY
Sbjct: 238 NTIYVPPLRRPPRDDLGASIPDGDYYGTRSQIVLLVSKDSTRVTFIERVLYSSDEDVRKY 297

Query: 284 GPKNPKEQIEFEFDI 298
              +PKE+  F+F +
Sbjct: 298 SVTSPKEEKRFKFKL 312

>Suva_7.415 Chr7 (716851..717792) [942 bp, 313 aa] {ON} YGR127W
           (REAL)
          Length = 313

 Score =  282 bits (722), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 144/316 (45%), Positives = 201/316 (63%), Gaps = 21/316 (6%)

Query: 1   MCILLGTTAHPRYSLILISNRDEFFERETHPTCVHSDDFIVSPFDMSITTKGRN-FGTWC 59
           MCIL+ T AHP Y LILISNRDEF ER+TH TC H+DDFI+SP+D++ T+  +  FGTW 
Sbjct: 1   MCILMATRAHPAYELILISNRDEFLERKTHATCWHNDDFILSPYDVAKTSMEKQIFGTWS 60

Query: 60  GVNKDGKVAVILNLRIASCGNPKNVECPQSRGIVPMKFLAGKDVDFNNWDSYEKFSHHYP 119
           G+NK+GK+A ILNL++    + ++    +SRG++P  FL      F +WD Y KF  HY 
Sbjct: 61  GINKEGKLATILNLKM---DDQRSCTKSKSRGMLPFTFLTSHKARFQDWDDYNKFEKHYD 117

Query: 120 GIEKTGNFNLFYGDCSKGEYKLISSLSETTDGF-----QNDDGYMVVSNDLIS-----SK 169
           G+  TG+FN FYGD  +  YK+I SL  T D       ++ D YMV+SN         S+
Sbjct: 118 GLRTTGDFNFFYGDVIEKRYKVIDSLGHTFDVLGSTCRRDPDSYMVISNGKYHNSSSISE 177

Query: 170 KKWGKISLAKNLLRNLVESSVDDTKDSILDKCFKLASHSTCSEK-------IVVKHESVT 222
           + W K+ +A++ L  L+  +++  +++++  CF+LAS S+  +         ++   +VT
Sbjct: 178 QAWEKVKIARDSLETLILDNIESDEETLISNCFQLASKSSLPDTGLKPDLLQMLVDPNVT 237

Query: 223 NETIYVPPLLVENGQDLDVSMPCGKYYGTRSQIVILVSKDQKKMTFVERVLYTCDEDVLK 282
             TIYVPPL    G DL  S+P G YYGTRSQIV+LVSKD  K+TF+ERVLY+ DEDV  
Sbjct: 238 MNTIYVPPLRRPPGDDLGASIPDGDYYGTRSQIVLLVSKDSSKVTFIERVLYSSDEDVSH 297

Query: 283 YGPKNPKEQIEFEFDI 298
           Y    PKE+  FEF++
Sbjct: 298 YSASAPKEEKRFEFEL 313

>Kwal_55.21217 s55 (733995..734906) [912 bp, 303 aa] {ON} YGR127W -
           Hypothetical ORF [contig 131] FULL
          Length = 303

 Score =  282 bits (721), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 141/298 (47%), Positives = 196/298 (65%), Gaps = 4/298 (1%)

Query: 1   MCILLGTTAHPRYSLILISNRDEFFERETHPTCVHSDDFIVSPFDMSITTKGR-NFGTWC 59
           MCILL ++AHPRYSLILISNRDEF ER+T  TC++ DD++VSP DM++      N GTWC
Sbjct: 1   MCILLASSAHPRYSLILISNRDEFVERQTRCTCLNHDDYVVSPLDMTLKDNNEPNLGTWC 60

Query: 60  GVNKDGKVAVILNLRIASCGNPKNVECPQSRGIVPMKFLAGKDVDFNNWDSYEKFSHHYP 119
           G N++G++AVILNLR  +    K      SRG V M++L  K    ++W+SY KF+   P
Sbjct: 61  GANRNGRIAVILNLRTGNTNQTKTKRI-VSRGNVTMRYLTDKQ-PASDWNSYAKFASKCP 118

Query: 120 GIEKTGNFNLFYGDCSKGEYKLISSLSETTDGFQNDDGYMVVSNDLISSKKKWGKISLAK 179
            I K+  FN+FYGDC  G+Y  I S   + +  ++ + Y+V+SND I S  KW KI LA+
Sbjct: 119 DI-KSCEFNMFYGDCKSGDYTAIDSSGHSFEVLRSQNPYLVISNDSIESATKWPKIELAE 177

Query: 180 NLLRNLVESSVDDTKDSILDKCFKLASHSTCSEKIVVKHESVTNETIYVPPLLVENGQDL 239
            L+R+LV  SV+D++D +L +CF LASH        +  E VT+  I+VPPL V   +DL
Sbjct: 178 KLMRDLVRDSVNDSEDDLLARCFSLASHKQDYNVDHMDKEKVTSSNIFVPPLEVPKSEDL 237

Query: 240 DVSMPCGKYYGTRSQIVILVSKDQKKMTFVERVLYTCDEDVLKYGPKNPKEQIEFEFD 297
             S+PCG++YGTRSQIV+LVSK+ K + FVE VLY  D +   +   NPK+ + ++ +
Sbjct: 238 GASVPCGRFYGTRSQIVVLVSKEDKSIRFVEHVLYDSDPETTHFCAANPKKCVSYKIN 295

>CAGL0I10582g Chr9 complement(1046028..1046987) [960 bp, 319 aa]
           {ON} similar to uniprot|P53275 Saccharomyces cerevisiae
           YGR127w
          Length = 319

 Score =  281 bits (719), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 143/318 (44%), Positives = 202/318 (63%), Gaps = 20/318 (6%)

Query: 1   MCILLGTTAHPRYSLILISNRDEFFERETHPTCVHSDDFIVSPFDMSITTKGRN---FGT 57
           MCIL  T  HP Y LI+ISNRDEF ER+TH TC H+DDFI+SP+D++    G++   FGT
Sbjct: 1   MCILFATREHPDYELIMISNRDEFLERKTHSTCWHNDDFILSPYDLARIGAGQSNDTFGT 60

Query: 58  WCGVNKDGKVAVILNLRIASCGNPKNVECPQSRGIVPMKFLAGKDVDFNNWDSYEKFSHH 117
           W GVN+ G+VA +LNLRI    + K +   +SRG +P  FL  +  +F +WD+Y KF   
Sbjct: 61  WTGVNRKGRVATVLNLRICDELDMKRMIGERSRGALPFVFLNDRQGNFEDWDTYAKFCKC 120

Query: 118 YPGIEKTGNFNLFYGDCSKGEYKLISSLSETTDGFQN-DDGYMVVSN-----------DL 165
           YP I++TG+FNLFYGD  +G Y LI SL  T   F     GY+V+SN           D+
Sbjct: 121 YPDIKRTGDFNLFYGDFKEGRYALIDSLGNTHPLFSKPGKGYLVISNNIHDKLHLQSQDI 180

Query: 166 ISSKKKWGKISLAKNLLRNLVESSVDDTKDSILDKCFKLASHSTCSEKI-----VVKHES 220
            S  ++WGKI   K ++   V+++ +  K+ +++ CFKLAS +   +KI     +VK   
Sbjct: 181 NSGPEEWGKIKKGKQIMEEFVKTNTNLGKEDVIENCFKLASTNLILDKITEEFDLVKSLG 240

Query: 221 VTNETIYVPPLLVENGQDLDVSMPCGKYYGTRSQIVILVSKDQKKMTFVERVLYTCDEDV 280
           VT ETIYV PLL    +++   +  G+YYGTRSQIV+LV K + K TF+ER++Y+ D+D+
Sbjct: 241 VTKETIYVQPLLTPPHEEIGSPLTAGQYYGTRSQIVLLVDKSKTKATFIERIIYSSDQDI 300

Query: 281 LKYGPKNPKEQIEFEFDI 298
             Y   NPKE++ +E+DI
Sbjct: 301 SLYSTSNPKEELRYEYDI 318

>Skud_7.438 Chr7 (726003..726944) [942 bp, 313 aa] {ON} YGR127W
           (REAL)
          Length = 313

 Score =  276 bits (705), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 143/316 (45%), Positives = 199/316 (62%), Gaps = 21/316 (6%)

Query: 1   MCILLGTTAHPRYSLILISNRDEFFERETHPTCVHSDDFIVSPFDMSITTKGRN-FGTWC 59
           MCIL+ T AHP Y LILISNRDEF  R+TH TC H+DDFI+SP+D++ T+K +  FGTW 
Sbjct: 1   MCILMATRAHPDYELILISNRDEFLARKTHATCWHNDDFILSPYDLAKTSKEKQIFGTWS 60

Query: 60  GVNKDGKVAVILNLRIASCGNPKNVECPQSRGIVPMKFLAGKDVDFNNWDSYEKFSHHYP 119
           G+N++GK+A ILNL++      ++    +SRG++P  FL+    DF NWD+Y+KF  +Y 
Sbjct: 61  GINREGKLATILNLKL---DGQRDTIKSKSRGLLPFTFLSTHKADFQNWDNYDKFEMNYD 117

Query: 120 GIEKTGNFNLFYGDCSKGEYKLISSLSETTDGF-----QNDDGYMVVSNDLIS-----SK 169
           G+  TG+FN FYGD  + +YKLI SL  T +        N + YM VSN         S+
Sbjct: 118 GLNTTGDFNFFYGDVIEKQYKLIDSLGRTFNVLDSTCKSNLNSYMAVSNGEFYNSPSISE 177

Query: 170 KKWGKISLAKNLLRNLVESSVDDTKDSILDKCFKLASHSTCSEKI-------VVKHESVT 222
           + W K+ +A++ L  LV  ++D  +++I+  CF+LAS S+            ++   +V 
Sbjct: 178 QAWKKVKVARDGLEKLVLGNIDSDEETIISNCFQLASKSSVPGTASKPNALQMLADPNVI 237

Query: 223 NETIYVPPLLVENGQDLDVSMPCGKYYGTRSQIVILVSKDQKKMTFVERVLYTCDEDVLK 282
             TIYVPPL      DL  S+P G YYGTRSQIV+LVSK+  K+TF+ER+LY+ DEDV  
Sbjct: 238 MNTIYVPPLRRPPDDDLGASIPDGDYYGTRSQIVLLVSKNSSKVTFIERILYSSDEDVNH 297

Query: 283 YGPKNPKEQIEFEFDI 298
           Y    PKE+  FEF +
Sbjct: 298 YSVATPKEEKRFEFKL 313

>NDAI0G00970 Chr7 complement(202186..203184) [999 bp, 332 aa] {ON}
           Anc_3.487 YGR127W
          Length = 332

 Score =  273 bits (699), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 141/332 (42%), Positives = 205/332 (61%), Gaps = 36/332 (10%)

Query: 1   MCILLGTTAHPRYSLILISNRDEFFERETHPTCVHSDDFIVSPFDMSITTK---GRNFGT 57
           MCILL TTAHP Y LILISNRDEF +R+TH +C H+DDFI+SP+DM+   K    + FGT
Sbjct: 1   MCILLATTAHPDYELILISNRDEFLQRKTHTSCWHNDDFILSPYDMAKECKYNDKKVFGT 60

Query: 58  WCGVNKDGKVAVILNLRIASCGNPKNVECPQSRGIVPMKFLAGKDVD-FNNWDSYEKFSH 116
           W G+NKDGK+A +LNL++    + K +  P+SRG++P  +L+    D F  WD Y+ F+ 
Sbjct: 61  WLGINKDGKIATVLNLKLNKSLSLKQLVAPKSRGMLPFVYLSDMTEDSFAEWDGYDNFTK 120

Query: 117 HYPGIEKTGNFNLFYGDCSKGEYKLISSLSETTDGFQNDDGYMVVSND------------ 164
            YPG++ TG+FNLFYGD  + +Y+++ S+  T     ++  Y+VVSND            
Sbjct: 121 KYPGLQSTGDFNLFYGDVKRKQYRIMDSIGNTVSTLNSNCQYLVVSNDVFTCNGQLGELQ 180

Query: 165 -----------LISSKKKWGKISLAKNLLRNLVESSVDDTKD--SILDKCFKLASHSTCS 211
                      L S  + WGK+ L   LL++LV  S+ + +D  +I+ +CFKL+S  TCS
Sbjct: 181 SNIKREGKQPCLQSKIETWGKVKLGTALLQSLVNKSIVEKQDEDTIISECFKLSS--TCS 238

Query: 212 EKI-----VVKHESVTNETIYVPPLLVENGQDLDVSMPCGKYYGTRSQIVILVSKDQKKM 266
             +       ++ ++ NETI VPPL  +   D+  S+P G+YYGTRSQIVIL+ +   ++
Sbjct: 239 VTVEDHCKFHQNSTLPNETILVPPLRCKITDDVGTSLPIGEYYGTRSQIVILIKRGTYEV 298

Query: 267 TFVERVLYTCDEDVLKYGPKNPKEQIEFEFDI 298
            F E V+YT D D+  + P NPKE + F+F +
Sbjct: 299 KFAEHVIYTSDSDIKTFSPANPKETVRFDFTL 330

>KLLA0E04687g Chr5 complement(416178..417098) [921 bp, 306 aa] {ON}
           similar to uniprot|P53275 Saccharomyces cerevisiae
           YGR127W Hypothetical ORF
          Length = 306

 Score =  271 bits (694), Expect = 5e-90,   Method: Compositional matrix adjust.
 Identities = 144/308 (46%), Positives = 201/308 (65%), Gaps = 14/308 (4%)

Query: 1   MCILLGTTAHPRYSLILISNRDEFFERETHPTCVHSDDFIVSPFDMSITTKGRNFGTWCG 60
           MCIL  T AHP Y LIL+SNRDEFFER+TH TC + D FI+SP+DM+I  KG+ +GTW G
Sbjct: 1   MCILFATRAHPDYKLILLSNRDEFFERKTHATCWNHDGFILSPYDMAIEKKGQGYGTWLG 60

Query: 61  VNKDGKVAVILNLRIASCGNPKNVEC---PQSRGIVPMKFLAGKD-VDFNNWDSYEKFSH 116
           +N+ G++AVILNL+I S  + ++V     P+SRGIVP++FL  +D   F+NWDS+EKF+ 
Sbjct: 61  INRRGRIAVILNLKIDSPLDSESVLVNGEPRSRGIVPLQFLQQEDNAPFDNWDSWEKFNG 120

Query: 117 HYPGIEKTGNFNLFYGDCSKGEYKLISSLSETTDGFQNDDGYMVVSNDLI-----SSKKK 171
            +  + +TG F LFYGD    EY +I  L  +T+ F+  + +MV+SND+          +
Sbjct: 121 QHGNLRRTGPFTLFYGDAKSDEYNVIDYLKHSTNPFEKME-HMVISNDIFHCAVGEHTSR 179

Query: 172 WGKISLAKNLLRNLVESSVDDTKDSILDKCFKLASHSTCSEKIVVKHESVTNETIYVPPL 231
           W K      LL  L +++    K+ +L KCF+L S+ T +E   V  +SVT  +IYVPPL
Sbjct: 180 WNKTEYGYVLLDALAKNTTGIAKEELLQKCFELLSNHTFNEGEDV--DSVTTSSIYVPPL 237

Query: 232 LVENGQD-LDVSMPCGKYYGTRSQIVILVSKDQKKMTFVERVLYTCDEDVLKYGPKNPKE 290
            +  G D +  S+P G YYGTRSQIVILV KD  ++T+ E V+Y  DED   Y   +PKE
Sbjct: 238 RITKGADAIGTSLPIGDYYGTRSQIVILVDKDN-RVTYEEHVIYESDEDCETYSFMDPKE 296

Query: 291 QIEFEFDI 298
            I+F+F++
Sbjct: 297 VIQFQFNM 304

>KLTH0F14718g Chr6 (1207203..1208105) [903 bp, 300 aa] {ON} similar
           to uniprot|P53275 Saccharomyces cerevisiae YGR127W
           Hypothetical ORF
          Length = 300

 Score =  270 bits (690), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 133/299 (44%), Positives = 196/299 (65%), Gaps = 3/299 (1%)

Query: 1   MCILLGTTAHPRYSLILISNRDEFFERETHPTCVHSDDFIVSPFDMSITTKGR-NFGTWC 59
           MCIL+ + AHP+YSLI ISNRDEFFER+T  TC++ DD+I+SP D ++ +  +   GTWC
Sbjct: 1   MCILMASVAHPKYSLIAISNRDEFFERKTSNTCLNHDDYILSPLDTALRSNNKPALGTWC 60

Query: 60  GVNKDGKVAVILNLRIASCGNPKNVECPQSRGIVPMKFLAGKDVDFNNWDSYEKFSHHYP 119
           GVN+ G+VAVILNLR         V+ P SRG VPMK+L  +     +W+S+EKF   YP
Sbjct: 61  GVNRKGRVAVILNLRNKEPAKRIPVKSPISRGSVPMKYLMDRGPS-TDWNSFEKFVSKYP 119

Query: 120 GIEKTGNFNLFYGDCSKGEYKLISSLSETTDGFQNDDGYMVVSNDLISSKKKWGKISLAK 179
            I +   FN+FYGDC  GEY  I SL  +++    +   +V+SND I S  +W K+  A 
Sbjct: 120 QITEC-EFNMFYGDCIAGEYTCIDSLGYSSEALTANKPNLVLSNDHIDSSSRWPKVQKAD 178

Query: 180 NLLRNLVESSVDDTKDSILDKCFKLASHSTCSEKIVVKHESVTNETIYVPPLLVENGQDL 239
            LL+ LV+SS  D+++ +++KCF LAS++  +E      E  T  +I++PP+ +    D+
Sbjct: 179 ILLQELVQSSQHDSEEELIEKCFALASNTEPAEIDNSDKEEFTCSSIFIPPVEIPEKVDV 238

Query: 240 DVSMPCGKYYGTRSQIVILVSKDQKKMTFVERVLYTCDEDVLKYGPKNPKEQIEFEFDI 298
             S+PCG++YGTRSQIVILV + ++ ++F ERVL+  D +V  +  K+PKE+++F   +
Sbjct: 239 GASLPCGRFYGTRSQIVILVKRHERTISFTERVLHDSDFEVPLHSEKHPKEKLQFNLHV 297

>TDEL0D05550 Chr4 (1003288..1004220) [933 bp, 310 aa] {ON} Anc_3.487
           YGR127W
          Length = 310

 Score =  263 bits (673), Expect = 8e-87,   Method: Compositional matrix adjust.
 Identities = 127/308 (41%), Positives = 193/308 (62%), Gaps = 10/308 (3%)

Query: 1   MCILLGTTAHPRYSLILISNRDEFFERETHPTCVHSDDFIVSPFDMSITTKGRNFGTWCG 60
           MCIL+ T+ HP+Y L+L+SNRDE+F R+  P     D+F++ P D  + + G + GTW G
Sbjct: 1   MCILIATSDHPKYDLVLVSNRDEYFARKASPASWTEDNFMLCPLDKGLDSSGEDLGTWIG 60

Query: 61  VNKDGKVAVILNLRIASCGNPKNVECPQSRGIVPMKFLAGKDVDFNNWDSYEKFSHHYPG 120
            N+DGK+  +LNL++ S    +   CP+SRG +P+ FL+ +  +F +WD+Y+KF H + G
Sbjct: 61  ANRDGKIGTVLNLKLFSDPRGRPAVCPESRGKIPVSFLSSRGANFKDWDTYDKFCHQFQG 120

Query: 121 IEKTGNFNLFYGDCSKGEYKLISSLSETTDGF-QNDDGYMVVSNDLISSK----KKWGKI 175
           +E T +FN FYGDCS G+Y++I SL  TT    + ++ Y+VVSND+   +    + W KI
Sbjct: 121 LEFTRDFNFFYGDCSIGDYRVIDSLGNTTKVLGKTNEKYIVVSNDIFQGESNKNRVWDKI 180

Query: 176 SLAKNLLRNLVESSVDDTKDSILDKCFKLASHSTCSEK-----IVVKHESVTNETIYVPP 230
           SLA   L +LV    D  +D  + +CF +AS +    K       +K   ++ +T++VPP
Sbjct: 181 SLADQALHHLVREFNDTDEDKFIQECFGIASINPFHSKHDHGNYYMKAVELSMQTVFVPP 240

Query: 231 LLVENGQDLDVSMPCGKYYGTRSQIVILVSKDQKKMTFVERVLYTCDEDVLKYGPKNPKE 290
           L       L  S+P G+YYGTRSQ VILVSKD+  +T+VER+++  D D L+Y   + KE
Sbjct: 241 LKTSCDDGLGASVPIGEYYGTRSQTVILVSKDRSHITYVERIIHDSDLDALQYSRDHYKE 300

Query: 291 QIEFEFDI 298
           Q  ++FD+
Sbjct: 301 QKRYDFDL 308

>KAFR0C01930 Chr3 (386752..387693) [942 bp, 313 aa] {ON} Anc_3.487
           YGR127W
          Length = 313

 Score =  259 bits (663), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 134/312 (42%), Positives = 190/312 (60%), Gaps = 14/312 (4%)

Query: 1   MCILLGTTAHPRYSLILISNRDEFFERETHPTCVHSDDFIVSPFDMSITTKGRN--FGTW 58
           MCIL  T +H  Y LILISNRDE+  R+TH TC H+D+FI+SP+DMS      N  FGTW
Sbjct: 1   MCILFATRSHKEYELILISNRDEYLGRKTHETCWHNDNFILSPYDMSREENHGNKIFGTW 60

Query: 59  CGVNKDGKVAVILNLRIASCGNPKNVECPQSRGIVPMKFLAG---KDVDFNNWDSYEKFS 115
            G+NK GK+A ILNLR  S  + K +  P+SRG++P  FL      +  F  W+++EKF 
Sbjct: 61  LGMNKKGKIATILNLRRFSSIDLKELVKPRSRGLIPFTFLYSDWTNEDSFEEWETFEKFK 120

Query: 116 HHYPGIEKTGNFNLFYGDCSKGEYKLISSLSETTDGFQNDDGYMVVSNDLISSKKK---- 171
             YP ++ +G+FN FYGD  +G Y++I SL  T     N++  M++SNDL   K +    
Sbjct: 121 SKYPFLQSSGDFNFFYGDIKEGNYRIIDSLGNTFKVLDNNNRNMIISNDLYQHKDEYEGK 180

Query: 172 --WGKISLAKNLLRNLVESSVDDTKDSILDKCFKLASHSTCSEKIVVK---HESVTNETI 226
             WGKI +    L   ++ +    +D +L KCF+LAS+ +    I  +   ++ +  ETI
Sbjct: 181 PTWGKIKIGAERLNKFLKETERSNEDEVLAKCFELASYCSIDSSITREENPNKELAAETI 240

Query: 227 YVPPLLVENGQDLDVSMPCGKYYGTRSQIVILVSKDQKKMTFVERVLYTCDEDVLKYGPK 286
           YVPPL V   +D+ ++   GKYYGTR+QIV+LV KD+K +T VE  ++  DE++ KY   
Sbjct: 241 YVPPLKVCPDEDIGLTKTNGKYYGTRTQIVVLVHKDRKHVTLVEHTIHNSDEEIYKYSGL 300

Query: 287 NPKEQIEFEFDI 298
           NPKE    +F I
Sbjct: 301 NPKEVQRLDFTI 312

>Kpol_1017.9 s1017 complement(28899..29831) [933 bp, 310 aa] {ON}
           complement(28899..29831) [933 nt, 311 aa]
          Length = 310

 Score =  252 bits (644), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 137/313 (43%), Positives = 196/313 (62%), Gaps = 18/313 (5%)

Query: 1   MCILLGTTAHPRYSLILISNRDEFFERETHPTCVHSDDF--IVSPFDMSITTKGR--NFG 56
           MCILL +  HP Y LILISNRDEF +R TH TC +  ++  I+ P+DMS + +      G
Sbjct: 1   MCILLASRDHPNYDLILISNRDEFLQRRTHETCWNQGEYARILCPYDMSKSNEKNVNKIG 60

Query: 57  TWCGVNKDGKVAVILNLRIASCGNPKNVECPQSRGIVPMKFLAGKDVD-FNNWDSYEKFS 115
           TWCG+N+ G+V+ ILNL+             +SRG +P+KFL  K+ D   NWDSYEKF 
Sbjct: 61  TWCGINEFGRVSTILNLKNDDSFQSSVPSTKKSRGALPIKFLDNKETDSLLNWDSYEKFV 120

Query: 116 HHYPGIEKTGNFNLFYGDCSKGEYKLISSLSETTDGFQNDDGYMVVSNDLIS-----SKK 170
             YP +++TG+FN FYGD   G+Y +I S+  T +    D+ Y+V+SND        S K
Sbjct: 121 KEYPFVKETGDFNFFYGDVRIGKYNVIDSIGSTNEVLTVDNPYLVISNDKFGKSNGKSTK 180

Query: 171 KWGKISLAKNLLRNLVESSVDDTKDSILDKCFKLASHSTCSEKIV--VKHESVTNETIYV 228
           +W KI+LAKNLL++L    + +T+D ++ KCF +AS +T +E ++  V    +  ETI V
Sbjct: 181 EWEKITLAKNLLKHL---PLCETEDDLIHKCFDIASTNTLNEDLIKDVDVRELMTETILV 237

Query: 229 PPLLV---ENGQDLDVSMPCGKYYGTRSQIVILVSKDQKKMTFVERVLYTCDEDVLKYGP 285
           PPL V   E  + +  S+P G+YYGTRSQIVILV+K++ K+ F+ER+LY  D+DV     
Sbjct: 238 PPLNVMTKEEKEKIGASLPIGQYYGTRSQIVILVNKNRTKVKFIERILYNSDDDVTTQKL 297

Query: 286 KNPKEQIEFEFDI 298
            +P + + + F I
Sbjct: 298 SSPIQDLTYNFTI 310

>KNAG0B00840 Chr2 complement(153939..154880) [942 bp, 313 aa] {ON}
           Anc_3.487 YGR127W
          Length = 313

 Score =  240 bits (612), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 135/312 (43%), Positives = 192/312 (61%), Gaps = 15/312 (4%)

Query: 1   MCILLGTTAHPRYSLILISNRDEFFERETHPTCVHSDDFIVSPFDMS--ITTKGRNF-GT 57
           MCILLGT  HP Y L+LISNRDEFFER+TH T  HS D+I+SP+DM+  +   G+   GT
Sbjct: 1   MCILLGTREHPDYDLVLISNRDEFFERDTHITEWHSGDYILSPYDMTKGLYDPGKCVRGT 60

Query: 58  WCGVNKDGKVAVILNLRIASCGNPKNVECP---QSRGIVPMKFLAGKDVDFNNWDSYEKF 114
           W G+N+ G+V+ +LNL++      K+ + P   +SRG++P  FL+ +    + WDS+EKF
Sbjct: 61  WMGLNRAGRVSTVLNLKLEGEALRKHSKNPVKRRSRGLIPFMFLSDRGF-IDQWDSFEKF 119

Query: 115 SHHYPGIEKTGNFNLFYGDCSKGEYKLISSLSETTDGFQNDDGY-MVVSNDLI-----SS 168
              YP +EK+G+FNLF GD  + +YK++ S   T        G  MVVSND       + 
Sbjct: 120 RDRYPDLEKSGDFNLFIGDIRQQDYKVLDSSGNTFSVLNETTGMNMVVSNDTYKEFNEND 179

Query: 169 KKKWGKISLAKNLLRNLVESSVDDTKDSILDKCFKLASHSTC--SEKIVVKHESVTNETI 226
             +W K+ L K  L  LV ++V+  K S +DKCF  AS  +   S + + K   V + TI
Sbjct: 180 ISEWNKVKLGKLKLHELVNTAVNLDKSSFIDKCFHAASFCSIEKSHEDISKTPEVISNTI 239

Query: 227 YVPPLLVENGQDLDVSMPCGKYYGTRSQIVILVSKDQKKMTFVERVLYTCDEDVLKYGPK 286
           +VPPL  +  QD+ ++   G Y+GTRSQ+V LVSKD++++T  ER+L+T D D     P 
Sbjct: 240 FVPPLKCQPQQDVGLTKSGGLYFGTRSQLVTLVSKDRRQVTVAERILHTSDLDRDFNSPH 299

Query: 287 NPKEQIEFEFDI 298
           NPKE  +F FD+
Sbjct: 300 NPKEVKQFTFDL 311

>TPHA0D03260 Chr4 (672002..672946) [945 bp, 314 aa] {ON} Anc_3.487
           YGR127W
          Length = 314

 Score =  236 bits (601), Expect = 6e-76,   Method: Compositional matrix adjust.
 Identities = 137/315 (43%), Positives = 205/315 (65%), Gaps = 19/315 (6%)

Query: 1   MCILLGTTAHPRYSLILISNRDEFFERETHPTCVH--SDDFIVSPFDMSIT-TKGRNFGT 57
           MCIL  T +HP Y LILISNRDEF +R+T  +C +  S+  ++ P+D+S   T    FGT
Sbjct: 1   MCILFLTRSHPDYELILISNRDEFLQRKTAFSCWNERSNCEVLCPYDLSRNETDPSKFGT 60

Query: 58  WCGVNKDGKVAVILNLRIASCG-NPKNVECPQSRGIVPMKFLAG-KDVDFNNWDSYEKFS 115
           WCG+N+ G+V+ +LNL++       KNV   +SRG +P+KFL   K+  FN+W+SY KF 
Sbjct: 61  WCGINEFGRVSSVLNLKMDENKVEDKNVR-KKSRGYLPVKFLDNRKENSFNDWNSYSKFL 119

Query: 116 HHYPGIEKTGNFNLFYGDCSKGEYKLISSLSETT---DGF-QNDDGYMVVSN-DLISS-K 169
             YP +EKTG+FNLF GD  K EY LI S  +T    DG  +N    +V+SN + IS+ K
Sbjct: 120 KQYPDLEKTGSFNLFIGDVKKQEYALIDSFGQTKRILDGKDENGKSSVVISNSEFISNDK 179

Query: 170 KKWGKISLAKNLLRNLVESSVDDTKDSILDKCFKLASHSTCSEKIVVKHESVTN---ETI 226
           ++W KIS  + L+   +   + D ++S+++ CFK+AS S  + + +  H+ + +   ET+
Sbjct: 180 ERWHKISNGEKLMDEFLSKDIRD-ENSVIESCFKIASTSELTNEYLHSHDDILDLMTETV 238

Query: 227 YVPPLLVENGQDLD---VSMPCGKYYGTRSQIVILVSKDQKKMTFVERVLYTCDEDVLKY 283
           +VPP+ +EN  + D    S+P GK+YGTRSQIVILV+K++  + ++ERVLY CD+DV K 
Sbjct: 239 FVPPIKLENPVEKDNIGASLPVGKFYGTRSQIVILVNKERTTVRYMERVLYECDDDVSKA 298

Query: 284 GPKNPKEQIEFEFDI 298
           G + P  ++ FE++I
Sbjct: 299 GIEKPINELNFEYNI 313

>ZYRO0D10098g Chr4 complement(851071..851901) [831 bp, 276 aa] {ON}
           similar to uniprot|P53275 Saccharomyces cerevisiae
           YGR127W Hypothetical ORF
          Length = 276

 Score =  227 bits (579), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 117/269 (43%), Positives = 173/269 (64%), Gaps = 17/269 (6%)

Query: 43  PFDMSITTKGRNFGTWCGVNKDGKVAVILNLRI---ASCGNPKNVECPQSRGIVPMKFLA 99
           P   +   +   FGTWCG+NKDG+V  +LNL++   A  G+P ++    SRG VP  FL+
Sbjct: 11  PLRCTPEHRAHKFGTWCGINKDGRVGTVLNLKLDQGAQRGHPLHLS---SRGKVPTAFLS 67

Query: 100 GKDVDFNNWDSYEKFSHHYPGIEKTGNFNLFYGDCSKGEYKLISSLSETTDGF-----QN 154
             D+D+  W+SY KF++ +  ++ TG+FN FYGDC  G+YK+I SL +T D       Q+
Sbjct: 68  QHDLDWEQWNSYNKFANQFSELDNTGDFNFFYGDCKNGQYKIIDSLRQTHDVLTNNESQD 127

Query: 155 DDGYMVVSNDL--ISSKKKWGKISLAKNLLRNLVESSVDDTKDSILDKCFKLASHST--- 209
           D  YMVVSND+     ++ W K+ LAK  LR L+E +V++ +DS + KCF++AS S    
Sbjct: 128 DSSYMVVSNDVYRYQGEETWPKVQLAKKNLRKLIEDNVNEDQDSFISKCFQVASTSPGLD 187

Query: 210 CSEKIVVKHESVTNETIYVPPLLVENGQDLDVSMPCGKYYGTRSQIVILVSKDQKKMTFV 269
              + ++K   VT ++I+VPPL      +L  +   G +YGTRSQIV+LVSKD++K+TFV
Sbjct: 188 WQSEELLKSSDVTKQSIFVPPLKFPPDLNLGTTTHAG-FYGTRSQIVLLVSKDRQKVTFV 246

Query: 270 ERVLYTCDEDVLKYGPKNPKEQIEFEFDI 298
           ERVL+  DE V +  P +P EQ++F+FD+
Sbjct: 247 ERVLHNSDEQVSQRSPDHPAEQLKFQFDL 275

>AFR305W Chr6 (995054..995983) [930 bp, 309 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR127W
          Length = 309

 Score =  227 bits (579), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 128/311 (41%), Positives = 182/311 (58%), Gaps = 18/311 (5%)

Query: 1   MCILLGTTAHPRYSLILISNRDEFFERETHPTCVHSDDFIVSPFDMSIT-----TKGRNF 55
           MCIL  TTAHP+Y L+LISNRDE+F R+TH TC   +D I++P+DM++        G   
Sbjct: 1   MCILFATTAHPKYKLVLISNRDEYFARKTHTTCWSHNDSILAPYDMALQDADGLDHGSPC 60

Query: 56  GTWCGVNKDGKVAVILNLRIASCGNPKNVECPQSRGIVPMKFLAGKDVDFNNWDS---YE 112
           GTW G+N+ G V+V+LNL               SRG V M++L  KD D NNWDS   YE
Sbjct: 61  GTWIGINRAGHVSVLLNLAPKDADGDHGYSHRHSRGAVTMEYL--KDFDHNNWDSWNTYE 118

Query: 113 KFSHHYPGIEKTGNFNLFYGDCSKGEYKLISSLSETTDGFQNDDGYMVVSN---DLISSK 169
           KF  H+P + KT  F  FYGD    ++ +I+SL +T D F     Y VVSN   D   + 
Sbjct: 119 KFGAHFPTLYKTKLFTHFYGDVVNSQFSVINSLGQTLDPFSQSP-YYVVSNGPSDGAKAL 177

Query: 170 KKWGKISLAKNLLRNLVESSVDDTKDSILDKCFKLASHS--TCSEKIVVKHESVTNETIY 227
            +W K+     L + +++ S+D +++ +L +CF LAS+S    ++ I V  +S+   TI+
Sbjct: 178 GQWPKVVEGNQLFKKMIQESLDVSEEELLQRCFNLASYSQYVSNQPIGVHDDSIPKRTIF 237

Query: 228 VPPLLVENGQDLDVSMPCGKYYGTRSQIVILVSKDQKKMTFVERVLYTCDEDVLKYGPKN 287
           VP L   +GQ  ++S   G YYGTRS IV+LVS+D   +T  E V++  D+D+  Y   N
Sbjct: 238 VPALYNLSGQ-ANLSFAAGMYYGTRSTIVMLVSEDGNVVT-REHVIHDSDQDLDSYSILN 295

Query: 288 PKEQIEFEFDI 298
           PKEQ+   F +
Sbjct: 296 PKEQVTHRFSL 306

>Ecym_1242 Chr1 complement(495583..496518) [936 bp, 311 aa] {ON}
           similar to Ashbya gossypii AFR305W
          Length = 311

 Score =  218 bits (556), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 123/313 (39%), Positives = 183/313 (58%), Gaps = 18/313 (5%)

Query: 1   MCILLGTTAHPRYSLILISNRDEFFERETHPTCVHSDDFIVSPFDMSITTKGRN------ 54
           MCILL TT HP Y LILISNRDEF+ER TH TC H D  I++P+D+S +    +      
Sbjct: 1   MCILLATTDHPDYKLILISNRDEFYERRTHVTCWHQDGVILAPYDISNSENASDASKAEL 60

Query: 55  -FGTWCGVNKDGKVAVILNLRIASCGNPKNVECPQSRGIVPMKFLAGKDVDFNNWD---S 110
            +GTW G+N+ G V+V+LNL+  S          +SRG V + FL  +D+   NWD   +
Sbjct: 61  SYGTWLGINRVGHVSVLLNLKEVSEAVNPGAGNRKSRGNVTVAFL--RDLSNGNWDKWNN 118

Query: 111 YEKFSHHYPGIEKTGNFNLFYGDCSKGEYKLISSLSETTDGFQNDDGYMVVSNDLISSKK 170
           YEKFS H+  ++ T +F LFYGD   G++ LI S   + + F +   Y+V+SN  ++ + 
Sbjct: 119 YEKFSEHFAALDDTQSFTLFYGDIKTGDFGLIDSYKRSMNPFSSKQPYVVISNSRVNCED 178

Query: 171 ---KWGKISLAKNLLRNLVESSVDDTKDSILDKCFKLASHST--CSEKIVVKHESVTNET 225
              +W K+   + LL+ LV+ +++ +K+ +L KCF+LA  S    +  I V   S+  +T
Sbjct: 179 EGPRWKKVVEGEQLLKELVKGNLNVSKEHLLQKCFELAGTSQFDVNGVIQVTDTSLPEKT 238

Query: 226 IYVPPLLVENGQDLDVSMPCGKYYGTRSQIVILVSKDQKKMTFVERVLYTCDEDVLKYGP 285
           I+VP L       + VS   G+YYGTR+ IVILV  +   +T  E V++  D+D+     
Sbjct: 239 IFVPTLKAAGNSSMGVSKIVGEYYGTRTTIVILVD-NFNHVTMHEHVIHDSDKDIGLSSA 297

Query: 286 KNPKEQIEFEFDI 298
            NPK ++ +EFDI
Sbjct: 298 MNPKTKVAYEFDI 310

>TBLA0D02990 Chr4 complement(725170..726126) [957 bp, 318 aa] {ON}
           Anc_3.487 YGR127W
          Length = 318

 Score =  202 bits (515), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 131/315 (41%), Positives = 175/315 (55%), Gaps = 40/315 (12%)

Query: 1   MCILLGTTAHPRYSLILISNRDEFFERETHPTCVHSDDFIVSPFDMS--ITTKG------ 52
           MCILLGTTAHP Y LILISNRDE FERETH TC + +  I+ P+DMS  I   G      
Sbjct: 1   MCILLGTTAHPFYKLILISNRDEVFERETHSTCWNHNSTILYPYDMSKDICHDGGGDERF 60

Query: 53  -RNFGTWCGVNKDGKVAVILNL-------RIASCGNPKNVECPQSRGIVPMKFLAGKDVD 104
               GTWCG+NKDGK+  +LNL       R   C N       QSRG++P+K+L   D  
Sbjct: 61  KSEHGTWCGLNKDGKICTVLNLLKEEEARRDGDCNNS-----LQSRGLIPIKYLCDFDHG 115

Query: 105 FNNWDSYEKFSHHYPGIE-KTGNFNLFYGDCSKGEYKLISSLSETTDGFQNDDGYMVVSN 163
           F +W++Y+KF      I+ K G FNLF GD    EY +I+S+ ++      ++ YMVVSN
Sbjct: 116 FQDWNTYDKFIEQNGSIDGKVGLFNLFLGDLKSNEYSIINSMGQSQRVLDEENPYMVVSN 175

Query: 164 DLISSKKKWGKISLAKN---LLRNLVESSVDDT-KD--SILDKCFKLASHSTCSEKIV-- 215
                 KK G+ S  KN   LL  L+   +D++ KD   IL+ CF+++S    S K +  
Sbjct: 176 INWGDPKKMGEWSKIKNGIKLLETLINDKLDNSNKDELEILEDCFQISSTINLSGKKIDG 235

Query: 216 -VKHESVTNETIYVPPLLVENGQ---------DLDVSMPCGKYYGTRSQIVILVSKDQKK 265
            ++    T + I+VPPL    G+           D      KYYGTRSQIV+L  +   K
Sbjct: 236 NIERLEQTKDLIFVPPLKRSEGEVRGDAGGDAGGDAGGESVKYYGTRSQIVVLCERKSNK 295

Query: 266 MTFVERVLYTCDEDV 280
           +TFVER+L+  +ED 
Sbjct: 296 VTFVERILHCKNEDA 310

>Kpol_183.2 s183 complement(2403..5474) [3072 bp, 1023 aa] {ON}
           complement(2403..5474) [3072 nt, 1024 aa]
          Length = 1023

 Score = 30.8 bits (68), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 31/117 (26%), Positives = 51/117 (43%), Gaps = 13/117 (11%)

Query: 108 WDSYEKFSHHYPGIEKTGNFNLFYGDCSKGE-YKLISSLSETTDGFQNDDGYM---VVSN 163
           ++S  K   + P + +T N  + YG  S+ E Y  +  +   +D FQ    Y+   VVSN
Sbjct: 491 FESLNKMLTNVPDLLRTIN-RIAYGTTSRKEIYYFLKQMKSFSDHFQLHSNYLNSQVVSN 549

Query: 164 DLISSKKKWGKISLAKNLLRNLVESSVDDTKDSILDKCFKLASHSTCSEKIVVKHES 220
           D        G+I  +  LL NL+       K+  ++    + + S+  EK   K  S
Sbjct: 550 D--------GRIHKSSALLTNLLTEITSGLKEINIENILSMINVSSVMEKDTYKQVS 598

>Kwal_26.9080 s26 (1067363..1071649) [4287 bp, 1428 aa] {ON} YMR219W
           (ESC1) - involved in silencing [contig 69] FULL
          Length = 1428

 Score = 30.0 bits (66), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 29/69 (42%), Gaps = 6/69 (8%)

Query: 126 NFNLFYGDCSKGEYKLISSLSETTDGFQNDDGYMVVSNDL----ISSKKKWGKISLAKNL 181
           N  L  G     ++      SET+ GF+  DG+ +  ND     IS  K+W     A  L
Sbjct: 343 NSTLEAGGVKSSDHNTADYASETSSGFKQSDGFQIGPNDHHLEDISGAKEWSNKGTA--L 400

Query: 182 LRNLVESSV 190
           L N   + V
Sbjct: 401 LPNTASTDV 409

>KAFR0H02980 Chr8 (569164..571278) [2115 bp, 704 aa] {ON} 
          Length = 704

 Score = 30.0 bits (66), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 36/80 (45%), Gaps = 9/80 (11%)

Query: 80  NPKNVECPQSRGIVPMK--FLAGKDVDFNNWDSYEKFSHHYPGIEKTGNFNLFYGDCSKG 137
           NPK  E          K  FL G   +FNNW   EK++H   G ++ GNF++       G
Sbjct: 67  NPKTNEITYKEWAPNAKNAFLVG---EFNNW---EKYTHQLEGKDEFGNFSITIPPTKTG 120

Query: 138 EYKLISSLSETTDGFQNDDG 157
           E   I   S+    FQ +DG
Sbjct: 121 E-AAIPHDSKIKVMFQLEDG 139

>ZYRO0E07546g Chr5 (585395..589354) [3960 bp, 1319 aa] {ON} weakly
           similar to uniprot|Q03214 Saccharomyces cerevisiae
           YMR176W ECM5 Non-essential protein of unknown function
           contains ATP/GTP-binding site motif A null mutant
           exhibits cellular volume up to four times greater than
           wild-type also large drooping buds with elongated necks
          Length = 1319

 Score = 30.0 bits (66), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 28/52 (53%), Gaps = 1/52 (1%)

Query: 198 LDKCFKLASHSTCSEKIVVKHESVTNETIYVPPLLVENGQDLD-VSMPCGKY 248
           LD+  K+  H+   ++  +  E +TNE +  P +L  NG  L+ ++  CG Y
Sbjct: 491 LDQDGKINVHNIFDKEPPLNEERLTNELVITPDVLTRNGITLNKITQECGTY 542

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.136    0.412 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 34,505,458
Number of extensions: 1554637
Number of successful extensions: 4410
Number of sequences better than 10.0: 47
Number of HSP's gapped: 4441
Number of HSP's successfully gapped: 47
Length of query: 298
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 189
Effective length of database: 40,982,805
Effective search space: 7745750145
Effective search space used: 7745750145
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 65 (29.6 bits)