Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0F02838g3.489ON65465432380.0
KLTH0F14762g3.489ON65062319050.0
AFR307C3.489ON65066117550.0
KLLA0E04665g3.489ON64762216830.0
TDEL0D055703.489ON64966116270.0
ZYRO0D10054g3.489ON66467216080.0
NCAS0E008303.489ON67168115850.0
Kpol_480.163.489ON65565815730.0
Suva_7.4163.489ON71371315310.0
Smik_6.2243.489ON70570515190.0
YGR128C (UTP8)3.489ON71371314940.0
Skud_7.4393.489ON71371314800.0
TPHA0D042303.489ON65265914290.0
NDAI0G009603.489ON70065814210.0
TBLA0C044603.489ON69867114180.0
CAGL0I10560g3.489ON67865813351e-176
Kwal_55.212223.489ON37337611531e-153
KNAG0B008303.489ON6076738761e-108
KAFR0C019403.489ON6096808211e-100
Kwal_55.21225singletonOFF2152136485e-80
Ecym_60366.373ON2100107771.4
TPHA0D029703.439ON20858704.9
Kpol_1001.284.289ON376131715.5
NCAS0I025403.86ON92057715.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0F02838g
         (654 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0F02838g Chr6 (240272..242236) [1965 bp, 654 aa] {ON} simila...  1251   0.0  
KLTH0F14762g Chr6 complement(1209571..1211523) [1953 bp, 650 aa]...   738   0.0  
AFR307C Chr6 complement(997169..999121) [1953 bp, 650 aa] {ON} S...   680   0.0  
KLLA0E04665g Chr5 (414183..416126) [1944 bp, 647 aa] {ON} simila...   652   0.0  
TDEL0D05570 Chr4 complement(1005376..1007325) [1950 bp, 649 aa] ...   631   0.0  
ZYRO0D10054g Chr4 (847992..849986) [1995 bp, 664 aa] {ON} simila...   624   0.0  
NCAS0E00830 Chr5 (151952..153967) [2016 bp, 671 aa] {ON} Anc_3.4...   615   0.0  
Kpol_480.16 s480 (33288..35255) [1968 bp, 655 aa] {ON} (33288..3...   610   0.0  
Suva_7.416 Chr7 complement(718089..720230) [2142 bp, 713 aa] {ON...   594   0.0  
Smik_6.224 Chr6 complement(365799..367916) [2118 bp, 705 aa] {ON...   589   0.0  
YGR128C Chr7 complement(747950..750091) [2142 bp, 713 aa] {ON}  ...   580   0.0  
Skud_7.439 Chr7 complement(727211..729352) [2142 bp, 713 aa] {ON...   574   0.0  
TPHA0D04230 Chr4 complement(913504..915462) [1959 bp, 652 aa] {O...   555   0.0  
NDAI0G00960 Chr7 (199784..201886) [2103 bp, 700 aa] {ON} Anc_3.4...   551   0.0  
TBLA0C04460 Chr3 complement(1080461..1082557) [2097 bp, 698 aa] ...   550   0.0  
CAGL0I10560g Chr9 (1043862..1045898) [2037 bp, 678 aa] {ON} simi...   518   e-176
Kwal_55.21222 s55 complement(736354..737475) [1122 bp, 373 aa] {...   448   e-153
KNAG0B00830 Chr2 (151939..153762) [1824 bp, 607 aa] {ON} Anc_3.4...   342   e-108
KAFR0C01940 Chr3 complement(387789..389618) [1830 bp, 609 aa] {O...   320   e-100
Kwal_55.21225 s55 complement(737726..738370) [645 bp, 215 aa] {O...   254   5e-80
Ecym_6036 Chr6 (65515..71817) [6303 bp, 2100 aa] {ON} similar to...    34   1.4  
TPHA0D02970 Chr4 complement(619854..620480) [627 bp, 208 aa] {ON...    32   4.9  
Kpol_1001.28 s1001 (78022..78294,78298..78306,78310..78405,78409...    32   5.5  
NCAS0I02540 Chr9 (475302..478064) [2763 bp, 920 aa] {ON} Anc_3.8...    32   5.7  

>SAKL0F02838g Chr6 (240272..242236) [1965 bp, 654 aa] {ON} similar
           to uniprot|P53276 Saccharomyces cerevisiae YGR128C UTP8
           Nucleolar protein required for export of tRNAs from the
           nucleus also copurifies with the small subunit (SSU)
           processome containing the U3 snoRNA that is involved in
           processing of pre-18S rRNA
          Length = 654

 Score = 1251 bits (3238), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 625/654 (95%), Positives = 625/654 (95%)

Query: 1   MASISQPFRLTALPKIASLNNFSTQTDYLQVANTLTPSANKINIGVSGSSISQYIINPTP 60
           MASISQPFRLTALPKIASLNNFSTQTDYLQVANTLTPSANKINIGVSGSSISQYIINPTP
Sbjct: 1   MASISQPFRLTALPKIASLNNFSTQTDYLQVANTLTPSANKINIGVSGSSISQYIINPTP 60

Query: 61  KLVHNLSIPSTSIVTACDVSEIQQNEGDTETQEVWCYALVANKSFTLNTIIKPLTADAPS 120
           KLVHNLSIPSTSIVTACDVSEIQQNEGDTETQEVWCYALVANKSFTLNTIIKPLTADAPS
Sbjct: 61  KLVHNLSIPSTSIVTACDVSEIQQNEGDTETQEVWCYALVANKSFTLNTIIKPLTADAPS 120

Query: 121 VNSTQTFENYKVSIKHKVASVKIFPSRKTIIAVLQNGLVQTFDFQLKLLHSADISYGNIS 180
           VNSTQTFENYKVSIKHKVASVKIFPSRKTIIAVLQNGLVQTFDFQLKLLHSADISYGNIS
Sbjct: 121 VNSTQTFENYKVSIKHKVASVKIFPSRKTIIAVLQNGLVQTFDFQLKLLHSADISYGNIS 180

Query: 181 LVKYFTNEVLQDFMIVLTDLNDDKVCYKLFEIIHHDSNVPLKELNSVILEGFSLQNSKTF 240
           LVKYFTNEVLQDFMIVLTDLNDDKVCYKLFEIIHHDSNVPLKELNSVILEGFSLQNSKTF
Sbjct: 181 LVKYFTNEVLQDFMIVLTDLNDDKVCYKLFEIIHHDSNVPLKELNSVILEGFSLQNSKTF 240

Query: 241 YQFGKIYTLSNGKISIYSLPHFQLSNTINLPFVTHENVVSFKPISTNRALLTVDNRIYLL 300
           YQFGKIYTLSNGKISIYSLPHFQLSNTINLPFVTHENVVSFKPISTNRALLTVDNRIYLL
Sbjct: 241 YQFGKIYTLSNGKISIYSLPHFQLSNTINLPFVTHENVVSFKPISTNRALLTVDNRIYLL 300

Query: 301 DLLHNAILSQRELTHVKTFQLLTTAIIPGNTAENNKTIAIGVSTKSDNNATSALDIVNIN 360
           DLLHNAILSQRELTHVKTFQLLTTAIIPGNTAENNKTIAIGVSTKSDNNATSALDIVNIN
Sbjct: 301 DLLHNAILSQRELTHVKTFQLLTTAIIPGNTAENNKTIAIGVSTKSDNNATSALDIVNIN 360

Query: 361 VGSGTLKDSMSKGFLTQDATEEVLNSLFXXXXXXXXXXGTSQFDYNQILSELEKAKSKTE 420
           VGSGTLKDSMSKGFLTQDATEEVLNSLF          GTSQFDYNQILSELEKAKSKTE
Sbjct: 361 VGSGTLKDSMSKGFLTQDATEEVLNSLFDEQDDELDEDGTSQFDYNQILSELEKAKSKTE 420

Query: 421 KFDNVFFKSLNIKKEYYTEYDRFFNSQGFLDKVLSLIFENFNKEYPRALTYLLTHPLFPA 480
           KFDNVFFKSLNIKKEYYTEYDRFFNSQGFLDKVLSLIFENFNKEYPRALTYLLTHPLFPA
Sbjct: 421 KFDNVFFKSLNIKKEYYTEYDRFFNSQGFLDKVLSLIFENFNKEYPRALTYLLTHPLFPA 480

Query: 481 KHATCLLSKFKEHPRLFRQAIVTCPNLPLDALLHELFTVINDELCLDLSLRILQDFTKDS 540
           KHATCLLSKFKEHPRLFRQAIVTCPNLPLDALLHELFTVINDELCLDLSLRILQDFTKDS
Sbjct: 481 KHATCLLSKFKEHPRLFRQAIVTCPNLPLDALLHELFTVINDELCLDLSLRILQDFTKDS 540

Query: 541 IKQSIKKMSKVDINNFIGFVINEDDDEERNKSKPQLFQLLNLVLDSIGLFALDGESLENL 600
           IKQSIKKMSKVDINNFIGFVINEDDDEERNKSKPQLFQLLNLVLDSIGLFALDGESLENL
Sbjct: 541 IKQSIKKMSKVDINNFIGFVINEDDDEERNKSKPQLFQLLNLVLDSIGLFALDGESLENL 600

Query: 601 HQFIENQVDIVEQNIELLNLLDDXXXXXXXXXXXXXXXXXXXEQALPSYSVEYL 654
           HQFIENQVDIVEQNIELLNLLDD                   EQALPSYSVEYL
Sbjct: 601 HQFIENQVDIVEQNIELLNLLDDTSAKSTSIISSYSASSSTTEQALPSYSVEYL 654

>KLTH0F14762g Chr6 complement(1209571..1211523) [1953 bp, 650 aa]
           {ON} similar to uniprot|P53276 Saccharomyces cerevisiae
           YGR128C UTP8 Nucleolar protein required for export of
           tRNAs from the nucleus also copurifies with the small
           subunit (SSU) processome containing the U3 snoRNA that
           is involved in processing of pre-18S rRNA
          Length = 650

 Score =  738 bits (1905), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/623 (57%), Positives = 483/623 (77%), Gaps = 5/623 (0%)

Query: 1   MASISQPFRLTALPKIASLNNFSTQTDYLQVANTLTPSANKINIGVSGSSISQYIINPTP 60
           M SISQPFRLTALPKIASLNN++TQ +YLQVA+TLTP+ N IN+GVSGS++SQYIINPTP
Sbjct: 1   MPSISQPFRLTALPKIASLNNYATQGNYLQVADTLTPTTNNINVGVSGSAVSQYIINPTP 60

Query: 61  KLVHNLSIPSTSIVTACDVSEIQQNEGDTETQEVWCYALVANKSFTLNTIIKPLTADAPS 120
           KLV+N  I ST++V+AC V+EI     + ++QEV CY + +N+ ++L   IKP+++ A  
Sbjct: 61  KLVYNQPISSTNVVSACAVAEITTT-SEKDSQEVICYGIQSNRVYSLCATIKPVSSTASD 119

Query: 121 VNSTQTFENYKVSIKHKVASVKIFPSRKTIIAVLQNGLVQTFDFQLKLLHSADISYGNIS 180
            +  +T+  +KVS+  ++ ++K+FP  K+I+AVL++GL+Q FDF+LKL HS D SY N+S
Sbjct: 120 SSFGETYAAHKVSVSDQIVNLKVFPDTKSIVAVLRSGLIQFFDFELKLQHSLDSSYKNVS 179

Query: 181 LVKYFTNEVLQDFMIVLTDLNDDKVCYKLFEIIHHDSNVPLKELNSVILEGFSLQNSKTF 240
            V++FT+E  Q +  +L+D++  KV +KLFEI   DS  P  EL+SVILE   L++S+ F
Sbjct: 180 YVQHFTSESGQRYTFLLSDIDGHKVSFKLFEIGQSDSATPATELSSVILENMCLKDSQIF 239

Query: 241 YQFGKIYTLSNGKISIYSLPHFQLSNTINLPFVTHENVVSFKPISTNRALLTVDNRIYLL 300
           YQFG++Y L    +SIY+LPHFQ S TI LPF+  E+++SFKPISTNRALLT DN+I+LL
Sbjct: 240 YQFGQVYRLHGNAVSIYNLPHFQHSRTIELPFLAPESIISFKPISTNRALLTSDNKIFLL 299

Query: 301 DLLHNAILSQRELTHVKTFQLLTTAIIPGNTAENNKTIAIGVSTKSDNNATSALDIVNIN 360
           DLLHNAILSQRE+ HVK FQLL TA+IPGN+  NNKTIA+GVS K  +N +S+LDI+NI+
Sbjct: 300 DLLHNAILSQREMGHVKIFQLLETAVIPGNSTLNNKTIALGVSIKHGSNPSSSLDIINID 359

Query: 361 VGSGTLKDSMSKGFLTQDATEEVLNSLFXXXXXXXXXXGTSQFDYNQILSELEKAKSKTE 420
           VG+GTL+DSM KGF++++   + L  L             ++F+Y++IL EL KA    E
Sbjct: 360 VGTGTLRDSMGKGFMSRENKSQHLQPLISTLNDTE----AAEFNYDRILKELSKAADNIE 415

Query: 421 KFDNVFFKSLNIKKEYYTEYDRFFNSQGFLDKVLSLIFENFNKEYPRALTYLLTHPLFPA 480
            FD+VFFK L IK  YYT+ DRF N + FL+ V +LIF++F  EYP+ALTYLLT+PLFP 
Sbjct: 416 NFDSVFFKRLGIKNNYYTDSDRFVNDREFLEDVSTLIFKSFKSEYPKALTYLLTNPLFPV 475

Query: 481 KHATCLLSKFKEHPRLFRQAIVTCPNLPLDALLHELFTVINDELCLDLSLRILQDFTKDS 540
            H   LL K K+HPRLF+QAIVTCPNL LD L+ ELFTVINDELCLDLSLRILQDF KDS
Sbjct: 476 SHTHNLLQKLKDHPRLFKQAIVTCPNLLLDELVQELFTVINDELCLDLSLRILQDFNKDS 535

Query: 541 IKQSIKKMSKVDINNFIGFVINEDDDEERNKSKPQLFQLLNLVLDSIGLFALDGESLENL 600
           IK++IK+ SK+D+NNFI FVI+E+ +E+R K+KP+LFQLL+LVLDS+GLFAL+ E LE L
Sbjct: 536 IKEAIKQKSKIDVNNFINFVISENFEEDRIKNKPRLFQLLSLVLDSVGLFALENEMLEKL 595

Query: 601 HQFIENQVDIVEQNIELLNLLDD 623
            ++I+ Q+ +V++N+EL NL+++
Sbjct: 596 TKYIDQQLSVVKENVELYNLVEE 618

>AFR307C Chr6 complement(997169..999121) [1953 bp, 650 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR128C
           (UTP8)
          Length = 650

 Score =  680 bits (1755), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/661 (52%), Positives = 466/661 (70%), Gaps = 20/661 (3%)

Query: 1   MASISQPFRLTALPKIASLNNFSTQTDYLQVANTLTPSANKINIGVSGSSISQYIINPTP 60
           MA I+QPFRL  LPKI+SLNN++ QT YLQVA+ L P++N + +GVSGSSISQY+INPTP
Sbjct: 1   MAYIAQPFRLANLPKISSLNNYAQQTSYLQVADVLEPTSNTVTVGVSGSSISQYVINPTP 60

Query: 61  KLVHNLSIPSTSIVTACDVSEIQQNEGDTETQEVWCYALVAN-KSFTLNTIIKPLTADAP 119
           KLV+N+ IPST++VT CDV  +      ++  E+W YAL AN K  TL+ +++   A AP
Sbjct: 61  KLVYNIPIPSTNVVTGCDVLAM------SDGAELWSYALTANGKVHTLHAVLRKAGA-AP 113

Query: 120 SVNSTQTFEN--YKVSIKHKVASVKIFPSRKTIIAVLQNGLVQTFDFQLKLLHSADISYG 177
                   E+  +K ++K +V  V+I  + K I+ VL  GL+QT+D+QL+LLHS DISY 
Sbjct: 114 QETGLDASEDEHFKQTLKGRVVRVRILSACKRIMVVLDCGLIQTYDYQLQLLHSLDISYT 173

Query: 178 NISLVKYFTNEVLQDFMIVLTDLNDDKVCYKLFEIIHHDSNVPLKELNSVILEGFSLQNS 237
           N+ LV+YFT+   +D+M VL D+ + K CYKLF++ H   N+P+ ELNSVILE F+L  S
Sbjct: 174 NVGLVEYFTDSAGKDYMFVLCDIQNKKTCYKLFQLNHSAENLPITELNSVILEDFALAES 233

Query: 238 KTFYQFGKIYTLSNGKISIYSLPHFQLSNTINLPFVTHENVVSFKPISTNRALLTVDNRI 297
           K  YQFGK+Y L + K+ +YSLPHFQLS+ + LPFV  ++ VS + ISTNR LLT  N+I
Sbjct: 234 KMVYQFGKLYRLVDSKMYVYSLPHFQLSHCVPLPFVRKDDQVSLQAISTNRLLLTCCNKI 293

Query: 298 YLLDLLHNAILSQRELTHVKTFQLLTTAIIPGNT-AENNKTIAIGVSTKSDNNATSALDI 356
           +LLDLLHNAIL +REL+++K FQLL  A+IPG T  E+N+T AIGVSTK  +N +SALD+
Sbjct: 294 FLLDLLHNAILYERELSNIKFFQLLRAAVIPGTTPGESNRTFAIGVSTKQGSNPSSALDV 353

Query: 357 VNINVGSGTLKDSMSKGFLTQDATE-EVLNSLFXXXXXXXXXXGTSQFDYNQILSELEKA 415
           V I VG+GTLKDS+ KGFL+ +    E L  LF           +   D+  IL+EL  +
Sbjct: 354 VTIAVGTGTLKDSLGKGFLSGEHRRTEALKPLFGTDDDE-----SPNIDFAAILAEL-TS 407

Query: 416 KSKTEKFDNVFFKSLNIKKEYYTEYDRFFNSQGFLDKVLSLIFENFNKEYPRALTYLLTH 475
           ++  + FD++F+K L  KKEYYTE+DRF N+  FL  +L  IF  F  E+P+AL YLLTH
Sbjct: 408 RTTPKAFDSIFYKRLGPKKEYYTEHDRFINNSEFLAGILDHIFATFADEFPKALIYLLTH 467

Query: 476 PLFPAKHATCLLSKFKEHPRLFRQAIVTCPNLPLDALLHELFTVINDELCLDLSLRILQD 535
           PLFP+ H   LL K K HPRLF+QA+VTCPNLPLD LLHELFTV+NDEL LDLSLR+LQ+
Sbjct: 468 PLFPSSHTKGLLPKLKAHPRLFKQAVVTCPNLPLDELLHELFTVLNDELSLDLSLRVLQE 527

Query: 536 FTKDSIKQSIKKMSKVDINNFIGFVINEDDD-EERNKSKPQLFQLLNLVLDSIGLFALDG 594
           FTK+ IKQ I+++S+VD++NF+ FVI +  D EER K+KPQLFQLL+LV+D++GL AL+G
Sbjct: 528 FTKEDIKQGIRELSRVDLHNFLNFVIKDSTDVEERQKAKPQLFQLLSLVIDAVGLLALEG 587

Query: 595 ESLENLHQFIENQVDIVEQNIELLNLLDDXXXXXXXXXXXXXXXXXXXEQA-LPSYSVEY 653
           + L  L  FI++QV + +Q +ELL LL++                     A +P YSVEY
Sbjct: 588 DILHRLSAFIDSQVAVADQLVELLYLLENSSTKKGKHLNSVTRLDESPVAATIPLYSVEY 647

Query: 654 L 654
           L
Sbjct: 648 L 648

>KLLA0E04665g Chr5 (414183..416126) [1944 bp, 647 aa] {ON} similar
           to uniprot|P53276 Saccharomyces cerevisiae YGR128C UTP8
           Nucleolar protein required for export of tRNAs from the
           nucleus also copurifies with the small subunit (SSU)
           processome containing the U3 snoRNA that is involved in
           processing of pre-18S rRNA
          Length = 647

 Score =  652 bits (1683), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/622 (52%), Positives = 447/622 (71%), Gaps = 14/622 (2%)

Query: 1   MASISQPFRLTALPKIASLNNFSTQTDYLQVANTLTPSANKINIGVSGSSISQYIINPTP 60
           MASISQPFRL+ALPKI SLNN++ QTDYLQV + L+PSANK+NIG+SGSSISQY+INPTP
Sbjct: 1   MASISQPFRLSALPKIPSLNNYANQTDYLQVVDNLSPSANKVNIGISGSSISQYLINPTP 60

Query: 61  KLVHNLSIPSTSIVTACDVSEIQQNEGDTETQEVWCYALVANKSFTLNTIIKPLTADAPS 120
           KLV NL IPST+IVTACDV E      D    EVWCY L A K   L+   KP+  DA S
Sbjct: 61  KLVFNLPIPSTNIVTACDVVE------DAANTEVWCYGLEARKVSHLHLATKPMIQDAVS 114

Query: 121 VNSTQTFENYKVSIKHKVASVKIFPSRKTIIAVLQNGLVQTFDFQLKLLHSADISYGNIS 180
            ++ +    +K  +K +V S+KI+   + ++ +L+NGL+QTFD++LKL ++ DISY +I 
Sbjct: 115 SSNAEITSQFKYKLKSEVVSIKIYSKAEKVLVILRNGLIQTFDYELKLSNTIDISYDDIR 174

Query: 181 LVKYFTNEVLQDFMIVLTDLNDDKVCYKLFEIIHHDSNVPLKELNSVILEGFSLQNSKTF 240
            V++F +    DF  VL  L+D+K+CYKLF++     +V   ELNS+ILE ++L+N+K  
Sbjct: 175 FVQFFQDGQGNDFFFVLCQLSDEKICYKLFQV--RSESVSCIELNSIILENYTLENAKLC 232

Query: 241 YQFGKIYTLSNG-KISIYSLPHFQLSNTINLPFVTHENVVSFKPISTNRALLTVDNRIYL 299
           ++FGK+Y L N  ++SIY LPH QL  +I LPF++ + VVS KP+S+NR LLT DN IYL
Sbjct: 233 FEFGKLYVLKNSNELSIYQLPHLQLQTSIQLPFISKDAVVSIKPVSSNRVLLTADNTIYL 292

Query: 300 LDLLHNAILSQRELTHVKTFQLLTTAIIPGNTAENNKTIAIGVSTKSDNNATSALDIVNI 359
           +DLL+NAIL Q++L ++K  QLL+TA++  N+ +N KTIA+ V+TK+  N TS LD++NI
Sbjct: 293 VDLLYNAILFQKDLQNIKAIQLLSTAVVQENSEDNRKTIALDVTTKNGANPTSYLDVINI 352

Query: 360 NVGSGTLKDSMSKGFLTQDATEEVLNSLFXXXXXXXXXXGTSQFDYNQILSELEKAKSKT 419
           +VG+GTLKD+M KGF+ +   ++ L  LF            S  DY +I+ +L   K K 
Sbjct: 353 DVGTGTLKDAMGKGFMVKQ--KQKLQKLFEESNEDDDVELPSP-DYERIIKQLHICK-KI 408

Query: 420 EKFDNVFFKSLNIKKEYYTEYDRFFNSQGFLDKVLSLIFENFNKEYPRALTYLLTHPLFP 479
           E FD++FFK L++ KEYYT+ DRF N    L +++  +F NF  EYP+ALTYLLTHPLFP
Sbjct: 409 ENFDSIFFKMLSLDKEYYTDNDRFLNDSDLLTQIIDCLFLNFKDEYPKALTYLLTHPLFP 468

Query: 480 AKHATCLLSKFKEHPRLFRQAIVTCPNLPLDALLHELFTVINDELCLDLSLRILQDFTKD 539
             HA  LL+K K +PRLF+QAIVTCPN+PLD LL ELF + N ELC D++LR+LQD+ K+
Sbjct: 469 PVHAKGLLTKLKNNPRLFKQAIVTCPNVPLDDLLTELFNITNAELCFDITLRVLQDYKKE 528

Query: 540 SIKQSIKKMSKVDINNFIGFVINEDD-DEERNKSKPQLFQLLNLVLDSIGLFALDGESLE 598
           SIK  I+K+ K+DI NF+  ++N +  D +   +KPQ+FQL++L++DSIGLFALD E LE
Sbjct: 529 SIKAGIRKIEKMDITNFLDMILNSNKADSDLKLNKPQIFQLMSLIIDSIGLFALDDEYLE 588

Query: 599 NLHQFIENQVDIVEQNIELLNL 620
            L  F++ QV +V QNIELL+L
Sbjct: 589 KLSSFVDAQVSVVSQNIELLHL 610

>TDEL0D05570 Chr4 complement(1005376..1007325) [1950 bp, 649 aa]
           {ON} Anc_3.489 YGR128C
          Length = 649

 Score =  631 bits (1627), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/661 (50%), Positives = 447/661 (67%), Gaps = 21/661 (3%)

Query: 1   MASISQPFRLTALPKIASLNNFSTQTDYLQVANTLTPSANKINIGVSGSSISQYIINPTP 60
           M S+SQ F+L  LP++ASL+NF+ QT++LQVA+ + P++N+I IG+S S+ISQY++NPTP
Sbjct: 1   MPSLSQSFKLAVLPRVASLSNFAFQTNFLQVADDIEPTSNRITIGISESAISQYVLNPTP 60

Query: 61  KLVHNLSIPSTSIVTACDVSEIQQNEGDTETQEVWCYALVANKSFTLNTIIKPLTADAPS 120
           KLV ++ IPST+IVTACDV+        ++ QE+WCYAL A K  TLN   K   A+   
Sbjct: 61  KLVLSIPIPSTNIVTACDVAR-------SDEQEIWCYALQAGKVCTLNVASKVSHAE--- 110

Query: 121 VNSTQTFENYKVSIKHKVASVKIFPSRKTIIAVLQNGLVQTFDFQLKLLHSADISYGNIS 180
            N   + +  KV +  +   V +    KTI+ VL+NGL+Q +DFQLKLLHS D+SY ++S
Sbjct: 111 -NGVNSDDVLKVKVDDQAVGVHVNGKDKTIVVVLKNGLIQFYDFQLKLLHSLDVSYSDVS 169

Query: 181 LVKYFTNEVLQDFMIVLTDLNDDKVCYKLFEIIHHDSN-VPLKELNSVILEGFSLQNSKT 239
           + K+FT E   DF+ +L  L +DKVC+KLFE+   + N VP+KEL+S+ILE FSL  SK 
Sbjct: 170 VTKFFT-EGANDFLFILCSLPEDKVCFKLFELSLPNYNQVPIKELSSIILEDFSLATSKI 228

Query: 240 FYQFGKIYTLSNGKISIYSLPHFQLSNTINLPFVTHENVVSFKPISTNRALLTVDNRIYL 299
            YQ G++Y L   ++ +Y+LP  QL   + LP V   +V+S KPIS+NR L+T DN+IYL
Sbjct: 229 CYQSGRLYRLIGHEVLVYALPQCQLVQAVTLPMVQGADVISMKPISSNRILVTADNKIYL 288

Query: 300 LDLLHNAILSQRELTHVKTFQLLTTAIIPGNTAE---NNKTIAIGVSTKSDNNATSALDI 356
           L+L HN+IL QRELTH+K+FQLL +A+I    +    N KT  IGV TK   N TS+L+I
Sbjct: 289 LNLTHNSILFQRELTHLKSFQLLKSAVIDSRVSSSLPNQKTFVIGVGTKHGKNPTSSLEI 348

Query: 357 VNINVGSGTLKDSMSKGF-LTQDATEEVLNSLFXXXXXXXXXXGT--SQFDYNQILSELE 413
           VN++VG+GTLKDS+ KGF ++ +   +VL  LF                FD+NQI   LE
Sbjct: 349 VNVDVGTGTLKDSLGKGFTVSNEPISQVLKPLFSDEDNEAEDEDNKFEHFDFNQIYQHLE 408

Query: 414 KAKSKTEKFDNVFFKSLNIKKEYYTEYDRFFNSQGFLDKVLSLIFENFNKEYPRALTYLL 473
           K K     FD +F + LNIK+E+YTE DRF   + FL  V+ LI +NF +EYP+ALT+LL
Sbjct: 409 KNKQSISSFDRIFLRELNIKREHYTELDRFICDRQFLSNVVHLILQNFQEEYPKALTFLL 468

Query: 474 THPLFPAKHATCLLSKFKEHPRLFRQAIVTCPNLPLDALLHELFTVINDELCLDLSLRIL 533
           THPLFP      LLS+ +EHPRLF+QAIVTCPNLPL  LL ELF++ N EL LD+SLRIL
Sbjct: 469 THPLFPVDCTPKLLSRLREHPRLFKQAIVTCPNLPLQELLSELFSIENGELSLDISLRIL 528

Query: 534 QDFTKDSIKQSIKKMSKVDINNFIGFVINEDDDEERNKSKPQLFQLLNLVLDSIGLFALD 593
           QD+T D IKQ ++K++K+D+ NFI FVI+  +DE   +S  QLFQLL+LVLDSIGLFALD
Sbjct: 529 QDYTTDMIKQEVRKLNKIDVQNFIEFVISS-NDENAIRSSHQLFQLLSLVLDSIGLFALD 587

Query: 594 GESLENLHQFIENQVDIVEQNIELLNLLDDXXXXXXXXXXXXXXXXXXXEQALPSYSVEY 653
           G  L+ L  +I+ +V I E+N +L +LLDD                   E A+P Y+VEY
Sbjct: 588 GVLLDRLADYIQERVAIAERNSKLCHLLDDKQNSRGFAKSGAGSVGSTRE-AVPKYTVEY 646

Query: 654 L 654
           L
Sbjct: 647 L 647

>ZYRO0D10054g Chr4 (847992..849986) [1995 bp, 664 aa] {ON} similar
           to uniprot|P53276 Saccharomyces cerevisiae YGR128C UTP8
           Nucleolar protein required for export of tRNAs from the
           nucleus also copurifies with the small subunit (SSU)
           processome containing the U3 snoRNA that is involved in
           processing of pre-18S rRNA
          Length = 664

 Score =  624 bits (1608), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/672 (48%), Positives = 452/672 (67%), Gaps = 28/672 (4%)

Query: 1   MASISQPFRLTALPKIASLNNFSTQTDYLQVANTLTPSANKINIGVSGSSISQYIINPTP 60
           M SI QPFRL+ LP+I +L+N+  Q+DYL+V++ ++P++NKI IG+S S+ISQYI+NPTP
Sbjct: 1   MPSIFQPFRLSVLPRIGALSNYEVQSDYLRVSSDISPNSNKITIGISESAISQYILNPTP 60

Query: 61  KLVHNLSIPSTSIVTACDVSEIQQNEGDTETQEVWCYALVANKSFTLNTIIKPLTADAP- 119
           KL+ N+SIPST++V+ACDV+ +       + +E+WCY + + KS  LN  +KP+ AD   
Sbjct: 61  KLLSNISIPSTNVVSACDVATL------ADDKEIWCYCVKSGKSHFLNASVKPVDADTVL 114

Query: 120 SVNSTQTFENYKVSIKHKVASVKIFPSRKTIIAVLQNGLVQTFDFQLKLLHSADISYGNI 179
             +     E++K+ +  KV  +KI P  K I+ VL++GL+Q +DFQL+ L S DISY N+
Sbjct: 115 DTDGGDKTEDFKIKMDSKVVGIKIIPDYKAIVVVLESGLIQYYDFQLQKLSSLDISYQNV 174

Query: 180 SLVKYFTNEVLQDFMIVLTDLNDDKVCYKLFEIIHHDS--NVPLKELNSVILEGFSLQNS 237
            +V YF+ E  Q+FM VL+   ++KVC+KLFE+++HD   + P+KEL++ ILE F+L  S
Sbjct: 175 KVVNYFS-ENGQNFMFVLSGFENNKVCFKLFELLYHDGKRHTPIKELSTTILENFNLDQS 233

Query: 238 KTFYQFGKIYTLSNGKISIYSLPHFQLSNTINLPFVTHENV--VSFKPISTNRALLTVDN 295
           K  YQ GK+Y L    I  Y+LP   L  T +LP +   N   VS  P+STNR LLTV+N
Sbjct: 234 KLCYQSGKLYQLEGSTIKTYALPQCHLVQTTHLPMILDPNSQKVSLAPVSTNRILLTVNN 293

Query: 296 RIYLLDLLHNAILSQRELTHVKTFQLLTTAIIPGNTAEN-------NKTIAIGVSTKSDN 348
           ++YLLDL+H+++LS+R LTH KTFQLL +A  P N + +        +T+AIGV+TK+ N
Sbjct: 294 QVYLLDLVHSSVLSERTLTHAKTFQLLRSA--PLNVSSSLKGSEFATRTLAIGVTTKNGN 351

Query: 349 NATSALDIVNINVGSGTLKDSMSKGFLT-QDATEEVLNSLFXXXXXXXXXXGTSQ----F 403
           N TSAL+++N++VG+GTLKDS+ K F +  D+    L  LF            S     F
Sbjct: 352 NPTSALEVINVDVGTGTLKDSLGKSFQSINDSKTHNLQPLFSDDESDAGDNADSDEVVAF 411

Query: 404 DYNQILSELEKAKSKTEKFDNVFFKSLNIKKEYYTEYDRFFNSQGFLDKVLSLIFENFNK 463
            Y  I  EL K      KFD+ F K LNI++E+YT+ +RF   Q FL KV+ LI ++F++
Sbjct: 412 AYEDIFKELSKNNKSISKFDSTFAKRLNIQEEHYTDRERFICDQEFLSKVVRLILDSFDQ 471

Query: 464 EYPRALTYLLTHPLFPAKHATCLLSKFKEHPRLFRQAIVTCPNLPLDALLHELFTVINDE 523
           EYPRALT+LLTHPLFP      LL +F+ HPRLF+QAIVTCPNLPLD LL ELF++ N E
Sbjct: 472 EYPRALTFLLTHPLFPTDCTRGLLERFRNHPRLFKQAIVTCPNLPLDDLLSELFSINNGE 531

Query: 524 LCLDLSLRILQDFTKDSIKQSIKKMSKVDINNFIGFVINEDDDEE-RNKSKPQLFQLLNL 582
           LCLD+SLRILQDFT D IK  +KK++KVD++NF+ F+I+  D+E  +NKS  +LFQLL+L
Sbjct: 532 LCLDISLRILQDFTTDMIKDEVKKLNKVDVHNFVNFLISPKDEELIQNKSTYELFQLLSL 591

Query: 583 VLDSIGLFALDGESLENLHQFIENQVDIVEQNIELLNLLDDXXXXXXXXXXXXXXXXXXX 642
           V+D+IGLFALDG  L+ L  +I+ QV + E+N  L NLL D                   
Sbjct: 592 VIDAIGLFALDGALLQRLSDYIDEQVYLAERNARLWNLL-DTRNKNRGATGSLAGSSRAK 650

Query: 643 EQALPSYSVEYL 654
           EQ LP Y+VEYL
Sbjct: 651 EQTLPKYTVEYL 662

>NCAS0E00830 Chr5 (151952..153967) [2016 bp, 671 aa] {ON} Anc_3.489
           YGR128C
          Length = 671

 Score =  615 bits (1585), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/681 (50%), Positives = 460/681 (67%), Gaps = 39/681 (5%)

Query: 1   MASISQPFRLTALPKIASLNNFSTQTDYLQVAN-TLTPSANKINIGVSGSSISQYIINPT 59
           M S+SQPFRLT LPKIASL+NF+ Q+DY+QV + T +P+ NKI IG+SGSS+SQYI+NPT
Sbjct: 1   MPSLSQPFRLTILPKIASLSNFALQSDYIQVNDSTFSPTTNKITIGISGSSVSQYIVNPT 60

Query: 60  PKLVHNLSIPSTSIVTACDVSEIQQNEGDTETQEVWCYALVANKSFTLNTIIK------- 112
           PKL+ N  IPST+IVTAC+V E    +G +E  E WC+A +ANK+ TLN I K       
Sbjct: 61  PKLIFNFPIPSTNIVTACNVFE---QKGSSE--ETWCFATMANKTSTLNLINKNQYQTNE 115

Query: 113 PLTADAPSVNSTQTFENYKVSIKHKVASVKIFPSRKTIIAVLQNGLVQTFDFQLKLLHSA 172
             + D+   +S+ T E +K+     V  +KI   +K I+ VL+NG +QT+DF+LKLL+S 
Sbjct: 116 EESGDSAPSDSSVTSE-FKIKADDHVVDIKILNKKKIIV-VLKNGKIQTYDFELKLLNSI 173

Query: 173 DISYGNISLVKYFTNEVLQDFMIVLTDLNDDKVCYKLFEIIHH-----DSNVPLKELNSV 227
           +++Y N+  V++F +E  +DFM VL DL +DKVC KLF+I  +     DS +   EL S 
Sbjct: 174 NMAYNNVRFVEHF-HEDGKDFMFVLCDLENDKVCLKLFQINENIETINDSAI---ELTST 229

Query: 228 ILEGFSLQNSKTFYQFGKIYTLSNGKISIYSLPHFQLSNTINLPFVTH----ENVVSFKP 283
           ILE F L+N+K  YQFGK Y L++ KI +YSLP FQ   +I LP +T     E VVSFKP
Sbjct: 230 ILENFPLENAKFCYQFGKFYKLTDDKILVYSLPQFQFQYSITLPMITDLKEGERVVSFKP 289

Query: 284 ISTNRALLTVDNRIYLLDLLHNAILSQRELTHVKTFQLLTTAIIPGNTAENNKTIAIGVS 343
           IS NR LLTV+N+IYLLDL+HN+ILS+RELTH+KTFQLL TA++  N  +N +T+AIGVS
Sbjct: 290 ISPNRILLTVNNKIYLLDLIHNSILSERELTHLKTFQLLKTAVVDTNINQN-RTLAIGVS 348

Query: 344 TKSDNNATSALDIVNINVGSGTLKDSMSKGFLTQDATEEV--LNSLFXXX-XXXXXXXGT 400
           TK  +N TS+L+++N++VG+ T+KDS+ K F T      V  L SLF             
Sbjct: 349 TKFGSNPTSSLELLNVDVGTSTIKDSLGKSFQTSSTENNVQSLKSLFDDENDYSDKKKQV 408

Query: 401 SQFDYNQILSELEKAKSKTEKFDNVFFKSLNIKKEYYTEYDRFFNSQGFLDKVLSLIFEN 460
             F+Y +I  EL  +K+   KFD++FFKS +IKKEYYTE DRF  +  FL +++ LIFE 
Sbjct: 409 KNFNYEKIYKELVDSKNDVTKFDDIFFKSFDIKKEYYTEKDRFIYNHEFLVQIIDLIFET 468

Query: 461 FNKEYPRALTYLLTHPLFPAKHATCLLSKFKEHPRLFRQAIVTCPNLPLDALLHELFTVI 520
           F +EYP+  TYLLT PLFP +    LL++   HPRLF+QAIVTCPNLPL+ LL ELFT+ 
Sbjct: 469 FKEEYPKTFTYLLTDPLFPLERTKGLLARLNNHPRLFKQAIVTCPNLPLNELLAELFTIS 528

Query: 521 NDELCLDLSLRILQDFTKDSIKQSIKKMSKVDINNFIGFVINEDDDEERNKSKPQLFQLL 580
           N EL LD+SLRILQD+T+DSIK+ +KK+ K+++ NFI F+I+E+ D +   + P LFQLL
Sbjct: 529 NGELSLDISLRILQDYTRDSIKKELKKLPKIEVENFIEFIIDEESDIKDTTNAPHLFQLL 588

Query: 581 NLVLDSIGLFALDGESLENLHQFIENQVDIVEQNIELLNLLD-------DXXXXXXXXXX 633
           +LV+DSIGLFALD   LE L ++I+ QV I + N EL +LLD                  
Sbjct: 589 SLVVDSIGLFALDNAVLERLSKYIDEQVAIAQSNTELWHLLDYSNVLAYKNDKFVTSTSK 648

Query: 634 XXXXXXXXXEQALPSYSVEYL 654
                    E+ LP YSVEYL
Sbjct: 649 DSNTSLKLQEEVLPKYSVEYL 669

>Kpol_480.16 s480 (33288..35255) [1968 bp, 655 aa] {ON}
           (33288..35255) [1968 nt, 656 aa]
          Length = 655

 Score =  610 bits (1573), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/658 (49%), Positives = 437/658 (66%), Gaps = 9/658 (1%)

Query: 1   MASISQPFRLTALPKIASLNNFSTQTDYLQVANTLTPSANKINIGVSGSSISQYIINPTP 60
           M S SQPFRL  LPKI SL+N  TQ   LQ+A+  +  +NKI IG+SGS+ISQYIINPTP
Sbjct: 1   MPSFSQPFRLAVLPKILSLSNVETQISSLQIADDFSLESNKITIGISGSTISQYIINPTP 60

Query: 61  KLVHNLSIPSTSIVTACDVSEIQQNEGDTETQEVWCYALVANKSFTLNTIIKPLTADAPS 120
            LV N+ IPST+ VTAC++     ++ D    E W Y L  NK+ TLN  IK    D  +
Sbjct: 61  SLVFNVPIPSTNNVTACNIGHFV-SDTDGSKLECWAYGLSYNKNHTLNISIKTSDDDKYA 119

Query: 121 VNSTQTFENYKVSIKHKVASVKIFPSRKTIIAVLQNGLVQTFDFQLKLLHSADISYGNIS 180
            +  +  E Y      K+  +KI    K I+ VL+NGL+Q +DF LKLL S ++ Y +IS
Sbjct: 120 TSGGEVVETYSQKCDDKIEHIKINEKEKVIVVVLKNGLIQFYDFTLKLLKSVNVMYSDIS 179

Query: 181 LVKYFTNEVLQDFMIVLTDLNDDKVCYKLFEIIHHDSNVPLKELNSVILEGFSLQNSKTF 240
            V++F  +  Q F I+L+++   K+ +KL+E+  +D    + EL+S ILE   L  S+  
Sbjct: 180 FVEHFEEDGKQ-FAIILSNIEGKKISFKLYELFTNDK-TSINELSSTILEDADLGESQIC 237

Query: 241 YQFGKIYTLSNGKISIYSLPHFQLSNTINLPFVTHEN--VVSFKPISTNRALLTVDNRIY 298
           YQFGKIY L   ++ IY+LP  QL  TI LPF+  ++  V+SF PI+ NR LLTV+N+IY
Sbjct: 238 YQFGKIYRLFEDRLYIYNLPQCQLQQTIELPFIQKKDSDVLSFSPIANNRILLTVNNKIY 297

Query: 299 LLDLLHNAILSQRELTHVKTFQLLTTAIIPGNTA-ENNKTIAIGVSTKSDNNATSALDIV 357
           LLDL+HN+IL++R+L+HVK +QLL + ++P     +N+KTIAIGVS K+  +  S+L+++
Sbjct: 298 LLDLVHNSILAERDLSHVKVYQLLKSIVVPSKGENKNSKTIAIGVSIKNGPSPISSLEVI 357

Query: 358 NINVGSGTLKDSMSKGFLTQDATEEV-LNSLFXXXXXXXXXXGTSQFDYNQILSELEKAK 416
           N++VGSGTLKDS+ K F   +  + + L SLF              FDY  IL EL+  K
Sbjct: 358 NVDVGSGTLKDSLGKSFQVANVKKNIPLQSLFPEDETIYAKGEQKSFDYKNILQELQNNK 417

Query: 417 SKTEKFDNVFFKSLNIKKEYYTEYDRFFNSQGFLDKVLSLIFENFNKEYPRALTYLLTHP 476
           +   KFD++FFK LNI KEYYTE DRF   Q FL  VL LIF  F K+YPRALT+LLTHP
Sbjct: 418 NDINKFDDIFFKKLNIMKEYYTEQDRFIYDQKFLSDVLDLIFSAFKKDYPRALTFLLTHP 477

Query: 477 LFPAKHATCLLSKFKEHPRLFRQAIVTCPNLPLDALLHELFTVINDELCLDLSLRILQDF 536
           LFP  H   LL+KF+  PRLF+QA+VTCPNLPL  LL ELFT+ N ELCLD+SLRILQD+
Sbjct: 478 LFPISHTRNLLTKFRNQPRLFKQAVVTCPNLPLKELLAELFTITNGELCLDISLRILQDY 537

Query: 537 TKDSIKQSIKKMSKVDINNFIGFVINEDDDEERNKSKPQLFQLLNLVLDSIGLFALDGES 596
           T+DSIKQ +K +SKVDI NFI FVI + D E++++  PQLFQLL+LVLD+ GLFAL+ E+
Sbjct: 538 TRDSIKQELKTLSKVDIQNFIEFVI-DTDSEDKSQFNPQLFQLLSLVLDASGLFALEEET 596

Query: 597 LENLHQFIENQVDIVEQNIELLNLLDDXXXXXXXXXXXXXXXXXXXEQALPSYSVEYL 654
           LE L  +I+NQV++ E+N  L +LLD+                    ++L +YSVEYL
Sbjct: 597 LEKLSAYIDNQVNVAERNNRLWHLLDENSDKRSTLNQANDQNVLQT-KSLSAYSVEYL 653

>Suva_7.416 Chr7 complement(718089..720230) [2142 bp, 713 aa] {ON}
           YGR128C (REAL)
          Length = 713

 Score =  594 bits (1531), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/713 (49%), Positives = 463/713 (64%), Gaps = 61/713 (8%)

Query: 1   MASISQPFRLTALPKIASLNNFSTQTDYLQVANT-LTPSANKINIGVSGSSISQYIINPT 59
           M S+SQPFRL  LPKIASL+NFS Q DY+QVA+       N I +G+SGSSISQYIINPT
Sbjct: 1   MPSLSQPFRLATLPKIASLSNFSLQADYVQVADGPFNEFTNNITLGISGSSISQYIINPT 60

Query: 60  PKLVHNLSIPSTSIVTACDVSEIQ-QNEGDTETQ------------------EVWCYALV 100
           PKL  +  IPST+I+TAC+  + Q + E DT+                    E+W + L+
Sbjct: 61  PKLTFDYPIPSTNIITACNAVQGQVEIENDTKNSDNDKTDHEVTNFQSKRDVEIWSFGLM 120

Query: 101 ANKS-FTLNTIIKPLTADAPSVNSTQT---------------FENYKVSIKHKVASVKIF 144
            NK  +TLN I K +  +  + N   T                  YK+  K KV ++KI 
Sbjct: 121 VNKGNYTLNVITKAVEDNDDTSNDHLTENGTDKKAYAGTDDILSQYKIKTKDKVMNIKID 180

Query: 145 PSRKTIIAVLQNGLVQTFDFQLKLLHSADISYGNISLVKYFTNEVLQDFMIVLTDLNDDK 204
                +IAVLQNGLV+ +DF+LKLLHS DISYGN+   K+FT E   +F+ VL  L DDK
Sbjct: 181 AKNSLVIAVLQNGLVEFYDFKLKLLHSYDISYGNLKYAKWFT-ENGTEFVFVLCPLEDDK 239

Query: 205 VCYKLFEI--IHHDSNVPLKELNSVILEGFSLQNSKTFYQFGKIYTLSNGKISIYSLPHF 262
           VCYKLFE+       + P+KEL+S I+EGFS ++SK  YQFGK+Y L+ GKI +YSLPH 
Sbjct: 240 VCYKLFELSDFEGKESSPIKELSSTIIEGFSFESSKFCYQFGKLYKLNQGKIHVYSLPHC 299

Query: 263 QLSNTINLPFV---THEN-VVSFKPISTNRALLTVDNRIYLLDLLHNAILSQRELTHVKT 318
           QL   I++P +   T EN ++SF+P+S NR LLTV+N IYLLDLLH +IL+QRELTHV+T
Sbjct: 300 QLQQIIDVPLINKPTSENDLISFQPVSVNRILLTVNNTIYLLDLLHCSILNQRELTHVRT 359

Query: 319 FQLLTTAIIPGNTAENNKTIAIGVSTKSDNNATSALDIVNINVGSGTLKDSMSKGFL--T 376
           FQLL +A+I    ++N+KTIAIG+STK+  N TS+L+I+NI+VG+ TLKDS+ K F    
Sbjct: 360 FQLLRSAVIDSEKSQNSKTIAIGISTKNGPNPTSSLEIINIDVGTNTLKDSLGKSFQIGK 419

Query: 377 QDATEEVLNSLFXXXXXXXXXXGTSQFD---------YNQILSELEKAKSK-TEKFDNVF 426
            D +  VL  LF            +  D         Y++I+ ++   K+     FD++F
Sbjct: 420 NDTSSVVLKPLFDDENVADNMVKRNDIDGNISVPTFQYDEIIKKISALKNNDVASFDDIF 479

Query: 427 FKSLNIKKEYYTEYDRFFNSQGFLDKVLSLIFENFN-KEYPRALTYLLTHPLFPAKHATC 485
           FK L +K+E+YTE DRF +   FL++VL LIFE FN  +YP+ALT+LLTHPLFP      
Sbjct: 480 FKDLKVKEEHYTEKDRFISDSEFLNRVLDLIFEKFNGNDYPKALTFLLTHPLFPLNRTHN 539

Query: 486 LLSKFKEHPRLFRQAIVTCPNLPLDALLHELFTVINDELCLDLSLRILQDFTKDSIKQSI 545
           LLS+ ++ PRLF+QAIVTCPNLPL+ LL ELF++ N EL LD+S RILQDFT+DSIKQ +
Sbjct: 540 LLSRLRDQPRLFKQAIVTCPNLPLNELLEELFSIRNKELLLDISFRILQDFTRDSIKQEM 599

Query: 546 KKMSKVDINNFIGFVINEDDD---EERNKSK-PQLFQLLNLVLDSIGLFALDGESLENLH 601
           K +SK+DI NFI F+ N D+D   E  N S+  QLFQLL+LVLDSIGLF+L+G  L+NL 
Sbjct: 600 KNLSKLDIQNFIDFITNTDEDSTLENLNHSQSSQLFQLLSLVLDSIGLFSLEGALLDNLA 659

Query: 602 QFIENQVDIVEQNIELLNLLDDXXXXXXXXXXXXXXXXXXXEQALPSYSVEYL 654
            +I+ QV+I E+N EL NL+ +                   +QALP+Y++EYL
Sbjct: 660 SYIDKQVEIAERNTELWNLV-ETKGSQHGFTNMNSDSRTSQKQALPTYTMEYL 711

>Smik_6.224 Chr6 complement(365799..367916) [2118 bp, 705 aa] {ON}
           YGR128C (REAL)
          Length = 705

 Score =  589 bits (1519), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/705 (49%), Positives = 455/705 (64%), Gaps = 53/705 (7%)

Query: 1   MASISQPFRLTALPKIASLNNFSTQTDYLQVAN-TLTPSANKINIGVSGSSISQYIINPT 59
           M S+SQPFRL ALPKIASL+NFS Q +Y+QVA+ T   S N I +G+SGSS+SQYIINPT
Sbjct: 1   MPSLSQPFRLAALPKIASLSNFSLQANYVQVADGTFNESTNNITLGISGSSVSQYIINPT 60

Query: 60  PKLVHNLSIPSTSIVTACDVSEIQQNEGDTETQE------------VWCYALVANKS-FT 106
           PKL+ +  IPST+I+TAC+  E Q N  D +  E            +W + L+ NK  +T
Sbjct: 61  PKLIFDYPIPSTNIITACNAGEAQVNIEDKDNNEKVINSQTKRNIEIWSFGLMVNKGNYT 120

Query: 107 LNTIIKPL---------------TADAPSVNSTQTFENYKVSIKHKVASVKIFPSRKTII 151
           LN I K L                 +     S      YK+  K KV S+KI      II
Sbjct: 121 LNVITKVLENTINNTDENLVENKIENNVYTGSEGLLSQYKIKAKAKVMSIKIDTKNNLII 180

Query: 152 AVLQNGLVQTFDFQLKLLHSADISYGNISLVKYFTNEVLQDFMIVLTDLNDDKVCYKLFE 211
           A+LQNGL++ +DF+LKLLHS DISY N+   K+FT   ++ F+ VL  L DDKVCYKL E
Sbjct: 181 AILQNGLIEFYDFKLKLLHSFDISYDNLKYAKWFTENGIE-FIFVLCPLQDDKVCYKLLE 239

Query: 212 IIHHDS--NVPLKELNSVILEGFSLQNSKTFYQFGKIYTLSNGKISIYSLPHFQLSNTIN 269
           +  +++  N P+KEL+S I+EGFS  +SK  YQFGK+Y L+ GKI +YSLPH QL   I 
Sbjct: 240 LTDYENRENSPIKELSSTIIEGFSFDDSKLCYQFGKLYKLNKGKIYVYSLPHCQLQQVIE 299

Query: 270 LPFVTH----ENVVSFKPISTNRALLTVDNRIYLLDLLHNAILSQRELTHVKTFQLLTTA 325
           LP + +     +++SF+P+S NR LLTV+N +YLLDLLH + L QREL+HVKTFQLL TA
Sbjct: 300 LPLINNSDFEHDLISFQPVSVNRVLLTVNNIVYLLDLLHCSTLGQRELSHVKTFQLLNTA 359

Query: 326 IIPGNTAENNKTIAIGVSTKSDNNATSALDIVNINVGSGTLKDSMSKGFLTQDATEEV-L 384
           +I    + ++KTIAIG+STK+  N TS+L+I+NI+VG+ TLKDS+ K F  +     V L
Sbjct: 360 VINSEKSHSSKTIAIGISTKNGANPTSSLEIINIDVGTNTLKDSLGKSFQAEKKDSSVIL 419

Query: 385 NSLFXXXXXXXXXXGTSQFD---------YNQILSELEKAKSK-TEKFDNVFFKSLNIKK 434
             LF            +  D         Y++I+ +L   KS     FD++FFK L IK+
Sbjct: 420 KPLFDDEEVTENMVKRNNIDGDISIPTFQYDEIIVKLSALKSNDITSFDDIFFKDLKIKE 479

Query: 435 EYYTEYDRFFNSQGFLDKVLSLIFENFN-KEYPRALTYLLTHPLFPAKHATCLLSKFKEH 493
           E+YTE DRF +   FL+KVL LIFE FN  +YP+ LT+LLTHPLFP      LLS  ++ 
Sbjct: 480 EHYTEKDRFISDLVFLNKVLDLIFEKFNGNDYPKTLTFLLTHPLFPLDRTRNLLSLLRDQ 539

Query: 494 PRLFRQAIVTCPNLPLDALLHELFTVINDELCLDLSLRILQDFTKDSIKQSIKKMSKVDI 553
           PRLF+QAIVTCPNLPL+ LL ELF++ N EL LD+S RILQDFT+DSIKQ +K++SK+DI
Sbjct: 540 PRLFKQAIVTCPNLPLNELLEELFSIRNKELLLDISFRILQDFTRDSIKQEMKRLSKLDI 599

Query: 554 NNFIGFVINEDDD---EERNKSKP-QLFQLLNLVLDSIGLFALDGESLENLHQFIENQVD 609
            NFI F+ + ++D   E  N S+  QLFQLL+LVLDSIGLF+L+G  LE+L  +I+ QV 
Sbjct: 600 QNFIEFMTSTENDNSLEGFNHSQSTQLFQLLSLVLDSIGLFSLEGALLESLTSYIDKQVK 659

Query: 610 IVEQNIELLNLLDDXXXXXXXXXXXXXXXXXXXEQALPSYSVEYL 654
           I E+N EL NL+ D                   +QALP+Y++EYL
Sbjct: 660 IAERNTELWNLI-DIKSSQHGFTNLAFESASSQKQALPTYTMEYL 703

>YGR128C Chr7 complement(747950..750091) [2142 bp, 713 aa] {ON}
           UTP8Nucleolar protein required for export of tRNAs from
           the nucleus; also copurifies with the small subunit
           (SSU) processome containing the U3 snoRNA that is
           involved in processing of pre-18S rRNA
          Length = 713

 Score =  580 bits (1494), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/713 (48%), Positives = 451/713 (63%), Gaps = 61/713 (8%)

Query: 1   MASISQPFRLTALPKIASLNNFSTQTDYLQVAN-TLTPSANKINIGVSGSSISQYIINPT 59
           M S+SQPFRL  LPKIASL+NFS Q DY+QVA+ T   S N I +G+SGSSISQYIINPT
Sbjct: 1   MPSLSQPFRLATLPKIASLSNFSLQADYVQVADGTFNESTNNITLGISGSSISQYIINPT 60

Query: 60  PKLVHNLSIPSTSIVTACDVSEIQQN-EGDTETQ-------------------EVWCYAL 99
           PKL  +  IPST+I+TAC+  + Q N +G+ E                     E+W + L
Sbjct: 61  PKLTFDYPIPSTNIITACNAEKGQANIDGNIEASTDDEANNEKTINTQKKRNVEIWAFGL 120

Query: 100 VANKS-FTLNTIIKPLTADAPSVN---------------STQTFENYKVSIKHKVASVKI 143
           + NK  +TLN I K L     + N               S +    YK+  K KV S+KI
Sbjct: 121 MVNKGNYTLNVITKALEDTTDTSNDHLSESDIDNKAYTGSDEFLSQYKIKAKAKVMSIKI 180

Query: 144 FPSRKTIIAVLQNGLVQTFDFQLKLLHSADISYGNISLVKYFTNEVLQDFMIVLTDLNDD 203
                 +IA+LQNGL++ FDF+L LLHS DISY N+   K+FT E   +++ VL  L DD
Sbjct: 181 DTKNSLVIAILQNGLIEIFDFKLTLLHSFDISYDNLKYAKWFT-ENGTEYVFVLCPLQDD 239

Query: 204 KVCYKLFEIIHHDSN--VPLKELNSVILEGFSLQNSKTFYQFGKIYTLSNGKISIYSLPH 261
           KVCYKL E+    S    P+KEL+S I+EGFS +NSK  YQFGK+Y L+ GKI IYSLPH
Sbjct: 240 KVCYKLLELTDCGSGESSPIKELSSTIIEGFSFENSKLCYQFGKLYKLNQGKIYIYSLPH 299

Query: 262 FQLSNTINLPFVTH----ENVVSFKPISTNRALLTVDNRIYLLDLLHNAILSQRELTHVK 317
            QL   I  P V      ++++SF+P+S NR LLTV+N IYLLDLLH + LSQRELTHVK
Sbjct: 300 CQLQQVIEFPMVDKLSPGDDLISFQPVSVNRVLLTVNNVIYLLDLLHCSTLSQRELTHVK 359

Query: 318 TFQLLTTAIIPGNTAENNKTIAIGVSTKSDNNATSALDIVNINVGSGTLKDSMSKGF-LT 376
           TFQLL +A+I    + N+KTIAIG+STK+  N TS+L+I+NI+VG+ TLKDS+ K F + 
Sbjct: 360 TFQLLKSAVINSEKSHNSKTIAIGISTKNGPNPTSSLEIINIDVGTNTLKDSLGKSFQVG 419

Query: 377 QDATEEVLNSLFX------XXXXXXXXXGTSQ---FDYNQILSELEKAK-SKTEKFDNVF 426
            + +  +L  LF                G S       N+++ +L   + +    FD++F
Sbjct: 420 NNDSSVILKPLFDDKDINDKRVKCNDVSGDSSVPVLHCNEVIEKLSALQDNDITSFDDIF 479

Query: 427 FKSLNIKKEYYTEYDRFFNSQGFLDKVLSLIFENF-NKEYPRALTYLLTHPLFPAKHATC 485
           FK L IK+E+YTE DR+ +  GFL+KVL LIF  F   +YP+ LT+LLTHPLFP      
Sbjct: 480 FKELKIKEEHYTEKDRYISDPGFLNKVLDLIFGKFSGNDYPKTLTFLLTHPLFPLSRTRN 539

Query: 486 LLSKFKEHPRLFRQAIVTCPNLPLDALLHELFTVINDELCLDLSLRILQDFTKDSIKQSI 545
           LLS  ++ PRLF+QAIVTCPNLPL+ LL ELF++ N EL LD+S RILQDFT+DSIKQ +
Sbjct: 540 LLSLLRDQPRLFKQAIVTCPNLPLNELLEELFSIRNRELLLDISFRILQDFTRDSIKQEM 599

Query: 546 KKMSKVDINNFIGFVINEDDDEERNKSKP----QLFQLLNLVLDSIGLFALDGESLENLH 601
           KK+SK+D+ NFI F+ +  +D       P    QLFQLL+LVLDSIGLF+L+G  LENL 
Sbjct: 600 KKLSKLDVQNFIEFITSGGEDSSPECFNPSQSTQLFQLLSLVLDSIGLFSLEGALLENLT 659

Query: 602 QFIENQVDIVEQNIELLNLLDDXXXXXXXXXXXXXXXXXXXEQALPSYSVEYL 654
            +I+ QV+I E+N EL NL+ D                   ++ALP+Y++EYL
Sbjct: 660 LYIDKQVEIAERNTELWNLI-DTKGFQHGFASSTFDNGTSQKRALPTYTMEYL 711

>Skud_7.439 Chr7 complement(727211..729352) [2142 bp, 713 aa] {ON}
           YGR128C (REAL)
          Length = 713

 Score =  574 bits (1480), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/713 (47%), Positives = 455/713 (63%), Gaps = 61/713 (8%)

Query: 1   MASISQPFRLTALPKIASLNNFSTQTDYLQVAN-TLTPSANKINIGVSGSSISQYIINPT 59
           M S+SQPFRL  LPKIASL+NFS Q DY+QVA+ T   S N I +G+SGSSISQYIINPT
Sbjct: 1   MPSLSQPFRLATLPKIASLSNFSLQADYVQVADGTFNESTNNITLGISGSSISQYIINPT 60

Query: 60  PKLVHNLSIPSTSIVTACDVSEIQQN-----------------EGDTETQ---EVWCYAL 99
           PKL  +  IPST+++TAC  +E+Q N                   +++T+   E+W +  
Sbjct: 61  PKLTFDYPIPSTNVITACSAAEVQVNVEEDLKISNDDSNDEEKAANSQTKRNIEIWSFGS 120

Query: 100 VANKS-FTLNTIIKPLTADAPSVN---------------STQTFENYKVSIKHKVASVKI 143
           + NK  +TLN   K L ++  + N               +      +K+  K KV ++KI
Sbjct: 121 MVNKGNYTLNVTTKMLESNKNTSNEHLVEDSIDSRRHAGADDFLSQHKIKTKAKVMNIKI 180

Query: 144 FPSRKTIIAVLQNGLVQTFDFQLKLLHSADISYGNISLVKYFTNEVLQDFMIVLTDLNDD 203
                 IIAVLQNGL++ +D +LKLL+S DISY N+   K+FT E   DF+ VL  L DD
Sbjct: 181 DAKNSLIIAVLQNGLIEFYDLKLKLLYSFDISYDNLKYAKWFT-ENGTDFVFVLCPLEDD 239

Query: 204 KVCYKLFEIIHHDS--NVPLKELNSVILEGFSLQNSKTFYQFGKIYTLSNGKISIYSLPH 261
           KVCYK+ E+   +S  N P+KEL+S I+EGFS ++SK  YQFGK+Y L+ GKI +YSLPH
Sbjct: 240 KVCYKMLELSDFESKDNSPIKELSSTIIEGFSFESSKLCYQFGKLYKLNQGKIYVYSLPH 299

Query: 262 FQLSNTINLPFV----THENVVSFKPISTNRALLTVDNRIYLLDLLHNAILSQRELTHVK 317
            QL   I LP +    + ++++SF+P+S NR LLTV+N IYLLDLLH +IL+ RELTHVK
Sbjct: 300 CQLQQIIELPLINKSNSEDDLISFQPVSVNRILLTVNNIIYLLDLLHCSILNHRELTHVK 359

Query: 318 TFQLLTTAIIPGNTAENNKTIAIGVSTKSDNNATSALDIVNINVGSGTLKDSMSKGF-LT 376
           TFQLL +A+I    + N+KTIAIG+STK+  N TS+L+I+NI+VG+ TLKDS+ K F + 
Sbjct: 360 TFQLLKSALIDSEKSHNSKTIAIGISTKNGPNPTSSLEIINIDVGTNTLKDSLGKSFQVG 419

Query: 377 QDATEEVLNSLFXXXXXXXXXXGTSQFD---------YNQILSELEKAKSK-TEKFDNVF 426
           ++    +L  LF            +  D         Y++++ +L   K+     FD +F
Sbjct: 420 KNDASVILKPLFDDEDVTNNMVKRNDIDGNINVPIFHYDEVIEKLSVLKNNDIASFDEIF 479

Query: 427 FKSLNIKKEYYTEYDRFFNSQGFLDKVLSLIFENFN-KEYPRALTYLLTHPLFPAKHATC 485
           F  L +K+E+YTE DRF +  GFL+KVL LIF  F   +YP+ALT+LLTHPLFP      
Sbjct: 480 FNDLKVKEEHYTEKDRFISDPGFLNKVLDLIFLKFGGNDYPKALTFLLTHPLFPLNRTHG 539

Query: 486 LLSKFKEHPRLFRQAIVTCPNLPLDALLHELFTVINDELCLDLSLRILQDFTKDSIKQSI 545
           LLS  ++ PRLF+QAIVTCPNLPL+ LL ELF++ N EL LD+S R+LQDFT+DSIKQ +
Sbjct: 540 LLSLLRDQPRLFKQAIVTCPNLPLNELLEELFSIRNRELLLDISFRVLQDFTRDSIKQEM 599

Query: 546 KKMSKVDINNFIGFVINEDDDEE----RNKSKPQLFQLLNLVLDSIGLFALDGESLENLH 601
           KK+SK+DI NFI  + N ++D       +    QLFQLL+LVLDSIGLF+L+G  LENL 
Sbjct: 600 KKLSKLDIQNFIECITNTEEDGPLEGFNHNHSSQLFQLLSLVLDSIGLFSLEGALLENLT 659

Query: 602 QFIENQVDIVEQNIELLNLLDDXXXXXXXXXXXXXXXXXXXEQALPSYSVEYL 654
            +I+ QV I E+N EL NL+ D                   +QALP+Y++EYL
Sbjct: 660 LYIDKQVKIAERNTELWNLI-DIKGSQHGFATLSSGSTTSQKQALPAYAMEYL 711

>TPHA0D04230 Chr4 complement(913504..915462) [1959 bp, 652 aa] {ON}
           Anc_3.489 YGR128C
          Length = 652

 Score =  555 bits (1429), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/659 (46%), Positives = 424/659 (64%), Gaps = 14/659 (2%)

Query: 1   MASISQPFRLTALPKIASLNNFSTQTDYLQVANTLTPSANKINIGVSGSSISQYIINPTP 60
           M S+SQPFRL  LPKIA L++++ Q+  LQVA+  T  +NKI IGVSG ++SQY+INPTP
Sbjct: 1   MPSLSQPFRLAILPKIAVLSDYNVQSKLLQVADDFTLDSNKITIGVSGCAVSQYVINPTP 60

Query: 61  KLVHNLSIPSTSIVTACDVSEIQQNEGDTETQ-EVWCYALVANKSFTLNTIIKPLTADAP 119
            +   + IPST+ VTAC+V+  Q  + DTE   E+W Y L  NK  TL+  IK +  D  
Sbjct: 61  NVSQTVPIPSTNNVTACNVA--QYKDADTEELFEIWVYNLAVNKKNTLHVAIKTVDPDKF 118

Query: 120 SVNSTQTFENYKVSIKHKVASVKIFPSRKTIIAVLQNGLVQTFDFQLKLLHSADISYGNI 179
           S   +   E Y V     V  +KI    KTI+  L NG +Q FDF+LKLL+S + SY NI
Sbjct: 119 STTQSDALETYTVKCDASVVGIKINKEDKTIVVTLGNGFIQIFDFKLKLLNSVNTSYDNI 178

Query: 180 SLVKYFTNEVLQDFMIVLTDLNDDKVCYKLFEIIHHDSNVPLKELNSVILEGFSLQNSKT 239
              ++F  E  + F I+L+ +  +K+ YKL+E+   D    +KEL+S ILE    ++SK 
Sbjct: 179 YFSEHFV-ENKKSFAIILSTIEGNKLSYKLYELFGQDK-TSIKELSSTILEDIQCKDSKI 236

Query: 240 FYQFGKIYTLSNGKISIYSLPHFQLSNTINLPFV--THENVVSFKPISTNRALLTVDNRI 297
            YQFGK+Y L   ++ +YSLP  QL +TI LP +       +SFKP+S NR LLTVDN+I
Sbjct: 237 SYQFGKLYRLYKNQMFVYSLPQCQLVDTITLPQIDLKKSQAISFKPVSNNRILLTVDNKI 296

Query: 298 YLLDLLHNAILSQRELTHVKTFQLLTTAIIPGNTAENN-KTIAIGVSTKSDNNATSALDI 356
           ++LDL+H A L++R L HVK FQLL + +I  N A NN KTIAIGVS K+  +  +AL+I
Sbjct: 297 FILDLVHRATLAERVLGHVKMFQLLKSVVIETNDASNNHKTIAIGVSVKNGPSPITALEI 356

Query: 357 VNINVGSGTLKDSMSKGF-LTQDATEEVLNSLFXXXXXXXXXXGTSQFDYNQILSELEKA 415
           +N NVG+GTLKDS+   F +++     +L  LF              F Y  IL +L   
Sbjct: 357 INANVGTGTLKDSLGNSFDVSKSFKSNILQPLFTDDANLVKR---HDFKYEAILKKLSST 413

Query: 416 KSKTEKFDNVFFKSLNIKKEYYTEYDRFFNSQGFLDKVLSLIFENFNKEYPRALTYLLTH 475
           ++  +KFD++FF  L I++ YYT+ +RF     FL  V+ LIF+NF KEYP ALT+LLTH
Sbjct: 414 ENDIKKFDDIFFGDLYIQQNYYTDNERFIFDVTFLSDVIDLIFKNFQKEYPSALTFLLTH 473

Query: 476 PLFPAKHATCLLSKFKEHPRLFRQAIVTCPNLPLDALLHELFTVINDELCLDLSLRILQD 535
           PLFP      LL K +EHPRLF+QA+VTCPNLP+D LL ELF++ N EL +D+SLRILQD
Sbjct: 474 PLFPIHQTKNLLLKLREHPRLFKQAVVTCPNLPIDELLTELFSITNGELSVDISLRILQD 533

Query: 536 FTKDSIKQSIKKMSKVDINNFIGFVINEDDDEERNKSKPQLFQLLNLVLDSIGLFALDGE 595
           +TKDSIK  +K ++K+DI NFI FVI+ +++EE+ K   QLF LL+LVLD+ GLF+++G 
Sbjct: 534 YTKDSIKLELKNLNKIDIQNFIDFVIDPNNEEEK-KHNEQLFVLLSLVLDASGLFSIEGP 592

Query: 596 SLENLHQFIENQVDIVEQNIELLNLLDDXXXXXXXXXXXXXXXXXXXEQALPSYSVEYL 654
            L  L ++I+ QV+++E++ +L +L+D                     +AL +YSVEYL
Sbjct: 593 LLTQLSEYIDKQVEMIEKSNKLWHLIDGTLGKRNNHYQTSGATVPEI-KALTAYSVEYL 650

>NDAI0G00960 Chr7 (199784..201886) [2103 bp, 700 aa] {ON} Anc_3.489
           YGR128C
          Length = 700

 Score =  551 bits (1421), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/658 (49%), Positives = 438/658 (66%), Gaps = 47/658 (7%)

Query: 1   MASISQPFRLTALPKIASLNNFSTQTDYLQVA-NTLTPSANKINIGVSGSSISQYIINPT 59
           M S+SQPFRLT LPKIASL+N+S Q DY+QV  +T  P+ NK+ IGVSGS+ISQYIINPT
Sbjct: 1   MPSLSQPFRLTVLPKIASLSNYSLQGDYIQVTKSTFNPTTNKVVIGVSGSAISQYIINPT 60

Query: 60  PKLVHNLSIPSTSIVTACDVSEIQQNEGDTETQEVWCYALVANKSFTLNTIIKPLTADAP 119
           PKL+ N  IPST+IVTACDV E   +       EVWC+ LVANK++TL  I K     + 
Sbjct: 61  PKLIFNYPIPSTNIVTACDVLENDND---NTNNEVWCFGLVANKTYTLTLITKDKQKSSA 117

Query: 120 SVNSTQTFENYKVSIKHKVASVKI------------FPSRKTIIAVLQNGLVQTFDFQLK 167
           ++   +   +   +      +VK+                 +I+ VL+NGL+Q F+  LK
Sbjct: 118 TMEDDEDVVDVIDTTIKDEFNVKLDSKIVDIKIIKKKADDISIMIVLENGLIQFFNSSLK 177

Query: 168 LLHSADISYGNISLVKYFTNEVLQDFMIVLTDLNDD-KVCYKLFEIIHHDSNVPLKELNS 226
           LL++  I+Y N+  V++F  E  +DFM  + DL D+ KVC KLF+I ++DS +   ELNS
Sbjct: 178 LLNTVKINYKNVKFVEHF-KEDNKDFMFTICDLGDNNKVCIKLFQI-NNDSAI---ELNS 232

Query: 227 VILEGFSLQNSKTFYQFGKIYTLSNGKISIYSLPHFQLSNTINLPFV-THENVVSFKPIS 285
           +I+E F+ QN+K  YQFGK Y L+N  + +YSLP FQL +T  +P + T + +VS KPIS
Sbjct: 233 IIMENFNGQNAKFCYQFGKFYKLTNNNLMVYSLPQFQLEHTTTIPMIKTDDQIVSMKPIS 292

Query: 286 TNRALLTVDNRIYLLDLLHNAILSQRELTHVKTFQLLTTAIIPGNTAENNKTIAIGVSTK 345
           TNR LLT++N+IYLLDL+HN+ILS+RELTH+K+ QLL +A+I G    NNKTI IGVSTK
Sbjct: 293 TNRILLTINNKIYLLDLIHNSILSERELTHLKSLQLLRSAVI-GKGENNNKTITIGVSTK 351

Query: 346 SDNNATSALDIVNINVGSGTLKDSMSKGFLTQDATEEV------LNSLFXXXXXX----- 394
              N TS+L+I+N++VGS TLKDS+ K F   +   ++      L  LF           
Sbjct: 352 FGVNPTSSLEIINVDVGSNTLKDSLGKCFQNLNLQNQIQISTQALKPLFDPNTDGDKDDD 411

Query: 395 --XXXXGTSQFDYNQILSELEKAKSKTEKFDNVFFKSLNIKKEYYTEYDRFFNSQGFLDK 452
                    QF+Y++IL++L +  +   KFD +FF+S NIKKE+YTE DRF  +  F  K
Sbjct: 412 LFKKLVTKEQFNYDEILTKLSENTNDIGKFDEIFFQSFNIKKEHYTENDRFIYNHEFFLK 471

Query: 453 VLSLIFENFNK--------EYPRALTYLLTHPLFPAKHATCLLSKFKEHPRLFRQAIVTC 504
           ++ LIFE F          EYP+ LT+LLTHPLFP +    LLS+F  HPRLF+QAIVTC
Sbjct: 472 LIDLIFEKFGSTATTAQTNEYPKTLTFLLTHPLFPMERTQSLLSRFANHPRLFKQAIVTC 531

Query: 505 PNLPLDALLHELFTVINDELCLDLSLRILQDFTKDSIKQSIKKMSKVDINNFIGFVINED 564
           PNLPL  LL+EL T+ N+EL LD+SLRILQD++KDSIKQ ++ + +++I NFI F++N++
Sbjct: 532 PNLPLPELLNELLTIKNNELSLDISLRILQDYSKDSIKQELRNLPRLEIENFIDFILNDE 591

Query: 565 DDEERNKSKPQLFQLLNLVLDSIGLFALDGESLENLHQFIENQVDIVEQNIELLNLLD 622
             +++N   PQLFQLL LVLDSIGLFAL    LENL  +I+ QV IVE+N EL  L+D
Sbjct: 592 IKDDQN--SPQLFQLLALVLDSIGLFALSDNILENLSAYIDRQVSIVEKNTELWYLID 647

>TBLA0C04460 Chr3 complement(1080461..1082557) [2097 bp, 698 aa]
           {ON} Anc_3.489 YGR128C
          Length = 698

 Score =  550 bits (1418), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/671 (47%), Positives = 429/671 (63%), Gaps = 55/671 (8%)

Query: 1   MASISQPFRLTALPKIASLNNFSTQTDYLQVA-NTLTPSANKINIGVSGSSISQYIINPT 59
           M S+SQPFRL  LPKIASL+N+S QTDYLQVA +T T   NK+ +G+SGS ISQYIINPT
Sbjct: 1   MPSLSQPFRLAVLPKIASLSNYSLQTDYLQVAPDTFTYDTNKVTLGISGSGISQYIINPT 60

Query: 60  PKLVHNLSIPSTSIVTACDVS---EIQQNEGDTETQ------------------------ 92
           PKL+ N++IPST+ VTA ++S   E  +N   T T                         
Sbjct: 61  PKLLFNIAIPSTNNVTASNISHYIEEVENANSTVTTDKSDLVDKDNMESTEEVSVAENTD 120

Query: 93  ------EVWCYALVANKSFTLNTIIKPLTADAPSVNSTQTFENYKVSIKHKVASVKIFPS 146
                 E+W Y LVANKS TLN  +K    D  S    +      + +  KV ++KIF  
Sbjct: 121 VTKRSVELWAYGLVANKSNTLNISVKTTGLDEFSTTPGEIIRKKTIKVDSKVVNIKIFKE 180

Query: 147 RKTIIAVLQNGLVQTFDFQLKLLHSADISYGNISLVKYFTNEVLQDFMIVLTDLNDDK-- 204
            KTI+ VL+NGLV+ FDF L L  S DI+Y ++  V++FT E  Q+F+++L++++++K  
Sbjct: 181 FKTIVVVLKNGLVKLFDFDLNLKSSLDIAYNDVQFVQHFT-ESKQNFLLILSNIDEEKSS 239

Query: 205 VCYKLFEI-IHHDSNVPLKELNSVILEGFSLQNSKTFYQFGKIYTLSNGKISIYSLPHFQ 263
           VC+KL+++ +  DSN  + EL+  IL+ F L  SK  YQFGK+Y L+  ++ +YSLP  Q
Sbjct: 240 VCFKLYQLRLDSDSN-QVSELSFSILQDFDLSKSKLSYQFGKLYRLTGSELFVYSLPQCQ 298

Query: 264 LSNTINLP--FVTHENVVSFKPISTNRALLTVDNRIYLLDLLHNAILSQRELTHVKTFQL 321
           L   I+L   F    +V S KP++ NR +L ++N +YL+D LH +IL++RE THVKTFQL
Sbjct: 299 LLQNISLAEIFPNTIDVSSIKPVANNRLVLAINNVVYLIDTLHRSILAEREFTHVKTFQL 358

Query: 322 LTTAIIPGNTAENNKTIAIGVSTKSDNNATSALDIVNINVGSGTLKDSMSKGFLTQ--DA 379
           L +A I G++    +TIAIGVSTKS   + SAL+++NI VGSGTLKDS+ KG   +  + 
Sbjct: 359 LQSATI-GDSNITQRTIAIGVSTKSGPTSASALELINIEVGSGTLKDSLGKGVSKKLSEG 417

Query: 380 TEEVLNSLFXXXXXXXXXXGT--------SQFDYNQILSELEKAKSKTEKFDNVFFKSLN 431
           +   L  LF          GT          F++N+IL++L K+      FD  FF+SL 
Sbjct: 418 SHSDLKPLFDENDEKSLI-GTPVHDISNVKSFNFNKILADL-KSSDTISDFDKTFFESLE 475

Query: 432 IKKEYYTEYDRFFNSQGFLDKVLSLIFENFNKEYPRALTYLLTHPLFPAKHATCLLSKFK 491
           IK+ +YTE DRF + Q F+   + LIF+ F+ E+P+A T+LLTHPLFP K    LL K K
Sbjct: 476 IKENHYTENDRFISDQDFIANTIDLIFKKFDTEFPKAFTFLLTHPLFPIKLTVGLLDKLK 535

Query: 492 EHPRLFRQAIVTCPNLPLDALLHELFTVINDELCLDLSLRILQDFTKDSIKQSIKKMSKV 551
           +HPRLF+QAIVTCPNLPL  LL +LFTV N EL LD+SLR+LQD++++ +KQ IKK+  V
Sbjct: 536 DHPRLFKQAIVTCPNLPLSELLFQLFTVKNGELTLDISLRVLQDYSRNDVKQEIKKLDNV 595

Query: 552 DINNFIGFVINEDDDEERNKSKPQLFQLLNLVLDSIGLFALDGESLENLHQFIENQVDIV 611
           DI NFI F+I     EE   + PQLFQLL+LVLDSIGLFAL G  LE L  +I  QV I 
Sbjct: 596 DIENFIEFIITP-TTEEIQTNTPQLFQLLSLVLDSIGLFALKGPLLERLSNYINEQVTIA 654

Query: 612 EQNIELLNLLD 622
           E++ EL +LLD
Sbjct: 655 ERSSELWHLLD 665

>CAGL0I10560g Chr9 (1043862..1045898) [2037 bp, 678 aa] {ON} similar
           to uniprot|P53276 Saccharomyces cerevisiae YGR128c
          Length = 678

 Score =  518 bits (1335), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 297/658 (45%), Positives = 428/658 (65%), Gaps = 48/658 (7%)

Query: 1   MASISQPFRLTALPKIASLNNFSTQTDYLQVANTLTPSANKINIGVSGSSISQYIINPTP 60
           M S+SQPFRL  LPKIASL+NFS +  Y++VA++ TP +N + +G+SGSSIS+Y+I PTP
Sbjct: 1   MPSLSQPFRLAVLPKIASLHNFSQKKTYIKVADSFTPDSNSVLLGISGSSISKYVITPTP 60

Query: 61  KLVHNLSIPSTSIVTACD---------VSEIQQNEGDTETQ---------------EVWC 96
           +L+ N+ IPST +V+AC+         VS   Q   D  T                E+WC
Sbjct: 61  RLIFNVPIPSTHLVSACNMGTYSETSTVSSDPQATADETTDTAPTSTNTVEETKHYEIWC 120

Query: 97  YALVAN-KSFTLNTIIKPLTADAPSVNSTQTFENYKVSIKHKVASVKIFPSRKTIIAVLQ 155
           YAL AN K+ TLN +I+ +  +  S+  T+    +    K ++ ++++    K I+ + +
Sbjct: 121 YALSANNKTHTLNCLIREVDNNNTSI--TENNPQFNAKFKEQIINIEVDTKHKVIVILFE 178

Query: 156 NGLVQTFDFQLKLLHSADISYGNISLVKYFTNEVLQDFMIVLTDLNDDKVCYKLFEIIHH 215
            GLVQ +D QLKLL+S +  Y +I +VK F    L+ +M++++DL D KV  +L+E+   
Sbjct: 179 TGLVQFYDLQLKLLNSINTPYRDIKIVKTFEENGLE-YMLLISDLKDQKVALQLYEVSTE 237

Query: 216 DSNVPLKELNSVILEGFSLQNSKTFYQFGKIYTLSNGKISIYSLPHFQLSNTINLPFVTH 275
           +  V  KEL S I+E F+LQ+S   YQFG+IY L   +I +YS+P  QL++ + +PF++ 
Sbjct: 238 EKKV--KELTSSIIENFNLQDSLLCYQFGRIYRLFKDEIEVYSIPSLQLNSKVKIPFLSE 295

Query: 276 ----ENVVSFKPISTNRALLTVDNRIYLLDLLHNAILSQRELTHVKTFQLLTTAIIPGNT 331
                 ++S KPI+TNR LLTV N+IYLLDLLH +ILS+RE++H+KTFQ+L TA+   + 
Sbjct: 296 IEDKNCLISLKPIATNRVLLTVKNKIYLLDLLHKSILSEREVSHMKTFQILKTAM-NRDG 354

Query: 332 AENNKTIAIGVSTKSDNNATSALDIVNINVGSGTLKDSMSKGFLTQD-ATEEVLNSLFXX 390
           +E+  T+A+G+STK+  N TSAL+I+NI+VGS +LKDS+ K FL ++   +  L +LF  
Sbjct: 355 SESKLTLALGISTKNGQNPTSALEIINIDVGSNSLKDSLGKSFLRRNNQIQGQLKNLFPE 414

Query: 391 XXXXXXXXGTSQFDYNQILSELEKAKSKTEKFDNVFFKSLNIKKEYYTEYDRFFNSQGFL 450
                        ++ +IL +L+ A S  EKFD  FF  LNIK+E +TE  RF N Q FL
Sbjct: 415 PKYEL-----PSINFPEILGKLKNANS-AEKFDETFFNLLNIKEEMFTENSRFLNDQRFL 468

Query: 451 DKVLSLIFE--NFNKEYPRALTYLLTHPLFPAKHATCLLSKFKEHPRLFRQAIVTCPNLP 508
             VL LIF   ++NK  PR+L +LLTHPLFP + A  LL+K K + RLF+QAIVTCPNLP
Sbjct: 469 ASVLDLIFTKIDYNKSCPRSLMFLLTHPLFPKEKAIGLLTKVKSNSRLFKQAIVTCPNLP 528

Query: 509 LDALLHELFTVINDELCLDLSLRILQDFTKDSIKQSIKKMSKVDINNFIGFVINEDDDEE 568
           L  LL ELFT+ N EL +D+S+RILQD+TKD+IK+ IKK+ +V + NF+ F+I  ++ E 
Sbjct: 529 LQELLQELFTIKNSELVVDISMRILQDYTKDAIKEEIKKLDQVSVENFMNFIIKMNNREA 588

Query: 569 RNKS----KPQLFQLLNLVLDSIGLFALDGESLENLHQFIENQVDIVEQNIELLNLLD 622
                    PQ+F+LL+L+LDSIGLF L+   L  L   IE +V I E+N+EL N++D
Sbjct: 589 AVSDFTMFTPQIFKLLSLILDSIGLFGLEESILIQLSSIIEKEVKIAERNVELWNIMD 646

>Kwal_55.21222 s55 complement(736354..737475) [1122 bp, 373 aa] {ON}
           YGR128C (UTP8) - Protein required for cell viability
           [contig 131] PARTIAL
          Length = 373

 Score =  448 bits (1153), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 230/376 (61%), Positives = 279/376 (74%), Gaps = 5/376 (1%)

Query: 279 VSFKPISTNRALLTVDNRIYLLDLLHNAILSQRELTHVKTFQLLTTAIIPGNTAENNKTI 338
           +SF PIS NRALLT DN++YLLDLLHNAILSQRE THVKTFQLL TA+IPGN++ NN TI
Sbjct: 1   MSFGPISINRALLTCDNKVYLLDLLHNAILSQREFTHVKTFQLLGTAVIPGNSSSNNSTI 60

Query: 339 AIGVSTKSDNNATSALDIVNINVGSGTLKDSMSKGFLTQDATEEVLNSLFXXXXXXXXXX 398
           AIGV+TK  N +TS+LD+VNI+VG+GTLKDSM KGFL+     +   SL           
Sbjct: 61  AIGVATKPGNTSTSSLDVVNIDVGTGTLKDSMGKGFLSSKTKVQCPQSLLGTPNDTE--- 117

Query: 399 GTSQFDYNQILSELEKAKSKTEKFDNVFFKSLNIKKEYYTEYDRFFNSQGFLDKVLSLIF 458
              + +Y QIL +L K KS ++KFD+VFFK LNIK +YYT+ DRF N Q FL   L LIF
Sbjct: 118 -VQEHNYTQILKDLAKTKSNSDKFDSVFFKKLNIKNDYYTDSDRFLNDQEFLGNSLKLIF 176

Query: 459 ENFNKEYPRALTYLLTHPLFPAKHATCLLSKFKEHPRLFRQAIVTCPNLPLDALLHELFT 518
           ENF  EYP+ALTYLLTHPLFP      LL K K+HPRLF+QAIVTCPNLPL  LL ELFT
Sbjct: 177 ENFQSEYPKALTYLLTHPLFPITCTHDLLQKLKDHPRLFKQAIVTCPNLPLSDLLQELFT 236

Query: 519 VINDELCLDLSLRILQDFTKDSIKQSIKKMSKVDINNFIGFVINEDDDEERNKSKPQLFQ 578
           VINDELCLDLSLRILQDF+KDSIK +IK+ SKVD+N FI FV+NE+ DE+R K+KP+LFQ
Sbjct: 237 VINDELCLDLSLRILQDFSKDSIKNAIKQRSKVDVNCFINFVMNENVDEDRVKNKPRLFQ 296

Query: 579 LLNLVLDSIGLFALDGESLENLHQFIENQVDIVEQNIELLNLLDDXXXXXXXXXXXXXXX 638
           LLNLVLDS+GLFAL+ E+L+ L  +I+ Q+ +V+QN++L NL+D+               
Sbjct: 297 LLNLVLDSVGLFALEDEALDKLSNYIDRQLSVVKQNVQLYNLVDE-RNFKNILGQHHADS 355

Query: 639 XXXXEQALPSYSVEYL 654
               E A+ +YSVE L
Sbjct: 356 LSVGEGAITAYSVEQL 371

>KNAG0B00830 Chr2 (151939..153762) [1824 bp, 607 aa] {ON} Anc_3.489
           YGR128C
          Length = 607

 Score =  342 bits (876), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 249/673 (36%), Positives = 342/673 (50%), Gaps = 90/673 (13%)

Query: 2   ASISQPFRLTALPKIASLNNFSTQTDYLQVANTLTPSANKINIGVSGSSISQYIINPTPK 61
           ASISQPF +  +P+ AS      QT  L   ++LT +AN +++ VS  SISQYIINPTPK
Sbjct: 3   ASISQPFTIANVPRQAS------QTKVLISQHSLTSNANTLDVAVSKYSISQYIINPTPK 56

Query: 62  LVHNLSIPSTSIVTACDVSEIQQNEGDTETQEVWCYALVANKSFTLNTIIKPLTADAPSV 121
           LV++ +IPS   VTA D        G   TQ         NKSF L              
Sbjct: 57  LVNSKAIPSNLTVTAFD-------NGVYATQS-------NNKSFCL-------------- 88

Query: 122 NSTQTFENYKVSIKHKVA---SVKIFPSRKTIIAVLQNGLVQTFDFQLKLLHSADISYGN 178
                 E++++ +K  V    S KI        A+LQ+G VQ                  
Sbjct: 89  ---YLDESHQIPLKSAVVNCLSEKIHDESVVTTAILQDGTVQ------------------ 127

Query: 179 ISLVKYFTNEVLQDFMIVLTDLNDDKVCYKLFEIIHHDSNVPLKELNSVILEGFSLQNSK 238
               KY   E +    + L D+   +     + +I    +  L EL +  L    +  + 
Sbjct: 128 ----KYKGGEQVFAKHLPLKDIKQVEFIDGQYALIVAAQSTALYELEN--LTELRVSTTL 181

Query: 239 TFYQF-------GKIYT--LSNGKISIYSLPHFQLSNTINLPFVTHEN--VVSFKPISTN 287
            F QF       GKIY   L+     I+ L        +N+PF++      ++F  +  +
Sbjct: 182 HFEQFKQIRQHLGKIYQFDLATNDFKIFELTTLNEIGVVNIPFLSASKGAPLTFTVVGDS 241

Query: 288 RALLTVDNRIYLLDLLHNAILSQRELTHVKTFQLLTTAIIPGNTAENNKTIAIGVSTKSD 347
           R  L + N IYLLDL   ++LS  +   +K  +L+  A         + + AI +S    
Sbjct: 242 RVCLALANEIYLLDLHLGSVLSHNKFAQLKQVELIAGA--------RDGSFAIALSHGPQ 293

Query: 348 NNATSALDIVNINVGSGTLKDSMSKGFLTQDATEEVLNSLFXXXXXXXXXXGTSQ-FDYN 406
           +NA S LDI+N+ +GS ++KDS+ KGF T         S             T + FDY 
Sbjct: 294 DNAVS-LDIINLELGSRSIKDSLGKGFATFMKERRSAESQVTLRPILDAGDKTKRSFDYA 352

Query: 407 QILSELEKAKSKTEKFDNVFFKSLNIKKEYYTEYDRFFNSQGFLDKVLSLIFENFNKE-- 464
            IL +L  A     KFD +FFK L I +E YTE DRF   Q FL + + +I +N++ E  
Sbjct: 353 SILKKLTAAAKDPAKFDQIFFKELYIVQECYTEGDRFIIDQNFLSETVGVILKNYSFEPS 412

Query: 465 --YPRALTYLLTHPLFPAKHATCLLSKFKEHPRLFRQAIVTCPNLPLDALLHELFTVIND 522
             YP A TYLLTHPLFPA     LLSK K+ PRL++Q IVTCPNLPLD LL E F + N+
Sbjct: 413 SKYPAAFTYLLTHPLFPADKTRHLLSKVKQIPRLYKQVIVTCPNLPLDELLTESFVIENN 472

Query: 523 ELCLDLSLRILQDFTKDSIKQSIKKMSKVDINNFIGFVI-NEDDDEERNKSKPQLFQLLN 581
           EL LDLSL+ILQD+TKDSIK+ +K + +V++ NFI FVI N ++ +E + + PQLFQLL+
Sbjct: 473 ELSLDLSLKILQDYTKDSIKKEMKALPRVNVTNFIKFVIGNYNNSDESSVATPQLFQLLS 532

Query: 582 LVLDSIGLFALDGESLENLHQFIENQVDIVEQNIELLNLLDDXXXXXXXXXXXXXXXXXX 641
           LV+DSIGLFALDGE L  L  +I+N V I E N EL NLL+                   
Sbjct: 533 LVIDSIGLFALDGELLTELAGYIDNMVKIAEMNTELWNLLEFRTNKASVAGSNRSKYVKT 592

Query: 642 XEQALPSYSVEYL 654
            ++  P Y V++L
Sbjct: 593 QKKVFPPYLVDHL 605

>KAFR0C01940 Chr3 complement(387789..389618) [1830 bp, 609 aa] {ON}
           Anc_3.489 YGR128C
          Length = 609

 Score =  320 bits (821), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 232/680 (34%), Positives = 360/680 (52%), Gaps = 99/680 (14%)

Query: 1   MASISQPFRLTALPKIASLNNFSTQTDYLQVANTLTPSANKINIGVSGSSISQYIINPTP 60
           M SISQPF +T +PK +S       +  +  +++LT ++N +++ +S  ++S+++INPTP
Sbjct: 1   MPSISQPFAITTVPKQSS------TSPIIVSSHSLTANSNSLDVAISKYAVSKFVINPTP 54

Query: 61  KLVHNLSIPSTSIVTACDVSEIQQNEGDTETQEVWCYALVANKSFTLNTIIKPLTADAPS 120
           KL++++ IPS  +VTA           DT    V+  A V N+ +TL+            
Sbjct: 55  KLINSIPIPSNEVVTAF---------HDT----VFATATV-NQKYTLH------------ 88

Query: 121 VNSTQTFENYKVSIKHKVASVKIFPSRKTIIAVLQNGLVQTFDFQL--KLLHSADISYGN 178
                     KV I+ K+  +K+F      I +L+NG ++ +D  L      +      N
Sbjct: 89  ------LNGKKVPIQSKI--MKLFSDESQTITILENGTIEKYDSNLIKSTYKTPHKDLVN 140

Query: 179 ISLVKYFTNEVLQDFMIVLTDLNDDKVCYKLFEIIHHDSNVPLKELNSVILEGFSLQNSK 238
           +  ++     ++    I L D+N       + E+ +      +  +  ++   F   + K
Sbjct: 141 VEFIESKYALLISQNSISLYDIN------TMIELRN------VANVQDIVDSDFKSLDGK 188

Query: 239 TFYQFGKIYTLSNGKISIYSLPHFQLSNTINLPFV--THENVVSFKPISTNRALLTVDNR 296
             YQF +  +    K  I+ +    + N I +PF+    ++VVSF  +  N  ++ V++ 
Sbjct: 189 -LYQFNQKLS----KFDIWEISSMTIVNIITIPFINDVEKDVVSFTVVDDNCVVMAVNST 243

Query: 297 IYLLDLLHNAILSQRELTHVKTFQLLTTAIIPGNTAENNKTIAIGVSTKSDNNATSALDI 356
           IY L+L  ++++S  EL ++K F+L+            +    +G+S    NN     ++
Sbjct: 244 IYALNLHLSSVISMSELLNLKWFKLIDNL---------SNQFVLGLSF---NNENYKFEL 291

Query: 357 VNINVGSG-TLKDSMSKGF---LTQDATEE---VLNSLFXXXXXXXXXXGTSQ------F 403
           +N+++ S   LKDS+ KGF   L    +E+   VL SLF            S       F
Sbjct: 292 INLDLNSNFGLKDSLGKGFRNFLVDKQSEKETLVLKSLFSADEADEDLHNDSDSDVEHTF 351

Query: 404 DYNQILSELEKAKSKTEKFDNVFFKSLNIKKEYYTEYDRFFNSQGFLDKVLSLIFENF-- 461
           +Y++I+ +L KA     KFD +FF+  NIKKE+YTE DRF  +Q FL KV+ LI +N+  
Sbjct: 352 NYDKIIVDLNKAVKNPSKFDKIFFEKFNIKKEHYTEADRFLVNQDFLAKVIELILQNYKF 411

Query: 462 ---NKEYPRALTYLLTHPLFPAKHATCLLSKFKEHPRLFRQAIVTCPNLPLDALLHELFT 518
                 YP+ LTYLLTHPLFP      LL KF+E PRL++QAIVTCPNLPL  LL +LFT
Sbjct: 412 DTDGNNYPKTLTYLLTHPLFPVSLTKNLLPKFRESPRLYKQAIVTCPNLPLGELLADLFT 471

Query: 519 VINDELCLDLSLRILQDFTKDSIKQSIKKMSKVDINNFIGFVINEDDDEERNKSKPQLFQ 578
           + N+EL LD+SLR+LQD+TKDSIK+ IK + KVDI NFI FV  ++D +  +    QLFQ
Sbjct: 472 IENNELSLDISLRVLQDYTKDSIKEQIKLLPKVDIRNFIEFVTQDEDQQVSS----QLFQ 527

Query: 579 LLNLVLDSIGLFALDGESLENLHQFIENQVDIVEQNIELLNLLD----DXXXXXXXXXXX 634
           LL+L++DSIGLFALD + L  +  FI  +  + +QN ELL+LLD                
Sbjct: 528 LLSLIIDSIGLFALDMDILGRISNFINEKTLVAKQNSELLHLLDYNPSKQSSARQSSKLI 587

Query: 635 XXXXXXXXEQALPSYSVEYL 654
                    + LP+Y+VE+L
Sbjct: 588 NNNNKSLHRKTLPTYTVEHL 607

>Kwal_55.21225 s55 complement(737726..738370) [645 bp, 215 aa] {OFF}
           YGR128C (UTP8) - Protein required for cell viability
           [contig 130] PARTIAL
          Length = 215

 Score =  254 bits (648), Expect = 5e-80,   Method: Compositional matrix adjust.
 Identities = 119/213 (55%), Positives = 165/213 (77%), Gaps = 2/213 (0%)

Query: 1   MASISQPFRLTALPKIASLNNFSTQTDYLQVANTLTPSANKINIGVSGSSISQYIINPTP 60
           M SISQPFRLTALPKIASLNN++TQ  YLQVA+TLTP+ N++N+G+SGS+ISQY+INPTP
Sbjct: 1   MPSISQPFRLTALPKIASLNNYATQGSYLQVADTLTPATNRVNVGISGSAISQYVINPTP 60

Query: 61  KLVHNLSIPSTSIVTACDVSEIQ--QNEGDTETQEVWCYALVANKSFTLNTIIKPLTADA 118
           KLV+NL I ST++VTACDV+E+    NEG  E  EV CYAL ANK+F++  + KP+ + A
Sbjct: 61  KLVYNLPISSTNVVTACDVAEVAGTNNEGTAEAHEVLCYALQANKTFSICAVKKPIPSAA 120

Query: 119 PSVNSTQTFENYKVSIKHKVASVKIFPSRKTIIAVLQNGLVQTFDFQLKLLHSADISYGN 178
              +  +T+  +KV++ ++  +VK+FP+ K+I+AVL +GL+Q FD+ LKL HS D SYGN
Sbjct: 121 TDSSFGETYATHKVALANQAVNVKVFPATKSIVAVLSSGLIQFFDYDLKLQHSIDSSYGN 180

Query: 179 ISLVKYFTNEVLQDFMIVLTDLNDDKVCYKLFE 211
           +  V++F +E  QDFM +L+DL+  KV +KL +
Sbjct: 181 VQFVQHFVSESKQDFMFLLSDLDGRKVSFKLLK 213

>Ecym_6036 Chr6 (65515..71817) [6303 bp, 2100 aa] {ON} similar to
           Ashbya gossypii ABR112C
          Length = 2100

 Score = 34.3 bits (77), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 52/107 (48%), Gaps = 15/107 (14%)

Query: 482 HATCLLSKF-KEHPRLFRQAIVTCPNLPLDALLHELFTVINDELCLDLSLRILQDFTKDS 540
           HA    +KF KE+P    +A+ T   L    +L +L         LD++ +I+ DF K+ 
Sbjct: 635 HAVIAETKFFKEYPL---EALATTSVLFGSMILFDLLR----GFVLDVAFKIIADFAKEG 687

Query: 541 IKQSIKKMS-------KVDINNFIGFVINEDDDEERNKSKPQLFQLL 580
            +  + K S       ++ ++ F  F  +  DD    +S+PQ+FQ+L
Sbjct: 688 PESKMFKFSVQALYAFRIRLHEFPSFCKSLVDDIPSLQSQPQIFQIL 734

>TPHA0D02970 Chr4 complement(619854..620480) [627 bp, 208 aa] {ON}
          Anc_3.439
          Length = 208

 Score = 31.6 bits (70), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 31/58 (53%), Gaps = 2/58 (3%)

Query: 18 SLNNFSTQTDYLQVANTLTPSANKINIGVSGSSISQYIINPTPKLVHNLSIPS-TSIV 74
          ++   +TQ   L +AN +    ++   G+  SS++   + P PKL  NL +PS TSI 
Sbjct: 27 TMRKMATQVMLLSIANPIGSPKSEFR-GLVASSVTSLCVLPKPKLEFNLQLPSFTSIA 83

>Kpol_1001.28 s1001
           (78022..78294,78298..78306,78310..78405,78409..78426,
           78428..78454,78458..78526,78529..79167) [1131 bp, 376
           aa] {ON}
           (78022..78294,78298..78306,78310..78405,78409..78426,
           78428..78454,78458..78526,78529..79167) [1131 nt, 377
           aa]
          Length = 376

 Score = 32.0 bits (71), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 36/131 (27%), Positives = 62/131 (47%), Gaps = 18/131 (13%)

Query: 240 FYQFGKIYTLSNGKISIYSLPHFQLSNTINLPFVTHENVVSFKPISTNRALLTVDNRIYL 299
           F++F     L N +IS  S   FQ+ N +   F+THE +VS +  S    +L+    I  
Sbjct: 185 FWKFFTFARLGNFEISTES---FQILNAL---FITHEKLVSKEFFSQESNMLSFIQNINK 238

Query: 300 LDLLHNAILSQRELTHVKTF--------QLLTTAIIPGNTAENNKTIAIGVSTKSDNNAT 351
           L + H   +++R+ T + +         QL++T I   N+ EN K I   ++ KS N   
Sbjct: 239 L-MAHGNYVTKRQSTKLISSLIIIRSNNQLMSTYI---NSPENLKLIMTLMTDKSKNLQI 294

Query: 352 SALDIVNINVG 362
            A ++  + + 
Sbjct: 295 EAFNVFKVVIA 305

>NCAS0I02540 Chr9 (475302..478064) [2763 bp, 920 aa] {ON} Anc_3.86
           YDR495C
          Length = 920

 Score = 32.0 bits (71), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 32/57 (56%), Gaps = 1/57 (1%)

Query: 170 HSADISYGNISLVKYFTNEVLQDFMIVLTDLNDDKVCYKLFEIIHHDSNVPLKELNS 226
           H  DIS G I L KY T E+   +  +LT+ +  KV       I+ DSN+P++ ++S
Sbjct: 251 HKGDISQGTIVLDKYPT-EIAVQYPYILTNYDGSKVQVNKLLNINDDSNLPIQTISS 306

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.134    0.373 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 68,146,885
Number of extensions: 3160445
Number of successful extensions: 13401
Number of sequences better than 10.0: 72
Number of HSP's gapped: 13862
Number of HSP's successfully gapped: 75
Length of query: 654
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 538
Effective length of database: 40,180,143
Effective search space: 21616916934
Effective search space used: 21616916934
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)