Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0F02860g3.488ON30530516350.0
Kwal_55.212193.488ON3022917353e-96
KLTH0F14740g3.488ON3023047084e-92
TDEL0D055603.488ON3113126365e-81
Skud_16.4423.488ON3043066312e-80
Ecym_12413.488ON3053076312e-80
TBLA0C044503.488ON3093096225e-79
Suva_16.4763.488ON3043066182e-78
Smik_16.4003.488ON3043066163e-78
Kpol_480.173.488ON3133006156e-78
TPHA0D042203.488ON3162786122e-77
AFR306C3.488ON3192796122e-77
NCAS0F035303.488ON3133156095e-77
YPR147C3.488ON3043066086e-77
ZYRO0D10076g3.488ON3052766015e-76
CAGL0L08514g3.488ON3123115862e-73
NDAI0B058303.488ON3293325375e-66
Skud_2.3318.524ON376134870.019
TBLA0J003307.497ON390107850.040
Suva_4.4598.524ON375142800.13
TBLA0H035408.524ON378136800.16
NDAI0C054308.524ON362136780.27
TDEL0B067602.583ON54966740.95
NDAI0J011508.303ON151764731.5
KLLA0E13135g5.691ON62573712.2
NCAS0B022608.524ON363124702.3
YBR204C (LDH1)8.524ON375137702.6
Smik_2.3458.524ON375158693.0
TDEL0A034305.479ON31669675.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0F02860g
         (305 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0F02860g Chr6 (242683..243600) [918 bp, 305 aa] {ON} similar...   634   0.0  
Kwal_55.21219 s55 complement(734903..735811) [909 bp, 302 aa] {O...   287   3e-96
KLTH0F14740g Chr6 complement(1208120..1209028) [909 bp, 302 aa] ...   277   4e-92
TDEL0D05560 Chr4 complement(1004217..1005152) [936 bp, 311 aa] {...   249   5e-81
Skud_16.442 Chr16 complement(779364..780278) [915 bp, 304 aa] {O...   247   2e-80
Ecym_1241 Chr1 (494505..495422) [918 bp, 305 aa] {ON} similar to...   247   2e-80
TBLA0C04450 Chr3 complement(1079139..1080068) [930 bp, 309 aa] {...   244   5e-79
Suva_16.476 Chr16 complement(822104..823018) [915 bp, 304 aa] {O...   242   2e-78
Smik_16.400 Chr16 complement(697593..698507) [915 bp, 304 aa] {O...   241   3e-78
Kpol_480.17 s480 (35641..36582) [942 bp, 313 aa] {ON} (35641..36...   241   6e-78
TPHA0D04220 Chr4 complement(912211..913161) [951 bp, 316 aa] {ON...   240   2e-77
AFR306C Chr6 complement(996001..996960) [960 bp, 319 aa] {ON} Sy...   240   2e-77
NCAS0F03530 Chr6 complement(706175..707116) [942 bp, 313 aa] {ON...   239   5e-77
YPR147C Chr16 complement(825645..826559) [915 bp, 304 aa] {ON} P...   238   6e-77
ZYRO0D10076g Chr4 (850134..851051) [918 bp, 305 aa] {ON} similar...   236   5e-76
CAGL0L08514g Chr12 (932629..933567) [939 bp, 312 aa] {ON} simila...   230   2e-73
NDAI0B05830 Chr2 complement(1415309..1416298) [990 bp, 329 aa] {...   211   5e-66
Skud_2.331 Chr2 complement(599967..601097) [1131 bp, 376 aa] {ON...    38   0.019
TBLA0J00330 Chr10 (59970..61142) [1173 bp, 390 aa] {ON} Anc_7.49...    37   0.040
Suva_4.459 Chr4 complement(802339..803466) [1128 bp, 375 aa] {ON...    35   0.13 
TBLA0H03540 Chr8 (863267..864403) [1137 bp, 378 aa] {ON} Anc_8.5...    35   0.16 
NDAI0C05430 Chr3 (1259106..1260194) [1089 bp, 362 aa] {ON} Anc_8...    35   0.27 
TDEL0B06760 Chr2 complement(1197971..1199620) [1650 bp, 549 aa] ...    33   0.95 
NDAI0J01150 Chr10 complement(262920..267473) [4554 bp, 1517 aa] ...    33   1.5  
KLLA0E13135g Chr5 complement(1162722..1164599) [1878 bp, 625 aa]...    32   2.2  
NCAS0B02260 Chr2 complement(374788..375879) [1092 bp, 363 aa] {O...    32   2.3  
YBR204C Chr2 complement(632254..633381) [1128 bp, 375 aa] {ON}  ...    32   2.6  
Smik_2.345 Chr2 complement(618817..619944) [1128 bp, 375 aa] {ON...    31   3.0  
TDEL0A03430 Chr1 complement(613050..614000) [951 bp, 316 aa] {ON...    30   5.0  

>SAKL0F02860g Chr6 (242683..243600) [918 bp, 305 aa] {ON} similar to
           uniprot|Q06522 Saccharomyces cerevisiae YPR147C
           Hypothetical ORF
          Length = 305

 Score =  634 bits (1635), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/305 (100%), Positives = 305/305 (100%)

Query: 1   MHIQPYSKNGFFSSLYHLKPLNQEVNSQTPLFVFIPGNPGLIEFYKSFLDQIQKKHGNWE 60
           MHIQPYSKNGFFSSLYHLKPLNQEVNSQTPLFVFIPGNPGLIEFYKSFLDQIQKKHGNWE
Sbjct: 1   MHIQPYSKNGFFSSLYHLKPLNQEVNSQTPLFVFIPGNPGLIEFYKSFLDQIQKKHGNWE 60

Query: 61  ILGISHAGMITKCKGLKKPTKVYSLKDQVQHKIYVINDFCSSNRPLIIAGHSIGAYIVQK 120
           ILGISHAGMITKCKGLKKPTKVYSLKDQVQHKIYVINDFCSSNRPLIIAGHSIGAYIVQK
Sbjct: 61  ILGISHAGMITKCKGLKKPTKVYSLKDQVQHKIYVINDFCSSNRPLIIAGHSIGAYIVQK 120

Query: 121 IALDVSLMGTVKKIMLLTPTVIDIHLSEKGRKLNWINEWCPNFHSYVATASWLVFEKMLP 180
           IALDVSLMGTVKKIMLLTPTVIDIHLSEKGRKLNWINEWCPNFHSYVATASWLVFEKMLP
Sbjct: 121 IALDVSLMGTVKKIMLLTPTVIDIHLSEKGRKLNWINEWCPNFHSYVATASWLVFEKMLP 180

Query: 181 QTITEKILSLFVGSEQTCVREAAKLLVTNYEFVQQSLGLAREEMQKVRDDWNFQLSFLQF 240
           QTITEKILSLFVGSEQTCVREAAKLLVTNYEFVQQSLGLAREEMQKVRDDWNFQLSFLQF
Sbjct: 181 QTITEKILSLFVGSEQTCVREAAKLLVTNYEFVQQSLGLAREEMQKVRDDWNFQLSFLQF 240

Query: 241 CKSQEVELQFLFAFKDHWVNSQTRFDLAEFYNSNYYKDFLTIDEDEKISHSFVLNDTKSV 300
           CKSQEVELQFLFAFKDHWVNSQTRFDLAEFYNSNYYKDFLTIDEDEKISHSFVLNDTKSV
Sbjct: 241 CKSQEVELQFLFAFKDHWVNSQTRFDLAEFYNSNYYKDFLTIDEDEKISHSFVLNDTKSV 300

Query: 301 VDRYI 305
           VDRYI
Sbjct: 301 VDRYI 305

>Kwal_55.21219 s55 complement(734903..735811) [909 bp, 302 aa] {ON}
           YPR147C - Hypothetical ORF [contig 131] FULL
          Length = 302

 Score =  287 bits (735), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 142/291 (48%), Positives = 187/291 (64%), Gaps = 3/291 (1%)

Query: 14  SLYHLKPLNQEVNSQTPLFVFIPGNPGLIEFYKSFLDQIQKKHGNWEILGISHAGMITKC 73
           SLYH          + PLFVFIPGNPGLIEFY+ FL QI +K+  WEILGISHAGM   C
Sbjct: 14  SLYHRNAGLNSSGGEAPLFVFIPGNPGLIEFYEPFLAQIHEKNPAWEILGISHAGM-NSC 72

Query: 74  KGLKKPTKVYSLKDQVQHKIYVINDFCSSNRPLIIAGHSIGAYIVQKIALDVSLMGTVKK 133
                P  VYSL+ Q+ HKI +IN +C   +P+II GHS+GA++VQKI     L   V +
Sbjct: 73  SEEVSP--VYSLEQQIDHKIEIINRYCLDGKPIIIMGHSVGAFMVQKITTSRRLKSKVIR 130

Query: 134 IMLLTPTVIDIHLSEKGRKLNWINEWCPNFHSYVATASWLVFEKMLPQTITEKILSLFVG 193
           + LLTPTVIDIH SEKG KL  I  WCP+FH+ V+T +W +FEK+LP  IT+ I+SL V 
Sbjct: 131 VGLLTPTVIDIHKSEKGVKLTSITRWCPSFHNVVSTLNWALFEKLLPTKITKSIISLLVD 190

Query: 194 SEQTCVREAAKLLVTNYEFVQQSLGLAREEMQKVRDDWNFQLSFLQFCKSQEVELQFLFA 253
             Q+C+    +LLVTN  FV+Q+LGLA EE++ +R DW +Q  FL  C+  + ++ +LF+
Sbjct: 191 DPQSCLGATTELLVTNSRFVKQALGLAAEEVRVIRSDWAYQKEFLLLCQENDTKIWWLFS 250

Query: 254 FKDHWVNSQTRFDLAEFYNSNYYKDFLTIDEDEKISHSFVLNDTKSVVDRY 304
            KDHWV+  TR D+ +FY  +       ID    I H+FV      V+ +Y
Sbjct: 251 EKDHWVSPTTRNDIIDFYRQHSSPALSQIDVSSTIEHAFVRRHADLVIKQY 301

>KLTH0F14740g Chr6 complement(1208120..1209028) [909 bp, 302 aa]
           {ON} similar to uniprot|Q06522 Saccharomyces cerevisiae
           YPR147C Hypothetical ORF
          Length = 302

 Score =  277 bits (708), Expect = 4e-92,   Method: Compositional matrix adjust.
 Identities = 139/304 (45%), Positives = 191/304 (62%), Gaps = 3/304 (0%)

Query: 1   MHIQPYSKNGFFSSLYHLKPLNQEVNSQTPLFVFIPGNPGLIEFYKSFLDQIQKKHGNWE 60
           M I+     G  SS+ HLK     + S   LFVFIPGNPGLIE+Y  FL Q+ +K+ +WE
Sbjct: 1   MKIEASFVGGEPSSILHLKSGVSSLGSDACLFVFIPGNPGLIEYYVPFLQQVHEKNPDWE 60

Query: 61  ILGISHAGMITKCKGLKKPTKVYSLKDQVQHKIYVINDFCSSNRPLIIAGHSIGAYIVQK 120
           ILGISHAGM   C  +  P  VY+L++Q+ HK+ VIN +   N+ + I GHS+GA+I QK
Sbjct: 61  ILGISHAGM-NSCNDIACP--VYTLQEQINHKVDVINSYAQGNKKITIMGHSVGAFIAQK 117

Query: 121 IALDVSLMGTVKKIMLLTPTVIDIHLSEKGRKLNWINEWCPNFHSYVATASWLVFEKMLP 180
           +     L   V ++ LLTPTVIDIH SEKG KL  I E  P FH  V+   W+ FEK+ P
Sbjct: 118 VVTSGLLNDEVARVGLLTPTVIDIHKSEKGLKLTAITERFPRFHQLVSALDWIAFEKLFP 177

Query: 181 QTITEKILSLFVGSEQTCVREAAKLLVTNYEFVQQSLGLAREEMQKVRDDWNFQLSFLQF 240
             +T  I+S F    +TC+  A +LL+TN  FV+Q+LGLA EEMQ +R DW +Q  FL +
Sbjct: 178 DFLTSWIISHFADDPKTCLGAATRLLLTNSRFVKQALGLATEEMQVIRSDWEYQKDFLHY 237

Query: 241 CKSQEVELQFLFAFKDHWVNSQTRFDLAEFYNSNYYKDFLTIDEDEKISHSFVLNDTKSV 300
           C+++  ++ +LF+  DHWV+S+TR DL +FY  +   + ++ID    I H+FV    + V
Sbjct: 238 CETKGAKIWWLFSDNDHWVSSETRKDLIQFYERHSSPELVSIDVSTAIEHAFVRRHAQVV 297

Query: 301 VDRY 304
           V  Y
Sbjct: 298 VQHY 301

>TDEL0D05560 Chr4 complement(1004217..1005152) [936 bp, 311 aa] {ON}
           Anc_3.488 YPR147C
          Length = 311

 Score =  249 bits (636), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 136/312 (43%), Positives = 187/312 (59%), Gaps = 13/312 (4%)

Query: 1   MHIQPYSKNGFFSSLYHLKPLNQEVNSQTPLFVFIPGNPGLIEFYKSFLDQIQKKHGNWE 60
           M  + Y K  + +S+ H K ++    S+ PLFV+IPGNPGLIE+Y+ FL  I ++H  WE
Sbjct: 1   MAAREYIKCAYPTSIVHFKSISIRGKSECPLFVWIPGNPGLIEYYEEFLMLIHRQHPEWE 60

Query: 61  ILGISHAGMITKCKGLKKPTK---VYSLKDQVQHKIYVINDFCSSNRPLIIAGHSIGAYI 117
           +LGISHAGM T      + ++   VYSLK Q+ HK+ +I DF S+NRPLII GHS+GAY+
Sbjct: 61  VLGISHAGMSTASVSKSEKSERNDVYSLKQQIDHKLEIIKDFSSTNRPLIIMGHSVGAYM 120

Query: 118 VQKIALDVSLMGTVKKIMLLTPTVIDIHLSEKGRKLNWINEWCPNFHSYVATASWLVFEK 177
           VQ I L   L+G V K+ LLTPT++DIH S+KG  L  +  W  +        S L+F  
Sbjct: 121 VQHIVLSDKLVGKVAKMGLLTPTILDIHTSKKGVVLTKVLYWLKDLPQLAGWFSSLLFGF 180

Query: 178 MLPQTITEKILSLFVGSEQTCVREAAKLLVT-----NYEFVQQSLGLAREEMQKVRDDWN 232
            LP  I   +LS F+G    C R ++ +L T     N EFV+Q+LGL+  EM+++R DW 
Sbjct: 181 FLPSFILRILLSFFMG----CHRNSSGVLTTTVLLENGEFVKQALGLSVYEMEEIRSDWA 236

Query: 233 FQLSFLQFCKSQEVELQFLFAFKDHWVNSQTRFDLAEFYNSNYYKDFLTIDEDEKISHSF 292
           FQ   +  C  + +    LF+  DHWV   TR DL +FY  +Y  D + I    KI HSF
Sbjct: 237 FQRRLIVHCNERGISTWLLFSDSDHWVADTTREDLIKFYRDHYRADKIKI-HTCKIPHSF 295

Query: 293 VLNDTKSVVDRY 304
           VLN +K ++  Y
Sbjct: 296 VLNHSKYLISEY 307

>Skud_16.442 Chr16 complement(779364..780278) [915 bp, 304 aa] {ON}
           YPR147C (REAL)
          Length = 304

 Score =  247 bits (631), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 122/306 (39%), Positives = 192/306 (62%), Gaps = 5/306 (1%)

Query: 1   MHIQPYSKNGFFSSLYHLKPLNQEVNSQTPLFVFIPGNPGLIEFYKSFLDQIQKKHGNWE 60
           M +Q Y+K+    S+ ++KP     N   PL V+IPGNPGL+ +Y+  L  +  KH +WE
Sbjct: 1   MPVQEYTKSTLPCSILNIKPSVATENEDAPLLVWIPGNPGLLYYYQEMLQHLHSKHPDWE 60

Query: 61  ILGISHAGMITKCKGLKKPTKVYSLKDQVQHKIYVINDFCSSNRPLIIAGHSIGAYIVQK 120
           ILG+SHAGM          T ++SL+DQV H++ VIN+F   NR +II GHS+GAYI+QK
Sbjct: 61  ILGVSHAGMTLNAHS---NTPIFSLQDQVDHQVEVINNFSHENRKIIIMGHSVGAYILQK 117

Query: 121 IALDVSLMGTVKKIMLLTPTVIDIHLSEKGRKLNWINEWCPNFHSYVATASWLVFEKMLP 180
           + L   L+G+V+KI L+TPTV+DIH SE G K+  +  + P     V+  S++ F  +L 
Sbjct: 118 VCLSDKLVGSVRKIGLITPTVMDIHTSEMGVKMTAVLHYIPPLAHVVSLLSYVFFYWILS 177

Query: 181 QTITEKILSLFVGSEQTCVRE--AAKLLVTNYEFVQQSLGLAREEMQKVRDDWNFQLSFL 238
           + ++  ++  F+G   T  +   + ++L+T+ +FV+QSLGLA +EM+++  +W FQ  F+
Sbjct: 178 EGLSRFVIDKFMGCGSTGYQAVLSTRILLTHKQFVRQSLGLASQEMKEITTNWEFQDEFI 237

Query: 239 QFCKSQEVELQFLFAFKDHWVNSQTRFDLAEFYNSNYYKDFLTIDEDEKISHSFVLNDTK 298
            +C+  E+ + FLF+ KDHWV  +TR  L+ +Y     ++ L ID  +KI HSFV+   +
Sbjct: 238 NYCQENEIFIWFLFSTKDHWVADKTRTHLSHYYKDKIKQERLKIDVTDKIPHSFVVKHAE 297

Query: 299 SVVDRY 304
             V+ +
Sbjct: 298 YAVNTF 303

>Ecym_1241 Chr1 (494505..495422) [918 bp, 305 aa] {ON} similar to
           Ashbya gossypii AFR306C
          Length = 305

 Score =  247 bits (631), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 125/307 (40%), Positives = 192/307 (62%), Gaps = 8/307 (2%)

Query: 3   IQPYSKNGFFSSLYHLKPLNQEVNSQTPLFVFIPGNPGLIEFYKSFLDQIQKKHGNWEIL 62
           ++ Y +   F+ + H+     +     PL +FIPGNPGLI FY+ FL  I +++  WE++
Sbjct: 1   METYLREDIFADILHIY---SQSTPPGPLLLFIPGNPGLINFYEEFLKCIHERNPTWEVV 57

Query: 63  GISHAGMITKCKGLKKPTKVYSLKDQVQHKIYVINDFCSS--NRPLIIAGHSIGAYIVQK 120
           GI H GM +  +      +V++L +Q++ K+ VIN+F  +  +R + + GHSIGAY+VQK
Sbjct: 58  GIGHTGMSSLRENNSLSGRVHTLDEQIEDKVKVINEFVDAGGDRCIKLIGHSIGAYMVQK 117

Query: 121 IALDVSLMGTVKKIMLLTPTVIDIHLSEKGRKLNWINEWCPNFHSYVATASWLVFEKMLP 180
           IAL   L G +  +MLLTPT+IDIH S KG +L  I++W P F+ Y      ++F+ +LP
Sbjct: 118 IALHKGLRGKIDMVMLLTPTIIDIHRSSKGVQLTRISDWFPKFYEYAYVVDRVLFKWILP 177

Query: 181 QTITEKILSLFVGSEQTCVREAAKLLVTNYEFVQQSLGLAREEMQKVRDDWNFQLSFLQF 240
            +  E I    +G    CV ++A+ LV+  EFV+Q+LGLA+ EM +VR+ W+FQ  F+ F
Sbjct: 178 TSWIEWIARKLIGGSDECVLQSAQKLVSTPEFVKQALGLAQIEMYQVRNQWDFQDEFISF 237

Query: 241 CKSQEVELQFLFAFKDHWVNSQTRFDLAEFYNSNYY---KDFLTIDEDEKISHSFVLNDT 297
           C++ +++++FLF+  DHWV+  T  D+ E Y + Y    KD L I  D  I+HSFV+ DT
Sbjct: 238 CQANKIKVRFLFSGHDHWVHPDTMKDIIELYEAKYSSDEKDLLNITIDGHINHSFVVKDT 297

Query: 298 KSVVDRY 304
             VV+ Y
Sbjct: 298 TKVVNIY 304

>TBLA0C04450 Chr3 complement(1079139..1080068) [930 bp, 309 aa] {ON}
           Anc_3.488 YPR147C
          Length = 309

 Score =  244 bits (622), Expect = 5e-79,   Method: Compositional matrix adjust.
 Identities = 126/309 (40%), Positives = 184/309 (59%), Gaps = 6/309 (1%)

Query: 1   MHIQPYSKNGFFSSLYHLKPL-NQEVNSQTPLFVFIPGNPGLIEFYKSFLDQIQKKHGNW 59
           M IQ Y  + + +S+ H  P  + ++   TPLF++IPGNPGL+E+Y   L  +  K+  W
Sbjct: 1   MTIQIYPDSRYPTSIVHFPPAKDYKITEDTPLFIWIPGNPGLLEYYTKMLRSLHDKYPTW 60

Query: 60  EILGISHAGMITKCKGLKK--PTKVYSLKDQVQHKIYVINDFCSSNRPLIIAGHSIGAYI 117
           EILG+SHAGM +    +K    TKVY+L +QV HK+ VIN+F S  R +II GHS+GAY+
Sbjct: 61  EILGVSHAGM-SNGNQIKNVLSTKVYTLDEQVSHKVEVINNFSSPKRNIIIMGHSVGAYM 119

Query: 118 VQKIALDVSLMGTVKKIMLLTPTVIDIHLSEKGRKLNWINEWCPNFHSYVATASWLVFEK 177
            Q++ +D +L+G V K+ L+TPTV+DIH S KG K+            ++   S L F K
Sbjct: 120 AQRVIMDSNLIGNVIKLGLVTPTVVDIHRSVKGIKMTRAFNLFRELPIFLGLLSTLAFSK 179

Query: 178 MLPQTITEKILSLFVG--SEQTCVREAAKLLVTNYEFVQQSLGLAREEMQKVRDDWNFQL 235
           + P   T  +L++ +G  +      +A+ + +TN  FV+Q LGLA  EM+ +RDDWNFQ 
Sbjct: 180 LFPAIFTRWLLTIIMGCKNNDNHAADASTVFLTNGSFVKQCLGLASHEMKHIRDDWNFQK 239

Query: 236 SFLQFCKSQEVELQFLFAFKDHWVNSQTRFDLAEFYNSNYYKDFLTIDEDEKISHSFVLN 295
             + +C  + V   FLF+  DHWV+  TR +L  FY +N   D L +     I HSFV+N
Sbjct: 240 RLIDYCNKENVSTWFLFSSTDHWVSDDTRNELINFYRTNCKSDILDVSVSNIIPHSFVIN 299

Query: 296 DTKSVVDRY 304
            +   V+ Y
Sbjct: 300 FSDFTVNSY 308

>Suva_16.476 Chr16 complement(822104..823018) [915 bp, 304 aa] {ON}
           YPR147C (REAL)
          Length = 304

 Score =  242 bits (618), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 120/306 (39%), Positives = 191/306 (62%), Gaps = 5/306 (1%)

Query: 1   MHIQPYSKNGFFSSLYHLKPLNQEVNSQTPLFVFIPGNPGLIEFYKSFLDQIQKKHGNWE 60
           M IQ Y+K+    S+ ++KP     N   PL V+IPGNPGL+ +Y+  +  +  KH +WE
Sbjct: 1   MSIQEYTKSKLPCSILNIKPTVTTDNEDAPLLVWIPGNPGLLHYYQEMIHHLHLKHPDWE 60

Query: 61  ILGISHAGMITKCKGLKKPTKVYSLKDQVQHKIYVINDFCSSNRPLIIAGHSIGAYIVQK 120
           ILGISHAGM +  +     T ++SL+DQV H++ VIN+F   NR +II GHS+GAYIVQK
Sbjct: 61  ILGISHAGMSSNARS---NTPIFSLQDQVDHQVKVINNFSHDNRKIIIMGHSVGAYIVQK 117

Query: 121 IALDVSLMGTVKKIMLLTPTVIDIHLSEKGRKLNWINEWCPNFHSYVATASWLVFEKMLP 180
           + L   L+G+V K+ L+TPTV+DIH SE G K+     + P     ++  S++ F  +L 
Sbjct: 118 VCLSNELVGSVTKVGLITPTVMDIHASEMGVKMTTAFHYVPALAHVLSFISYVFFYWVLS 177

Query: 181 QTITEKILSLFVGSEQTCVRE--AAKLLVTNYEFVQQSLGLAREEMQKVRDDWNFQLSFL 238
           + +++ I+  F+G      R   + +L +T+ +FV+QSLGLA +E++++  +W FQ  F+
Sbjct: 178 EGLSKLIIDKFMGCGTAGRRAVLSTRLFLTHRQFVRQSLGLASQELKEITTNWEFQDKFI 237

Query: 239 QFCKSQEVELQFLFAFKDHWVNSQTRFDLAEFYNSNYYKDFLTIDEDEKISHSFVLNDTK 298
             C+ + +   FLF+ KDHWVN +TR  L+ +Y+    ++ L ID  +K+ HSFV+   +
Sbjct: 238 NHCEEKGIFTWFLFSTKDHWVNDETRKHLSHYYHDKVKQEHLRIDVTDKMPHSFVVKHAE 297

Query: 299 SVVDRY 304
             ++ +
Sbjct: 298 YAINAF 303

>Smik_16.400 Chr16 complement(697593..698507) [915 bp, 304 aa] {ON}
           YPR147C (REAL)
          Length = 304

 Score =  241 bits (616), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 124/306 (40%), Positives = 188/306 (61%), Gaps = 5/306 (1%)

Query: 1   MHIQPYSKNGFFSSLYHLKPLNQEVNSQTPLFVFIPGNPGLIEFYKSFLDQIQKKHGNWE 60
           M IQ Y+K+ F  S+ ++KP     +    L V+IPGNPGL+ +Y+  L  +  KH +WE
Sbjct: 1   MPIQEYTKSKFPCSILNIKPTITRSDEDAALLVWIPGNPGLLYYYQEMLQYLHSKHPDWE 60

Query: 61  ILGISHAGMITKCKGLKKPTKVYSLKDQVQHKIYVINDFCSSNRPLIIAGHSIGAYIVQK 120
           ILGISHAGM          T VYSL+DQV H++ VIN+F   NR +II GHS+GAYI+QK
Sbjct: 61  ILGISHAGMTLNAHS---NTPVYSLQDQVDHQVEVINNFSHENRKIIIMGHSVGAYILQK 117

Query: 121 IALDVSLMGTVKKIMLLTPTVIDIHLSEKGRKLNWINEWCPNFHSYVATASWLVFEKMLP 180
           + L  +L+GTV+K+ L+TPTV+DIH SE G KL     + P     V+  S++ F  +L 
Sbjct: 118 VCLSHNLVGTVQKVGLVTPTVMDIHTSEMGVKLTTALHYIPPLAHVVSLFSYIFFYWILS 177

Query: 181 QTITEKILSLFVGSEQTCVRE--AAKLLVTNYEFVQQSLGLAREEMQKVRDDWNFQLSFL 238
           +  +  I+  F+G   T  +   + ++ +T+ +FV+QSLGLA +EM+++  +W FQ  F+
Sbjct: 178 EGFSRFIIDKFMGCGSTSCQAVLSTRIFLTHKQFVRQSLGLASQEMEEITTNWEFQDKFI 237

Query: 239 QFCKSQEVELQFLFAFKDHWVNSQTRFDLAEFYNSNYYKDFLTIDEDEKISHSFVLNDTK 298
            +C+     + FLF+  DHWV+ +TR  L+ +Y     ++ L ID  +KI HSFV+   K
Sbjct: 238 NYCEQNGTLIWFLFSSNDHWVSGKTRSHLSHYYKDKVDQNRLEIDVTDKIPHSFVVKHAK 297

Query: 299 SVVDRY 304
             ++ +
Sbjct: 298 YAINTF 303

>Kpol_480.17 s480 (35641..36582) [942 bp, 313 aa] {ON}
           (35641..36582) [942 nt, 314 aa]
          Length = 313

 Score =  241 bits (615), Expect = 6e-78,   Method: Compositional matrix adjust.
 Identities = 127/300 (42%), Positives = 184/300 (61%), Gaps = 9/300 (3%)

Query: 13  SSLYHLKPLNQEVNSQ-TPLFVFIPGNPGLIEFYKSFLDQIQKKHGNWEILGISHAGMIT 71
           +S+ HL PL +E++ + +PLFV+IPGNPGL+E+Y  FL  + KK+  WE+LGISHAGM  
Sbjct: 14  TSIVHLDPLTKELSPEDSPLFVWIPGNPGLLEYYVDFLALVHKKNPTWEVLGISHAGMSY 73

Query: 72  KCKGLKKPT------KVYSLKDQVQHKIYVINDFCSSNRPLIIAGHSIGAYIVQKIALDV 125
                KK T      KV+ L++QVQHK+ +IN F S NRPLII GHS+GAY+ Q++ +  
Sbjct: 74  DGNEKKKKTSSNDKFKVFDLEEQVQHKVDIINKFSSKNRPLIIMGHSVGAYLTQRVIMTN 133

Query: 126 SLMGTVKKIMLLTPTVIDIHLSEKGRKLNWINEWCPNFHSYVATASWLVFEKMLPQTITE 185
            L G + K+  LTPTV+DIHLS+KG K+  +  W  N   +V   S  +F K+LP    +
Sbjct: 134 KLNGKLIKVGYLTPTVVDIHLSDKGIKMTKVFNWTSNLPHHVGWISQFIFHKLLPLFFVK 193

Query: 186 KILSLFVG-SEQTCVREAAKLLVTNYEFVQQSLGLAREEMQKVRDDWNFQLSFLQFCKSQ 244
             +S  +  SE +    A+  L+ N   ++Q+LGLA  EM+ + DDW F    + +C   
Sbjct: 194 FFISKMIKCSEDSNAVLASGTLLRNANLIEQALGLATYEMEAIHDDWGFHKKLIDYCNET 253

Query: 245 EVELQFLFAFKDHWVNSQTRFDLAEFYNSNYYKDFLTIDEDEKISHSFVLNDTKSVVDRY 304
            V+  FLFA  DHWV   TR ++ +FY  +   + + ID D  I H+FV+  +K +VD+Y
Sbjct: 254 GVKTWFLFAEDDHWVAHSTRKEVIDFYQYHNKPENIRIDIDT-IPHAFVIKKSKYIVDQY 312

>TPHA0D04220 Chr4 complement(912211..913161) [951 bp, 316 aa] {ON}
           Anc_3.488 YPR147C
          Length = 316

 Score =  240 bits (612), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 121/278 (43%), Positives = 175/278 (62%), Gaps = 2/278 (0%)

Query: 29  TPLFVFIPGNPGLIEFYKSFLDQIQKKHGNWEILGISHAGMITKCKGLKK-PTKVYSLKD 87
           +PLFV+IPGNPGL+E+Y+ FL  +  K+  W+ILGISHAGM +    LK+    VY+L +
Sbjct: 38  SPLFVWIPGNPGLLEYYEEFLKLLHVKNPEWDILGISHAGMSSGNSNLKENECSVYTLDE 97

Query: 88  QVQHKIYVINDFCSSNRPLIIAGHSIGAYIVQKIALDVSLMGTVKKIMLLTPTVIDIHLS 147
           Q+ HKI +IN F +  R LI+ GHS+GA++ QK+ +   L G VKKI LL PTVIDIHLS
Sbjct: 98  QIHHKIEIINKFAAYGRELIVMGHSVGAFMAQKVVMSNKLEGKVKKIGLLMPTVIDIHLS 157

Query: 148 EKGRKLNWINEWCPNFHSYVATASWLVFEKMLPQTITEKILSLFVG-SEQTCVREAAKLL 206
           EKG +++ I  W PN        S  +F   LP T+ + I+S F+  + +     A    
Sbjct: 158 EKGTQISTILNWIPNLPQLAGWVSEKIFGGFLPITLVKFIISFFMELNNENKAAHATYTF 217

Query: 207 VTNYEFVQQSLGLAREEMQKVRDDWNFQLSFLQFCKSQEVELQFLFAFKDHWVNSQTRFD 266
           + +  FV+QSLGLA+ EMQ +R DW FQ   ++ C   ++EL  LFA  DHWV++QTR +
Sbjct: 218 LKDSNFVEQSLGLAKYEMQIIRHDWEFQRELVKMCNVNQIELWTLFAESDHWVSNQTRSE 277

Query: 267 LAEFYNSNYYKDFLTIDEDEKISHSFVLNDTKSVVDRY 304
           L E Y ++   D+ +    +++ H+FV+ ++  VVD Y
Sbjct: 278 LIELYRNSVNSDYYSYSITDQVPHAFVIKNSCHVVDNY 315

>AFR306C Chr6 complement(996001..996960) [960 bp, 319 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR147C
          Length = 319

 Score =  240 bits (612), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 122/279 (43%), Positives = 176/279 (63%), Gaps = 6/279 (2%)

Query: 31  LFVFIPGNPGLIEFYKSFLDQIQKKHGNWEILGISHAGMITKCKGLKKPTKVYSLKDQVQ 90
           + +F+PGNPGLI FY+ FL  I +K+  WEI+GISH GM  K  G +   +VY+L +QV+
Sbjct: 41  ILIFLPGNPGLINFYREFLRSIHEKNPTWEIVGISHTGMSAKT-GPEDLKRVYTLVEQVE 99

Query: 91  HKIYVINDFCSS--NRPLIIAGHSIGAYIVQKIALDVSLMGTVKKIMLLTPTVIDIHLSE 148
           HK+  INDF  +  N  + + GHSIGAY+ QK+ +  +L   V+ + LLTPT+IDIH S 
Sbjct: 100 HKVKAINDFVENRGNLAVKLVGHSIGAYMAQKVVVHPALRVNVEMVGLLTPTIIDIHRSP 159

Query: 149 KGRKLNWINEWCPNFHSYVATASWLVFEKMLPQTITEKILSLFVGSEQTCVREAAKLLVT 208
           KG +L  I+EW P F+ YV+    ++ E +LP T    +    +G    CV ++A+ LV 
Sbjct: 160 KGVQLTRISEWFPRFYEYVSIVDRVLLEWLLPATWISWLARKIIGGSDECVLQSAEKLVK 219

Query: 209 NYEFVQQSLGLAREEMQKVRDDWNFQLSFLQFCKSQEVELQFLFAFKDHWVNSQTRFDLA 268
           N  +V+Q+LG+A+ EM +VR+ W+FQ  F++ C+ +   L  LF+  DHWV+S T  D+ 
Sbjct: 220 NPSYVRQALGMAQLEMHQVRNQWDFQEEFIKTCQERRSSLWLLFSGHDHWVHSDTMKDIV 279

Query: 269 EFYNSNYYKD---FLTIDEDEKISHSFVLNDTKSVVDRY 304
           EFY + Y  +    L I  DE ISHSFV+ DT  VV+ Y
Sbjct: 280 EFYEAKYGTNADSLLRITIDEHISHSFVVKDTTKVVNIY 318

>NCAS0F03530 Chr6 complement(706175..707116) [942 bp, 313 aa] {ON}
           Anc_3.488 YPR147C
          Length = 313

 Score =  239 bits (609), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 126/315 (40%), Positives = 191/315 (60%), Gaps = 14/315 (4%)

Query: 1   MHIQPYSKNGFFSSLYHLKPL-NQEVNSQTPLFVFIPGNPGLIEFYKSFLDQIQKKHGNW 59
           M ++ Y  + F + + H+ P+   E+N   P+FV+IPGNPG++E+Y+  L  + +KH  W
Sbjct: 1   MSVEAYDDDEFPTCVVHILPIKTAEIN---PVFVWIPGNPGILEYYQEMLINLHEKHPTW 57

Query: 60  EILGISHAGMITKCKGLKKPT-----KVYSLKDQVQHKIYVINDFC-SSNRPLIIAGHSI 113
           EIL ISH GM TK   L K +     +V++LK+Q+QHKI +IN+F   SN P+ I+GHS+
Sbjct: 58  EILAISHIGMNTKTTSLFKGSHQDNSRVFTLKEQIQHKIKIINNFVKDSNVPIYISGHSV 117

Query: 114 GAYIVQKIALDVSLMGTVKKIMLLTPTVIDIHLSEKGRKLNWINEW-CPNFHSYVATASW 172
           GAY+VQKI     L+G V K+ L+TPT+IDIHLSEKG+ +     W C      ++   +
Sbjct: 118 GAYMVQKIVASDELIGQVLKMGLITPTIIDIHLSEKGKSMTRYARWSCRQLPHILSFLCY 177

Query: 173 LVFEKMLPQTITEKILSLFVGSEQ-TCVREAAKLLVTNYEFVQQSLGLAREEMQKVRDDW 231
           +VF  ++P  +   I+   +G    +    + +L +T   FV+QSLGLA+EEM  + DDW
Sbjct: 178 IVFGWLVPGILRSYIIGYVMGCHHDSQAAISTELFLTGPNFVRQSLGLAQEEMDTIHDDW 237

Query: 232 NFQLSFLQFCKSQEVELQFLFAFKDHWVNSQTRFDLAEFYNSNY--YKDFLTIDEDEKIS 289
            FQ   +++C    +++QFLF+  DHWV   TR ++ +FY       K  L ID  ++  
Sbjct: 238 QFQAELIEYCLKNSIKIQFLFSATDHWVREATRKEIIQFYQERCKGAKALLKIDVSDQFP 297

Query: 290 HSFVLNDTKSVVDRY 304
           HSFV+  +K VV+ Y
Sbjct: 298 HSFVVRRSKYVVEHY 312

>YPR147C Chr16 complement(825645..826559) [915 bp, 304 aa] {ON}
           Putative protein of unknown function; green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           and is induced in response to the DNA-damaging agent MMS
          Length = 304

 Score =  238 bits (608), Expect = 6e-77,   Method: Compositional matrix adjust.
 Identities = 118/306 (38%), Positives = 189/306 (61%), Gaps = 5/306 (1%)

Query: 1   MHIQPYSKNGFFSSLYHLKPLNQEVNSQTPLFVFIPGNPGLIEFYKSFLDQIQKKHGNWE 60
           M ++ Y+K+    S+ ++KP   +     PL V+IPGNPGL+ +Y+  L  +  KH +WE
Sbjct: 1   MTVKEYTKSKLPCSILNIKPTVTKSGEDAPLLVWIPGNPGLLYYYQEMLHHLHLKHPDWE 60

Query: 61  ILGISHAGMITKCKGLKKPTKVYSLKDQVQHKIYVINDFCSSNRPLIIAGHSIGAYIVQK 120
           ILGISHAGM          T ++SL+DQV H++ VIN+F   NR +II GHS+GAYIVQK
Sbjct: 61  ILGISHAGMTLNAHS---NTPIFSLQDQVDHQVEVINNFSCKNRKIIIMGHSVGAYIVQK 117

Query: 121 IALDVSLMGTVKKIMLLTPTVIDIHLSEKGRKLNWINEWCPNFHSYVATASWLVFEKMLP 180
           + L   L+G+V+K+ L+TPTV+DIH SE G K+     + P     V+  S++ F  +L 
Sbjct: 118 VCLSNKLVGSVQKVGLVTPTVMDIHTSEMGIKMTAALRYIPPLAHVVSLFSYIFFYWILS 177

Query: 181 QTITEKILSLFVGSEQTCVRE--AAKLLVTNYEFVQQSLGLAREEMQKVRDDWNFQLSFL 238
           +  +  I+  F+G   T  +   + ++ +T+ +FV+QSLGLA +EM+++  +W FQ  F+
Sbjct: 178 EGFSRFIIDKFMGCGSTGYQAVLSTRIFLTHRQFVRQSLGLAAQEMEEITTNWEFQDRFI 237

Query: 239 QFCKSQEVELQFLFAFKDHWVNSQTRFDLAEFYNSNYYKDFLTIDEDEKISHSFVLNDTK 298
            +C+   + + FLF+  DHWV+ +TR  L+++Y     ++ L ID  +KI HSFV+   +
Sbjct: 238 NYCEENGISIWFLFSSNDHWVSGKTRSHLSDYYKDKVKQERLKIDVTDKIPHSFVVKHAE 297

Query: 299 SVVDRY 304
             ++ +
Sbjct: 298 YAINAF 303

>ZYRO0D10076g Chr4 (850134..851051) [918 bp, 305 aa] {ON} similar to
           uniprot|Q06522 Saccharomyces cerevisiae YPR147C
           Hypothetical ORF
          Length = 305

 Score =  236 bits (601), Expect = 5e-76,   Method: Compositional matrix adjust.
 Identities = 117/276 (42%), Positives = 178/276 (64%), Gaps = 2/276 (0%)

Query: 31  LFVFIPGNPGLIEFYKSFLDQIQKKHGNWEILGISHAGMITKCKGL-KKPTKVYSLKDQV 89
           LFV+IPGNPG++++Y+ FL+ + +K+ ++EIL ISHAGM T+   L K+   +Y+L DQ+
Sbjct: 29  LFVWIPGNPGIVQYYEEFLNLLHEKYDSFEILAISHAGMATEDPDLQKRKATIYTLDDQI 88

Query: 90  QHKIYVINDFCSSNRPLIIAGHSIGAYIVQKIALDVSLMGTVKKIMLLTPTVIDIHLSEK 149
           QHK+ +IN F + +RPLI+ GHS+GAY+ Q + L   L+G V K+ L+TPTV+DIH S+K
Sbjct: 89  QHKVEIINQFSAKDRPLIVMGHSVGAYMAQHVVLAEKLLGRVVKLGLITPTVVDIHRSQK 148

Query: 150 GRKLNWINEWCPNFHSYVATASWLVFEKMLPQTITEKILSLFVGSEQTCVREA-AKLLVT 208
           G +L     W        A  S ++F K+     T++++SLF+G ++  V  A +K LV 
Sbjct: 149 GTQLTRAFYWVKYLPDIAAWVSDMLFNKLSSIMFTDQVISLFMGVDKESVPVATSKSLVQ 208

Query: 209 NYEFVQQSLGLAREEMQKVRDDWNFQLSFLQFCKSQEVELQFLFAFKDHWVNSQTRFDLA 268
           N E ++Q+LGLA  EMQ++R  W FQ   +  C S E+E +F+F+  D WV++ TR  L 
Sbjct: 209 NPEIIRQALGLAALEMQQIRGCWPFQKKLIDHCNSNEIETKFVFSANDPWVSNATREALM 268

Query: 269 EFYNSNYYKDFLTIDEDEKISHSFVLNDTKSVVDRY 304
            FY  NY    L I   + ++HSF++  +K +VD Y
Sbjct: 269 VFYRENYRDRNLEISVSQDLAHSFIVKHSKYIVDEY 304

>CAGL0L08514g Chr12 (932629..933567) [939 bp, 312 aa] {ON} similar
           to uniprot|Q06522 Saccharomyces cerevisiae YPR147c
          Length = 312

 Score =  230 bits (586), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 123/311 (39%), Positives = 180/311 (57%), Gaps = 7/311 (2%)

Query: 1   MHIQPYSKNGFFSSLYHLKPLNQEVNSQTPLFVFIPGNPGLIEFYKSFLDQIQKKHGNWE 60
           M +Q Y  +   + + H+KP     +  +PLFV+IPGNPGL+E+Y+ FL ++  K+  WE
Sbjct: 1   MSVQGYHDSALPTCIIHIKPTVTNNDESSPLFVWIPGNPGLLEYYQEFLAKVHDKNPTWE 60

Query: 61  ILGISHAGMITKCKGLKK----PTKVYSLKDQVQHKIYVINDFCSS-NRPLIIAGHSIGA 115
           ILGISHAG + +   LKK    P  +Y LK Q QHKI +IN   +  NR L+I GHS+GA
Sbjct: 61  ILGISHAGTVIESSQLKKFRKNPLPIYDLKQQTQHKIDIINKINNDPNRELVIMGHSVGA 120

Query: 116 YIVQKIALDVSLMGTVKKIMLLTPTVIDIHLSEKGRKLNWINEWCPNFHSYVATASWLVF 175
           YI Q +     L+G V K+ L+TPT+ DIH S  G     +  +  N + Y++  S  +F
Sbjct: 121 YIAQHVVSSPDLVGRVSKLGLITPTIRDIHKSSHGLIFTRVFNYISNVNEYLSFISSNIF 180

Query: 176 EKMLPQTITEKILSLFVGS--EQTCVREAAKLLVTNYEFVQQSLGLAREEMQKVRDDWNF 233
            K++P   T+ ++S  +G   ++  +     LL+T  E ++Q LGLA  EM ++RDDW F
Sbjct: 181 NKLIPAYWTKLLISFAMGCSFDEYHIILGTFLLLTQRETLRQVLGLAAHEMLEIRDDWAF 240

Query: 234 QLSFLQFCKSQEVELQFLFAFKDHWVNSQTRFDLAEFYNSNYYKDFLTIDEDEKISHSFV 293
           Q + L  CK    +L  LF+  DHWV+  T+ +L +F    Y +  L +D D+ I HSFV
Sbjct: 241 QENLLTKCKDNGTKLWLLFSDNDHWVSQHTQAELIKFLKDRYPELLLRVDVDKDIKHSFV 300

Query: 294 LNDTKSVVDRY 304
           + D   V  RY
Sbjct: 301 VKDVDLVTRRY 311

>NDAI0B05830 Chr2 complement(1415309..1416298) [990 bp, 329 aa] {ON}
           Anc_3.488 YPR147C
          Length = 329

 Score =  211 bits (537), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 125/332 (37%), Positives = 193/332 (58%), Gaps = 32/332 (9%)

Query: 1   MHIQPYSKNGFFSSLYHLKP--LNQEVNSQTPLFVFIPGNPGLIEFYKSFLDQIQKKHGN 58
           M ++ YS++ + +S+ H++   L +   S  PLF++IPGNPG++++Y+ FL  + KKH +
Sbjct: 1   MLVKSYSESKYPTSIIHIEAEKLIENDPSLNPLFIWIPGNPGILQYYQQFLCSLHKKHPH 60

Query: 59  WEILGISHAGMITKCKGLKKPT-KVYSLKDQVQHKIYVINDFCSS---------NRPLII 108
           WEIL I HAGM T     + P  ++Y L +Q++HKI VI  F +           RPL+I
Sbjct: 61  WEILAIPHAGMDTSLPVYRHPNDRIYHLNEQIEHKIEVITTFLTKANSSDGIMKKRPLVI 120

Query: 109 AGHSIGAYIVQKIALDVSLMGTV-------KKIMLLTPTVIDIHLSEKG----RKLNWIN 157
            GHS+G Y++Q++ L      T+       KKI  +TPT+IDI+LS KG      L   +
Sbjct: 121 MGHSVGTYMIQRMVLTKEFQDTILHNSFYLKKIGFITPTIIDINLSSKGILISHGLQLTH 180

Query: 158 EWCPNFHSYVATASWLVFEKMLP--QTITEKILSLFVGSEQTCVRE-AAKLLVTNYEFVQ 214
            + P   SY+   S+ VF  +L     I  ++++  +G + T       ++L+TN   V+
Sbjct: 181 GYLPYILSYL---SYFVFSLILKYFDNIRRRLIAYIMGCQMTDFAAIGTEILLTNSVLVK 237

Query: 215 QSLGLAREEMQKVRDDWNFQLSFLQFCKSQEVELQFLFAFKDHWVNSQTRFDLAEFYNSN 274
           QSLGLA  EMQ++R +W+ Q  F++ C   +++L  LF   DHWVN+ TR DL +FY SN
Sbjct: 238 QSLGLASIEMQEIRKNWDVQKQFVENCNHNDIQLWLLFCETDHWVNNVTRTDLIKFYQSN 297

Query: 275 YYKDF--LTIDEDEKISHSFVLNDTKSVVDRY 304
            YKD   L I+   +  HSFV+N +  VV+R+
Sbjct: 298 -YKDISRLQIEVSSEFPHSFVVNHSDWVVERF 328

>Skud_2.331 Chr2 complement(599967..601097) [1131 bp, 376 aa] {ON}
           YBR204C (REAL)
          Length = 376

 Score = 38.1 bits (87), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 35/134 (26%), Positives = 60/134 (44%), Gaps = 13/134 (9%)

Query: 31  LFVFIPGNPGLIEFYKSFL---DQIQKKHGNWEILGISHAGMITKCKGLKKPTKVYSLKD 87
           +F+F+PG  G +E ++  L   D  QK     ++ G  H+        LK    ++ L  
Sbjct: 89  VFLFVPGLAGNLEQFEPLLKLIDSDQKAFLALDLPGFGHSSEWADYPMLKVVELIFVLVC 148

Query: 88  QVQHKIYV-------INDFCSSNRPLIIAGHSIGAYIVQKI-ALDVSLMGTVKKIMLLTP 139
            V  K          +N F   NR +++ GHS+G ++   +    ++ +  V+K++LLTP
Sbjct: 149 DVLKKWPAAVPKDREVNPF--DNRKIVLTGHSMGCFLACHLYEQHLAALKVVEKMVLLTP 206

Query: 140 TVIDIHLSEKGRKL 153
               I    K R L
Sbjct: 207 PKAHIEQLSKDRHL 220

>TBLA0J00330 Chr10 (59970..61142) [1173 bp, 390 aa] {ON} Anc_7.497
           YJR107W
          Length = 390

 Score = 37.4 bits (85), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 28/107 (26%), Positives = 47/107 (43%), Gaps = 18/107 (16%)

Query: 60  EILGISHAGMITKCKGLKKPTKVYSLKDQVQ-------HKIYVINDFCSSNRPLIIAGHS 112
           E + +  +G I  CKG K     Y  K  +         KI+ I     S+  L++ GHS
Sbjct: 189 EYIDLIRSGKIRPCKGCKMHRGFYRFKQSLGKHFLRKVEKIFAI----YSDYNLVVTGHS 244

Query: 113 IGAYIVQKIALDVSLMGTVKKIML-LTPTVIDIHLSEKGRKLNWINE 158
           +GA I   + +++ L G    ++   TP + +  + E      W+NE
Sbjct: 245 LGAAIASMLGIELKLKGYNPLVLTYATPKMFNKEMKE------WVNE 285

>Suva_4.459 Chr4 complement(802339..803466) [1128 bp, 375 aa] {ON}
           YBR204C (REAL)
          Length = 375

 Score = 35.4 bits (80), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 33/142 (23%), Positives = 62/142 (43%), Gaps = 29/142 (20%)

Query: 31  LFVFIPGNPGLIEFYKSFLDQIQKKH-----------------GNWEILGISHAGMITKC 73
           +FVF+PG  G +E ++  L  +  +                   ++ +L +     +  C
Sbjct: 88  VFVFVPGLGGNLEQFEPLLKLLDSERKAFLAFDSPGFGQSSEWNDYPMLKVVELIFVLVC 147

Query: 74  KGLKK-PTKVYSLKDQVQHKIYVINDFCSSNRPLIIAGHSIGAYIVQKI-ALDVSLMGTV 131
             LKK PT V   KD   + +        + R +++ GHS+G ++   +    ++++  V
Sbjct: 148 DVLKKWPTAVS--KDDDTNLL--------NGRKIVLVGHSMGCFLACHLYEQHLAILNVV 197

Query: 132 KKIMLLTPTVIDIHLSEKGRKL 153
           K+ +LLTP    I    K R+L
Sbjct: 198 KRFVLLTPPKAHIEQLSKDRRL 219

>TBLA0H03540 Chr8 (863267..864403) [1137 bp, 378 aa] {ON} Anc_8.524
           YBR204C
          Length = 378

 Score = 35.4 bits (80), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 32/136 (23%), Positives = 60/136 (44%), Gaps = 6/136 (4%)

Query: 24  EVNSQTPLFVFIPGNPGLIEFYKSFL---DQIQKKHGNWEILGISHAGMITKCKGLKKPT 80
           EV +  P++VF+PG  G ++ Y+  L   D + +K   +++ G   +   T  +G     
Sbjct: 89  EVLTNKPIYVFLPGLGGSLDQYEPLLRLMDILNEKFIGFDLPGFGGSEEDTS-EGGYNMI 147

Query: 81  KVYSLKDQVQHKIYVINDFCSSNRPLIIAGHSIGAYIVQKI--ALDVSLMGTVKKIMLLT 138
           KV  + ++    I   N        L + GHS+G Y+V     +        + +++L +
Sbjct: 148 KVCHIINEALQSIITQNYSTRDTIELRLVGHSMGCYLVLHFFNSFQTKTEYKISQLILTS 207

Query: 139 PTVIDIHLSEKGRKLN 154
           P    I   +K  +LN
Sbjct: 208 PPKKKIEPLDKNNRLN 223

>NDAI0C05430 Chr3 (1259106..1260194) [1089 bp, 362 aa] {ON}
           Anc_8.524 YBR204C
          Length = 362

 Score = 34.7 bits (78), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 33/136 (24%), Positives = 62/136 (45%), Gaps = 14/136 (10%)

Query: 26  NSQTPLFVFIPGNPGLIEFYKSFLDQIQKKHGNWEILGISHAGMITKCKGLKKPTKVYSL 85
           N   PL++FI G  G++E ++  L  +      +  L +   G      G     + Y++
Sbjct: 86  NHNEPLYLFIHGLGGVLEQFEPLLRLLDLNENKF--LALDLPGF-----GKSDEYEDYNM 138

Query: 86  KDQVQ--HKIY--VINDFCSSNRPLIIAGHSIGAYIVQKIALDVSLMGTVKKIMLLTPTV 141
            D +   H I   +I +  +SN  +++ GHS+G YI   +        + KK++ L+P  
Sbjct: 139 FDVISIIHTIVDRLIPERTTSN--IVLVGHSMGCYISLHLFYKSYTRFSFKKLVFLSPPK 196

Query: 142 IDI-HLSEKGRKLNWI 156
             +  L +  RK+ W+
Sbjct: 197 PQLDQLEKTNRKMQWL 212

>TDEL0B06760 Chr2 complement(1197971..1199620) [1650 bp, 549 aa]
           {ON} Anc_2.583 YMR029C
          Length = 549

 Score = 33.1 bits (74), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 16/66 (24%), Positives = 33/66 (50%), Gaps = 6/66 (9%)

Query: 57  GNWEILGISHAGMITKCKGLKKPTKVYSLKDQVQHKIYVINDFCSSNRPLIIAGHSIGAY 116
           GN ++  +   G +TK       +K      QV  ++  ++    ++ P+I++GH+ G  
Sbjct: 485 GNIDVKNLKDFGSVTKL------SKGAEFDSQVNGRVKSVDSTTVNSTPVIVSGHNDGTI 538

Query: 117 IVQKIA 122
            +QK+A
Sbjct: 539 TLQKLA 544

>NDAI0J01150 Chr10 complement(262920..267473) [4554 bp, 1517 aa]
           {ON} Anc_8.303
          Length = 1517

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 15/64 (23%), Positives = 31/64 (48%)

Query: 191 FVGSEQTCVREAAKLLVTNYEFVQQSLGLAREEMQKVRDDWNFQLSFLQFCKSQEVELQF 250
            VG+E   +R A+   + + +F +    + RE  ++ +  WN  L + + C  + V +  
Sbjct: 899 LVGNEVQSLRRASDATLRSIDFGEDEGDVRREHREQGKVKWNIYLEYAKACNPRNVAIFM 958

Query: 251 LFAF 254
           +FA 
Sbjct: 959 IFAI 962

>KLLA0E13135g Chr5 complement(1162722..1164599) [1878 bp, 625 aa]
           {ON} weakly similar to uniprot|P36166 Saccharomyces
           cerevisiae YKR090W PXL1 LIM domain-containing protein
           that localizes to sites of polarized growth
          Length = 625

 Score = 32.0 bits (71), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 26/73 (35%), Positives = 35/73 (47%), Gaps = 5/73 (6%)

Query: 20  PLNQEVNSQTPLFVFIPGNPGLIEFYKSFLDQ-IQKKHGNWEILGISHAG---MITKCKG 75
           P  QE++ QTP+ V+ PG+      +K  + + I  KH N E+ G  H G    IT  K 
Sbjct: 454 PRQQELHEQTPMEVYPPGHGPCRNCHKEVVGKGIYSKHEN-ELSGQWHRGCFKCITCSKP 512

Query: 76  LKKPTKVYSLKDQ 88
             K    Y L DQ
Sbjct: 513 FSKRVPCYILDDQ 525

>NCAS0B02260 Chr2 complement(374788..375879) [1092 bp, 363 aa] {ON}
           Anc_8.524 YBR204C
          Length = 363

 Score = 31.6 bits (70), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 31/124 (25%), Positives = 51/124 (41%), Gaps = 17/124 (13%)

Query: 25  VNSQTPLFVFIPGNPGLIEFYKSFLDQIQKKHGNWEILGISHAGMITKCKGLKKPTKVYS 84
           VN   PL +FI G  G +  ++  L     K   +  L +   G   + +        YS
Sbjct: 77  VNDGHPLHLFIHGLGGSLGQFEPLLRLTHLKGKKFLTLDLPGFGQSDELES-------YS 129

Query: 85  LKDQVQHKIYVINDFCSSNRP---------LIIAGHSIGAYIVQKIALDVSLMGTVKKIM 135
           +K  ++  I  + D  + N+          LI+ GHS+G Y+        S    ++KI 
Sbjct: 130 MKSVIE-TIRSVVDLATGNQKSLGENTQLKLILTGHSMGCYLCLHFFETYSKNYDIRKIA 188

Query: 136 LLTP 139
           LL+P
Sbjct: 189 LLSP 192

>YBR204C Chr2 complement(632254..633381) [1128 bp, 375 aa] {ON}
           LDH1Serine hydrolase; exhibits active esterase plus weak
           triacylglycerol lipase activities; proposed role in
           lipid homeostasis, regulating phospholipid and non-polar
           lipid levels and required for mobilization of LD-stored
           lipids; localizes to the lipid droplet (LD) surface;
           contains a classical serine containing catalytic triad
           (GxSxG motif)
          Length = 375

 Score = 31.6 bits (70), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 33/137 (24%), Positives = 60/137 (43%), Gaps = 14/137 (10%)

Query: 31  LFVFIPGNPGLIEFYKSFL---DQIQKKHGNWEILGISHAGMITKCKGLKKPTKVYSLKD 87
           +FVF+PG  G +E ++  L   D  QK     ++ G  H+   +    LK    ++ L  
Sbjct: 88  VFVFVPGLAGNLEQFEPLLELVDSDQKAFLTLDLPGFGHSSEWSDYPMLKVVELIFVLVC 147

Query: 88  QVQHKIYV-------INDFCSSNRPLIIAGHSIGAYIVQKI-ALDVSLMGTVKKIMLLTP 139
            V  K          +N F  +   +++ GHS+G ++   +    ++    V+ ++LLTP
Sbjct: 148 DVLRKWSTAVPNNDNVNPF--NGHKIVLVGHSMGCFLACHLYEQHMADTKAVQTLVLLTP 205

Query: 140 TVIDI-HLSEKGRKLNW 155
               I  LS+    + W
Sbjct: 206 PKAHIEQLSKDKHIIQW 222

>Smik_2.345 Chr2 complement(618817..619944) [1128 bp, 375 aa] {ON}
           YBR204C (REAL)
          Length = 375

 Score = 31.2 bits (69), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 36/158 (22%), Positives = 65/158 (41%), Gaps = 34/158 (21%)

Query: 21  LNQEVNSQTPLFVFIPGNPGLIEFYKSFLDQIQKKH-----------------GNWEILG 63
           LN +      +FVF+PG  G +E ++  L  +                      ++ +L 
Sbjct: 78  LNDKGIRSDTVFVFVPGLAGNLEQFEPLLKLVDSDRKAFLALDLPGFGDSSEWSDYPMLK 137

Query: 64  ISHAGMITKCKGLKKPTKVYSLKDQVQHKIYVINDFCSSNRPLIIAGHSIGAYIV----Q 119
           +     I  C  LK    V S  D +        +F + ++ L++ GHS+G ++     +
Sbjct: 138 VVELIFILLCDVLKGRPAVLSKDDNL--------NFFNGHK-LVLVGHSMGCFLACHLYE 188

Query: 120 KIALDVSLMGTVKKIMLLTPTVIDI-HLSEKGRKLNWI 156
           +  +D  +   VK ++LLTP    I  LS+  R   W+
Sbjct: 189 QHLVDAKV---VKTLVLLTPPKAHIEQLSKDKRIYQWV 223

>TDEL0A03430 Chr1 complement(613050..614000) [951 bp, 316 aa] {ON}
           Anc_5.479 YOR143C
          Length = 316

 Score = 30.4 bits (67), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 32/69 (46%), Gaps = 7/69 (10%)

Query: 13  SSLYHLKPLNQEVN----SQTPLFVFIPGNPGLIEFYKSFLDQIQKKHGNWEILGISHAG 68
           + LY L   + + N    S T L  F+P    L+E+ K F DQ     GN  +L ++   
Sbjct: 201 TQLYKLSSPDSQFNLCYLSATDLIFFVPSGGFLLEYTKEFRDQCI---GNCGLLPLNGPT 257

Query: 69  MITKCKGLK 77
            I +  GLK
Sbjct: 258 EIIETSGLK 266

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.322    0.137    0.416 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 33,636,092
Number of extensions: 1464465
Number of successful extensions: 4362
Number of sequences better than 10.0: 38
Number of HSP's gapped: 4444
Number of HSP's successfully gapped: 38
Length of query: 305
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 196
Effective length of database: 40,982,805
Effective search space: 8032629780
Effective search space used: 8032629780
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 65 (29.6 bits)