Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0F02816g3.490ON1921928331e-114
Ecym_12393.490ON1931943155e-36
KLTH0F14784g3.490ON1951793131e-35
Kwal_55.212263.490ON1961972956e-33
TDEL0D055803.490ON1931932861e-31
AFR308W3.490ON1921722842e-31
ZYRO0D10032g3.490ON2091792662e-28
Kpol_480.153.490ON2071802313e-23
Suva_7.4173.490ON2122082174e-21
TBLA0C044703.490ON2221802166e-21
NCAS0E008203.490ON2021842156e-21
Skud_7.4403.490ON2131962088e-20
KLLA0E04643g3.490ON2211752062e-19
CAGL0I10538g3.490ON2001741991e-18
YGR129W (SYF2)3.490ON2151991964e-18
NDAI0G009503.490ON2131901879e-17
Smik_6.2253.490ON2131931816e-16
TPHA0D042403.490ON2091701528e-12
KNAG0B008203.490ON2071541151e-06
KAFR0C019503.490ON157154900.002
TDEL0C009608.68ON122277691.8
NCAS0A094601.272ON87932682.3
YML071C (COG8)4.339ON60795672.6
Skud_13.714.339ON53991654.7
SAKL0F08162g7.221ON33038646.2
TPHA0P016802.26ON60290638.2
Suva_4.3213.307ON138274639.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0F02816g
         (192 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0F02816g Chr6 complement(239471..240049) [579 bp, 192 aa] {O...   325   e-114
Ecym_1239 Chr1 complement(491113..491694) [582 bp, 193 aa] {ON} ...   125   5e-36
KLTH0F14784g Chr6 (1211778..1212365) [588 bp, 195 aa] {ON} weakl...   125   1e-35
Kwal_55.21226 s55 (738730..739320) [591 bp, 196 aa] {ON} YGR129W...   118   6e-33
TDEL0D05580 Chr4 (1007529..1008110) [582 bp, 193 aa] {ON} Anc_3....   114   1e-31
AFR308W Chr6 (999495..1000073) [579 bp, 192 aa] {ON} Syntenic ho...   114   2e-31
ZYRO0D10032g Chr4 complement(847175..847804) [630 bp, 209 aa] {O...   107   2e-28
Kpol_480.15 s480 complement(32143..32766) [624 bp, 207 aa] {ON} ...    94   3e-23
Suva_7.417 Chr7 (720529..721167) [639 bp, 212 aa] {ON} YGR129W (...    88   4e-21
TBLA0C04470 Chr3 (1082932..1083600) [669 bp, 222 aa] {ON} Anc_3....    88   6e-21
NCAS0E00820 Chr5 complement(151102..151710) [609 bp, 202 aa] {ON...    87   6e-21
Skud_7.440 Chr7 (729641..730282) [642 bp, 213 aa] {ON} YGR129W (...    85   8e-20
KLLA0E04643g Chr5 complement(413277..413942) [666 bp, 221 aa] {O...    84   2e-19
CAGL0I10538g Chr9 complement(1042601..1043203) [603 bp, 200 aa] ...    81   1e-18
YGR129W Chr7 (750400..751047) [648 bp, 215 aa] {ON}  SYF2Member ...    80   4e-18
NDAI0G00950 Chr7 complement(198741..199382) [642 bp, 213 aa] {ON...    77   9e-17
Smik_6.225 Chr6 (368227..368868) [642 bp, 213 aa] {ON} YGR129W (...    74   6e-16
TPHA0D04240 Chr4 (916281..916910) [630 bp, 209 aa] {ON} Anc_3.49...    63   8e-12
KNAG0B00820 Chr2 complement(151197..151820) [624 bp, 207 aa] {ON...    49   1e-06
KAFR0C01950 Chr3 (390143..390616) [474 bp, 157 aa] {ON} Anc_3.49...    39   0.002
TDEL0C00960 Chr3 (153572..157240) [3669 bp, 1222 aa] {ON} Anc_8....    31   1.8  
NCAS0A09460 Chr1 (1880409..1883048) [2640 bp, 879 aa] {ON} Anc_1...    31   2.3  
YML071C Chr13 complement(129749..131572) [1824 bp, 607 aa] {ON} ...    30   2.6  
Skud_13.71 Chr13 complement(127930..129549) [1620 bp, 539 aa] {O...    30   4.7  
SAKL0F08162g Chr6 complement(622302..623294) [993 bp, 330 aa] {O...    29   6.2  
TPHA0P01680 Chr16 complement(350606..352414) [1809 bp, 602 aa] {...    29   8.2  
Suva_4.321 Chr4 complement(568645..572793) [4149 bp, 1382 aa] {O...    29   9.6  

>SAKL0F02816g Chr6 complement(239471..240049) [579 bp, 192 aa] {ON}
           weakly similar to uniprot|P53277 Saccharomyces
           cerevisiae YGR129W SYF2 SYnthetic lethal with cdcForty
           (putative) involved in pre-mRNA splicing
          Length = 192

 Score =  325 bits (833), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 168/192 (87%), Positives = 168/192 (87%)

Query: 1   MDLTDXXXXXXXXXXXXVDVSVKNRXXXXXXXXXXXXSGKPKVYSMNEDETFKDQKEEDT 60
           MDLTD            VDVSVKNR            SGKPKVYSMNEDETFKDQKEEDT
Sbjct: 1   MDLTDLLGKLKYLKRKGVDVSVKNRKEAEKEEKQAKQSGKPKVYSMNEDETFKDQKEEDT 60

Query: 61  RGKLLNYSIKDYEKWQLKRTAKLKNSDGSSQQDLAKYTYDKEIREMEKDGSLNRGKVTKA 120
           RGKLLNYSIKDYEKWQLKRTAKLKNSDGSSQQDLAKYTYDKEIREMEKDGSLNRGKVTKA
Sbjct: 61  RGKLLNYSIKDYEKWQLKRTAKLKNSDGSSQQDLAKYTYDKEIREMEKDGSLNRGKVTKA 120

Query: 121 RLNGKGRIQINDDKKSLEQLADNLNKSTKRRYIERKKQAEKLDSSTTGGFINDKNKQFNE 180
           RLNGKGRIQINDDKKSLEQLADNLNKSTKRRYIERKKQAEKLDSSTTGGFINDKNKQFNE
Sbjct: 121 RLNGKGRIQINDDKKSLEQLADNLNKSTKRRYIERKKQAEKLDSSTTGGFINDKNKQFNE 180

Query: 181 KLSRQFKQFDDN 192
           KLSRQFKQFDDN
Sbjct: 181 KLSRQFKQFDDN 192

>Ecym_1239 Chr1 complement(491113..491694) [582 bp, 193 aa] {ON}
           similar to Ashbya gossypii AFR308W
          Length = 193

 Score =  125 bits (315), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 74/194 (38%), Positives = 113/194 (58%), Gaps = 8/194 (4%)

Query: 1   MDLTDXXXXXXXXXXXXVDVSVKNRXXXXXXXXXXXXSGKPKVYSMNEDETFKDQKEEDT 60
           MD+ D            VD+S+KNR              KP+VYS+N++    ++ +  +
Sbjct: 1   MDIDDISSRLRRLKSKRVDISIKNRKEIVSEEVLQVGRSKPEVYSINDEGAAVNEVQSTS 60

Query: 61  ---RGKLLNYSIKDYEKWQLKRTAKLKNSDGSSQQDLAKYTYDKEIREMEKDGSLNRGKV 117
              R KLLNYS+ DYEKW  K   K  N DG+   D+A  TY  EI+++ K G L +GK+
Sbjct: 61  NTERRKLLNYSLIDYEKWDEKE--KQANFDGTYSGDIAYSTYKNEIKQLRK-GGLTKGKI 117

Query: 118 TKARLNGKGRIQINDDKKSLEQLADNLNKSTKRRYIERKKQ--AEKLDSSTTGGFINDKN 175
           TK R++  G++ I D+K+ + +LA  L K+++ R++  KK+    K ++S  G F+N+KN
Sbjct: 118 TKGRISESGKVAIEDEKELVNKLAQTLEKTSRERFLREKKRLDGHKANTSELGNFVNEKN 177

Query: 176 KQFNEKLSRQFKQF 189
           + FNEKLSRQFK+ 
Sbjct: 178 RHFNEKLSRQFKEL 191

>KLTH0F14784g Chr6 (1211778..1212365) [588 bp, 195 aa] {ON} weakly
           similar to uniprot|P53277 Saccharomyces cerevisiae
           YGR129W SYF2 SYnthetic lethal with cdcForty (putative)
           involved in pre-mRNA splicing
          Length = 195

 Score =  125 bits (313), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 77/179 (43%), Positives = 110/179 (61%), Gaps = 5/179 (2%)

Query: 18  VDVSVKNRXXXXXXXXXXXXSGKPKVYSMNEDETFKDQKEEDTR-GKLLNYSIKDYEKWQ 76
           V +SVKN+              KP VYSM  +E    +  E+++  KLL YS+KD+E+WQ
Sbjct: 18  VSLSVKNKQQILQEEKQTSARAKPAVYSMKTEEAPSSETTEESKEAKLLQYSMKDFEQWQ 77

Query: 77  LK-RTAKLKNSDGSSQQDLAKYTYDKEIREMEKDGSLNRGKVTKARLNGKGRIQINDDKK 135
            K R    K+SD +  QDLAK+TYDKE++++ K+ +    K  K  +N KG+I + DD  
Sbjct: 78  DKERRKSQKSSDVAKYQDLAKFTYDKEVQQLRKNYTNKVEKPKKVSINKKGKIVVKDDPH 137

Query: 136 SLEQLADNLNKSTKRRY--IERKKQAEKLDSSTTGGFINDKNKQFNEKLSRQFKQFDDN 192
            +  LAD+LNK+   RY  IE KK   ++ S T GGFIN+KNKQFN+K+ RQ K+ ++N
Sbjct: 138 LVGSLADSLNKTANERYARIE-KKIHRQMVSDTPGGFINEKNKQFNDKIERQTKKREEN 195

>Kwal_55.21226 s55 (738730..739320) [591 bp, 196 aa] {ON} YGR129W
           (SYF2) - (putative) involved in pre-mRNA splicing
           [contig 130] FULL
          Length = 196

 Score =  118 bits (295), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 81/197 (41%), Positives = 114/197 (57%), Gaps = 15/197 (7%)

Query: 1   MDLTDXXXXXXXXXXXXVDVSVKNRXXXXXXXXXXXXSGKPKVYSMN----EDETFKDQK 56
           MDL+             +D+SVKN+            S KP VYSMN    E+E  KD  
Sbjct: 1   MDLSKYADRLKNLKRKRIDLSVKNKNEVIREEKMVSASRKPAVYSMNAEGAEEEIAKDVT 60

Query: 57  EEDTRGKLLNYSIKDYEKWQLKRTAKLKNSD----GSSQQDLAKYTYDKEIREMEKDGSL 112
           E +   KLL YS+ +YE+WQ K     KNS     G+S QDLAK TYDKE++++ K    
Sbjct: 61  EAN---KLLKYSMLEYEQWQDKVK---KNSHRLEGGASFQDLAKSTYDKEVQQLSKIDGN 114

Query: 113 NRGKVTKARLNGKGRIQINDDKKSLEQLADNLNKSTKRRYIE-RKKQAEKLDSSTTGGFI 171
              K TK R+N KG+I + DD++ +  L + LNK+   RY   +KK   +++++T+GG+I
Sbjct: 115 RVNKNTKYRVNNKGKIVVEDDQQLVTGLVETLNKTADERYARIQKKIGRQMNNTTSGGYI 174

Query: 172 NDKNKQFNEKLSRQFKQ 188
           N+KNKQFN+KL RQ K+
Sbjct: 175 NEKNKQFNDKLERQTKK 191

>TDEL0D05580 Chr4 (1007529..1008110) [582 bp, 193 aa] {ON} Anc_3.490
           YGR129W
          Length = 193

 Score =  114 bits (286), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 74/193 (38%), Positives = 112/193 (58%), Gaps = 8/193 (4%)

Query: 1   MDLTDXXXXXXXXXXXXVDVSVKNRXXXXXXXXXXXXSGKPKVYSM---NEDETFKDQKE 57
           MDL              VDV+++ R             GKPK+YSM   NE  T      
Sbjct: 1   MDLESIENRFKDLKKRSVDVAIQIRKIAEREAKDESLVGKPKIYSMEDTNEMGTRPVDSS 60

Query: 58  EDTRGKLLNYSIKDYEKWQLKRTAKLKNSDGSSQQDLAKYTYDKEIREMEKDGSLNRGKV 117
           E  R KL+NYS+++YE+W  K+  K     G++ Q+LAKY+Y+K++   +++   N  +V
Sbjct: 61  ERRRLKLMNYSMREYEEWDKKQKGKEVKRGGANVQELAKYSYEKDLSRSKQN---NGNRV 117

Query: 118 TKARLNGK-GRIQINDDKKSLEQLADNLNKSTKRRYIERKKQAEKLDS-STTGGFINDKN 175
            K   + K  R+Q+ DD+K + +LA++L K+T+ R++ RKK  EK D+ +T GG+IN+KN
Sbjct: 118 VKISTDAKTNRLQVKDDEKLVNKLANDLKKTTRERFLARKKDMEKADARATPGGYINEKN 177

Query: 176 KQFNEKLSRQFKQ 188
           KQFN KL RQ K+
Sbjct: 178 KQFNLKLDRQMKE 190

>AFR308W Chr6 (999495..1000073) [579 bp, 192 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR129W (SYF2)
          Length = 192

 Score =  114 bits (284), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 63/172 (36%), Positives = 103/172 (59%), Gaps = 3/172 (1%)

Query: 18  VDVSVKNRXXXXXXXXXXXXSGKPKVYSMNEDETFKDQKE--EDTRGKLLNYSIKDYEKW 75
           VD S++NR             GKP+VYSM E+   + + +  +  + KLLNY I DYEKW
Sbjct: 18  VDASIRNRKEAASEERARLAEGKPRVYSMAEEPADEAEADDTQSEQLKLLNYRIADYEKW 77

Query: 76  QLKRTAKLKNSDGSSQQDLAKYTYDKEIREMEKDGSLNRGKVTKARLNGKGRIQINDDKK 135
             K+    + SDG+   +LA  TY  E+ ++ + G + +G+ T  R++  G++ ++D+ +
Sbjct: 78  DEKQKRHKQPSDGADLGELANSTYRSELHQLHRRGVV-KGRATNGRISASGKVVLDDEPE 136

Query: 136 SLEQLADNLNKSTKRRYIERKKQAEKLDSSTTGGFINDKNKQFNEKLSRQFK 187
            +E+LA  + ++ KRR+ ER+K+A K     T G +NDKN+ FNEKL R+F+
Sbjct: 137 LVEKLAAAVQQTAKRRHEERQKKAAKDGGRATAGSLNDKNRHFNEKLDREFR 188

>ZYRO0D10032g Chr4 complement(847175..847804) [630 bp, 209 aa] {ON}
           similar to uniprot|P53277 Saccharomyces cerevisiae
           YGR129W SYF2 SYnthetic lethal with cdcForty (putative)
           involved in pre-mRNA splicing
          Length = 209

 Score =  107 bits (266), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 63/179 (35%), Positives = 104/179 (58%), Gaps = 9/179 (5%)

Query: 19  DVSVKNRXXXXXXXXXXXXSGKPKVYSMNEDETFKDQKEEDTRGKLLNYSIKDYEKWQLK 78
           ++SV+NR              KP+VY +   E     +++    +L+NY+I+ YE+W  +
Sbjct: 29  EISVENRKLVNAESKELAAGRKPRVYQLEAPEPSLPTQDDKHGNQLMNYTIQQYEEWNSR 88

Query: 79  RTAKLKNSDGSSQQDLAKYTYDKEIREMEKDGSL-----NRGKVTKARLNGK-GRIQIND 132
           +  +    D  + QD+AKYTYDKE+ ++ KD  L     N G + K   N K G++ I D
Sbjct: 89  QRDQTNKRDSGNLQDMAKYTYDKELNKLHKDTMLQNRYTNGGSIQKMNRNPKTGKLTIKD 148

Query: 133 DKKSLEQLADNLNKSTKRRYIERKKQAEK---LDSSTTGGFINDKNKQFNEKLSRQFKQ 188
           D + +++LA +++K+   RY  R+++ E+    ++S+ GG+IN+KNKQFNEKL RQ  Q
Sbjct: 149 DDQLVKKLAKDMDKTATERYEARRREMERSNVQNASSGGGYINEKNKQFNEKLDRQMPQ 207

>Kpol_480.15 s480 complement(32143..32766) [624 bp, 207 aa] {ON}
           complement(32143..32766) [624 nt, 208 aa]
          Length = 207

 Score = 93.6 bits (231), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 69/180 (38%), Positives = 109/180 (60%), Gaps = 13/180 (7%)

Query: 18  VDVSVKNRXXXXXXXXXXXXSGKPKVYSMNE---DETFKDQKEEDTRGKLLNYSIKDYEK 74
           VD+ ++NR            + KPK YSM E   D+T  +    D   +LLNYSI++YE+
Sbjct: 20  VDILIENRKLLDANTRELKKNSKPKTYSMEELAEDDTV-NTGTVDEADRLLNYSIREYEE 78

Query: 75  WQ-----LKRTAKLKNSDGSSQQDLAKYTYDKEIREMEKDGSLN--RGKVTKARLNGK-G 126
           W+      K    +  S  +S   +AK+TYDK+I++++K  S N  RGK++K R + K G
Sbjct: 79  WEKKQGRHKENVHVTKSSVNSTAQIAKFTYDKQIKKLQKQKSTNDNRGKISKIRKDPKTG 138

Query: 127 RIQINDDKKSLEQLADNLNKSTKRRYIERKKQAEK-LDSSTTGGFINDKNKQFNEKLSRQ 185
           +I +ND K+ ++QLA++LN++TK RY    ++ +K  D +    +IN+KNK+FN+KL RQ
Sbjct: 139 KIVVNDSKQLIKQLAEDLNQTTKERYDRTNQKRQKNSDQNENYSYINEKNKEFNDKLERQ 198

>Suva_7.417 Chr7 (720529..721167) [639 bp, 212 aa] {ON} YGR129W
           (REAL)
          Length = 212

 Score = 88.2 bits (217), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 69/208 (33%), Positives = 107/208 (51%), Gaps = 24/208 (11%)

Query: 1   MDLTDXXXXXXXXXXXXVDVSVKNRXXXXXXXXXXXXSGKPKVYSM---NEDETFKDQKE 57
           MDL +            VD S+K R            + KP+VYSM   ++DE  ++ K 
Sbjct: 1   MDLEELGNKLKELKRRRVDASLKTRKLADREIQEASSNRKPRVYSMEDASDDELVRETKS 60

Query: 58  EDTRGKLLNYSIKDYEKWQLK---RTAKLKNSDGSSQQDLAKYTYDKEIREM-------- 106
           +D + +  +Y++++Y  W+ K   R +      G+S   LAK +YDK +R +        
Sbjct: 61  DD-KDRAFHYTVQEYNAWEQKQKQRKSGKTQGTGNSYDQLAKLSYDKTLRNLTTQNYGKH 119

Query: 107 -----EKD--GSLNRGKVTKARLNG-KGRIQINDDKKSLEQLADNLNKSTKRRYIERKKQ 158
                EKD  GSL + ++ K + N   G+I+I DD + + +LA  L   +K+R+  RK+Q
Sbjct: 120 ESSVNEKDSKGSLGKSRIEKIQKNSITGKIRIVDDDELVNKLASTLESDSKKRHDARKRQ 179

Query: 159 AEKLDS-STTGGFINDKNKQFNEKLSRQ 185
            E + + S    FINDKNKQFNEKL R+
Sbjct: 180 MENVKTPSGVESFINDKNKQFNEKLGRE 207

>TBLA0C04470 Chr3 (1082932..1083600) [669 bp, 222 aa] {ON} Anc_3.490
           YGR129W
          Length = 222

 Score = 87.8 bits (216), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 64/180 (35%), Positives = 97/180 (53%), Gaps = 33/180 (18%)

Query: 39  GKPKVYSM-----------NEDETFKDQKEEDTRGKLLNYSIKDYEKWQLKRTAKLKNSD 87
            KPKVYSM           N++   K+  EE+   KL+NY++++Y+ W+LK+      S 
Sbjct: 40  NKPKVYSMTDEFDKDELPINDENARKNHSEEERISKLMNYTLREYKDWELKQNEYTTESQ 99

Query: 88  GSSQQD-------LAKYTYDKEIREMEK--------DGSLNRGKVTKARLNGKGRIQIND 132
            +S+ D       LAK TYDK+IR++ K        + S   GK+ K   N   +I I D
Sbjct: 100 TNSKDDQIESLDSLAKRTYDKDIRKLNKALRATNSGNKSNKPGKIIKNHRNESNKIVIKD 159

Query: 133 DKKSLEQLADNLNKSTKRRYI---ERKKQAEKLDSSTTGGFINDKNKQFNEKLSRQFKQF 189
           DK  +E+L +NL   + R Y    ER+K      S+T  G +N KN++FNEKL+R++K+ 
Sbjct: 160 DKFLVEELVNNLKTKSDRLYKHLGERRKNY----STTLSGHVNTKNQEFNEKLTREWKKL 215

>NCAS0E00820 Chr5 complement(151102..151710) [609 bp, 202 aa] {ON}
           Anc_3.490 YGR129W
          Length = 202

 Score = 87.4 bits (215), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 65/184 (35%), Positives = 103/184 (55%), Gaps = 26/184 (14%)

Query: 19  DVSVKNRXXXXXXXXXXXXSGKPKVYSMNEDE--TFKDQKEE--DTRGKLLNYSIKDYEK 74
           D +++NR            SGKP+VY+M +D+    + Q+E+  D   KL+NY+++ YE+
Sbjct: 20  DATIENRLLVDRESKDIESSGKPRVYNMQDDQDNQLETQEEDADDKVAKLMNYTLRQYEE 79

Query: 75  WQLKRTAKLKNSDGSSQQDLAKYTYDKEIREMEKDGSLNRGKVTKA--------RLNGK- 125
           W+ K+  K    D S  + LA ++YDK +       +LNR +  K         ++N K 
Sbjct: 80  WEKKQKDKKIKDDSSDMKQLAMFSYDKGV------SNLNRFRTDKTTTEREVQIQVNSKT 133

Query: 126 GRIQINDDKKSLEQLADNLNKSTKRRYIERKKQAEKLDS----STTGGFINDKNKQFNEK 181
           G++ I D+KK +  LA NL K+  +RY+  KK   KLD+    S+  G+IN++NK FNEK
Sbjct: 134 GKVNIQDEKKLVNDLAKNLTKTANKRYMVTKK---KLDARSKDSSAEGYINERNKHFNEK 190

Query: 182 LSRQ 185
           L R+
Sbjct: 191 LDRE 194

>Skud_7.440 Chr7 (729641..730282) [642 bp, 213 aa] {ON} YGR129W
           (REAL)
          Length = 213

 Score = 84.7 bits (208), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 71/196 (36%), Positives = 107/196 (54%), Gaps = 29/196 (14%)

Query: 18  VDVSVKNRXXXXXXXXXXXXSGKPKVYSMNED-----ETFKDQKEEDTRGKLLNYSIKDY 72
           V+VS+KNR            + KPKVYSM ED     E  +D +  D + K  +Y++++Y
Sbjct: 18  VNVSIKNRKLADREIQEAGLNRKPKVYSM-EDVNDGAEPVEDAETSD-KDKAFHYTVQEY 75

Query: 73  EKWQLKRTAKLKNS----DGSSQQDLAKYTYDKEIREM------EKDGSLNR-------- 114
             W+ K+  + KN      G+S   +AK +Y+K +R +      + + S+N+        
Sbjct: 76  NAWKQKQNQR-KNGQGQRSGNSYDQVAKLSYEKTLRNLVTQNSNKNENSVNKNDSNSSPK 134

Query: 115 -GKVTKARLNGK-GRIQINDDKKSLEQLADNLNKSTKRRYIERKKQAEKLDS-STTGGFI 171
            G + K + N K G+I+I DD K + +LA  L   +K+RY  R+KQ E   + S+   FI
Sbjct: 135 NGAIHKIQRNIKTGKIEIVDDDKLVNKLAFTLESESKKRYEARRKQMENAKTPSSVESFI 194

Query: 172 NDKNKQFNEKLSRQFK 187
           NDKNKQFNEKLSR+ K
Sbjct: 195 NDKNKQFNEKLSREPK 210

>KLLA0E04643g Chr5 complement(413277..413942) [666 bp, 221 aa] {ON}
           similar to uniprot|P53277 Saccharomyces cerevisiae
           YGR129W SYF2 SYnthetic lethal with cdcForty (putative)
           involved in pre-mRNA splicing
          Length = 221

 Score = 84.0 bits (206), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 59/175 (33%), Positives = 103/175 (58%), Gaps = 12/175 (6%)

Query: 18  VDVSVKNRXXXXXXXXXXXXSGKPKVYSM---NEDETFKDQKEEDTRGKLLNYSIKDYEK 74
           V+VS++N+            + + +VYSM    ED+   ++ E +   KL NYSI++YEK
Sbjct: 54  VEVSIRNKKAIIAEEKK---NSERRVYSMADDGEDKARSNKSEPEDPIKLANYSIREYEK 110

Query: 75  WQLK-RTAKLKNSDGSSQQDLAKYTYDKEIREMEKDGSLNRGKVTKARLNGKGRIQINDD 133
           W+ K + ++   S     Q +AK +Y KE+  + KD S       K  +   G++Q+ D+
Sbjct: 111 WEAKTQNSRHNKSVMGDFQTIAKNSYKKEVDALPKDIS----HPLKGGITEDGKVQVEDN 166

Query: 134 KKSLEQLADNLNKSTKRRYIERKKQAEKLDS-STTGGFINDKNKQFNEKLSRQFK 187
            + +E++ ++LN+ +K+RY+ RK++ +K +  +   GFINDKNK+FN KL+ +FK
Sbjct: 167 PELVEKMVNDLNERSKKRYMVRKQKLDKQNKINLDDGFINDKNKRFNAKLNSEFK 221

>CAGL0I10538g Chr9 complement(1042601..1043203) [603 bp, 200 aa]
           {ON} similar to uniprot|P53277 Saccharomyces cerevisiae
           YGR129w
          Length = 200

 Score = 81.3 bits (199), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 56/174 (32%), Positives = 95/174 (54%), Gaps = 10/174 (5%)

Query: 19  DVSVKNRXXXXXXXXXXXXSGKPKVYSMNEDETFKDQK-----EEDTRGKLLNYSIKDYE 73
           D+ ++NR              KP+VYSM++DE   D+K     + D R  L  Y+++D+ 
Sbjct: 19  DIKIRNRNLLKQEAEEKEKGLKPRVYSMHDDEDDSDEKRSSDEQSDMRTNLFQYTVQDFI 78

Query: 74  KWQLKRTAKLKNSD----GSSQQDLAKYTYDKEIREMEKDGSLNRGKVTKARLN-GKGRI 128
            W+ ++  K K+      G   Q LAK TYDKE++ + +     + K T+ R+N   G++
Sbjct: 79  DWEKRQQRKKKSKLESKSGMRLQHLAKNTYDKELQNLPRPEFKMKAKETQFRINKDSGKV 138

Query: 129 QINDDKKSLEQLADNLNKSTKRRYIERKKQAEKLDSSTTGGFINDKNKQFNEKL 182
            I D+K+ +++L+ NL ++ K+RY   +K A   + ++  G IN KN QFN+ L
Sbjct: 139 NIKDNKELVQRLSQNLKETAKQRYDSNRKIANDKEHTSLSGSINAKNLQFNKSL 192

>YGR129W Chr7 (750400..751047) [648 bp, 215 aa] {ON}  SYF2Member of
           the NineTeen Complex (NTC) that contains Prp19p and
           stabilizes U6 snRNA in catalytic forms of the
           spliceosome containing U2, U5, and U6 snRNAs; isy1 syf2
           cells have defective spindles activiating cell cycle
           arrest
          Length = 215

 Score = 80.1 bits (196), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 68/199 (34%), Positives = 107/199 (53%), Gaps = 33/199 (16%)

Query: 18  VDVSVKNRXXXXXXXXXXXXSGKPKVYSMNE----DETFKDQKEEDTRGKLLNYSIKDYE 73
           VDVS+K+R            + KP+VYSM +    DE+  D  E   + K  +Y++++Y+
Sbjct: 18  VDVSIKSRKLADREIQEVSANRKPRVYSMEDVNDADESVGDT-ESPEKEKAFHYTVQEYD 76

Query: 74  KWQLKRTAKLKNSD----GSSQQDLAKYTYDKEIREM--------EKDGSLN-------- 113
            W+ +R  + K       G S   LAK +Y+K +R +        ++D S +        
Sbjct: 77  AWE-RRHPQGKTGQSQRGGISYDQLAKLSYEKTLRNLATQTQNSSKQDSSADEEDNKNVP 135

Query: 114 -RGKVTKARLNGK-GRIQINDDKKSLEQLADNLNKSTKRRYIERKKQAEKLDSSTTGG-- 169
            +G++ K + + K G+I I DD K + +LA +L   +K+RY  RK+Q +  ++ T  G  
Sbjct: 136 KKGRIGKVQKDTKTGKITIADDDKLVNKLAVSLQSESKKRYEARKRQMQ--NAKTLYGVE 193

Query: 170 -FINDKNKQFNEKLSRQFK 187
            FINDKNKQFNEKLSR+ K
Sbjct: 194 SFINDKNKQFNEKLSRESK 212

>NDAI0G00950 Chr7 complement(198741..199382) [642 bp, 213 aa] {ON}
           Anc_3.490 YGR129W
          Length = 213

 Score = 76.6 bits (187), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 62/190 (32%), Positives = 109/190 (57%), Gaps = 16/190 (8%)

Query: 18  VDVSVKNRXXXXXXXXXXXXSGKPKVYSM----NEDETFKD--------QKEEDTRGKLL 65
           +D+  +NR            S KPKVY +    ++D    D         +EE  + KL+
Sbjct: 21  LDIITENRKRADQEVKEKSQSSKPKVYDIKAVEDDDNHHTDYDGLGDFSNEEEKRKFKLM 80

Query: 66  NYSIKDYEKW-QLKRTAKLKNSDGSSQQDLAKYTYDKEIREM-EKDGSLNRGKVTKARLN 123
           NY+I++YE+W + ++  + K  DGS   +LA +TY+KE+ ++  K  +++  +  +  +N
Sbjct: 81  NYTIREYEEWDKQQKDKQRKRVDGSDLTELATFTYEKELSKLNSKLENISHEQKHQIGVN 140

Query: 124 GK-GRIQINDDKKSLEQLADNLNKSTKRRYIERKKQAE-KLDSSTTGGFINDKNKQFNEK 181
            + G++ + D+++ L  L +NLN++ K+RY+ RKK+ + K  S   G +  DKNKQFNEK
Sbjct: 141 TRNGKLNVKDEERLLNNLVNNLNETAKKRYMVRKKKLQSKASSDIAGNYFKDKNKQFNEK 200

Query: 182 LSRQFKQFDD 191
           L R+ K+ D+
Sbjct: 201 LERELKERDN 210

>Smik_6.225 Chr6 (368227..368868) [642 bp, 213 aa] {ON} YGR129W
           (REAL)
          Length = 213

 Score = 74.3 bits (181), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 66/193 (34%), Positives = 99/193 (51%), Gaps = 27/193 (13%)

Query: 18  VDVSVKNRXXXXXXXXXXXXSGKPKVYSMNE----DETFKDQKEEDTRGKLLNYSIKDYE 73
           V+VS+KNR            + KP+VY+M +    DE+    +  D + +  +Y+ ++Y 
Sbjct: 18  VNVSIKNRKLADREIQEANVNRKPRVYNMEDINDVDESVGYTESSD-KDRAFHYTAQEYI 76

Query: 74  KW-QLKRTAKLKNS--DGSSQQDLAKYTYDKEIREM-------------EKDGSLNRGKV 117
            W Q     K+  S   G S   LAK +Y+K +R +             EKD   N  K+
Sbjct: 77  AWEQRHHQRKIGQSKRSGISYDQLAKLSYEKTLRNLATQDLSEYDNFVNEKDHK-NISKI 135

Query: 118 TKA-RL---NGKGRIQINDDKKSLEQLADNLNKSTKRRYIERKKQAE-KLDSSTTGGFIN 172
           ++  R+      G+I+I DD K + +LA +L   +K+RY  RK+Q E  +  S    FIN
Sbjct: 136 SRIDRIQKDTKTGKIRIADDHKLVNKLAVSLESESKKRYEARKRQMESAVIPSGVESFIN 195

Query: 173 DKNKQFNEKLSRQ 185
           DKNKQFNEKLSR+
Sbjct: 196 DKNKQFNEKLSRE 208

>TPHA0D04240 Chr4 (916281..916910) [630 bp, 209 aa] {ON} Anc_3.490
           YGR129W
          Length = 209

 Score = 63.2 bits (152), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 57/170 (33%), Positives = 83/170 (48%), Gaps = 29/170 (17%)

Query: 40  KPKVYSMNEDETFKDQKEE-----DTRGKLLNYSIKDYEKWQLKRTAKLKNSDGSSQQDL 94
           KPKVYS+N D+       +     ++   LL Y+I+DYE+W+     K KN   +S    
Sbjct: 40  KPKVYSINMDDDGDGDAGDDLLTNNSERALLTYTIRDYEEWEESLKRKHKNVTNTSTSSS 99

Query: 95  -----AKYTYDKEIREMEK-------DGSLNRGKVTKARLNGKGRIQINDDKKSLEQLAD 142
                AK+TYDKEI  M+K       D  + RG   K  L+  G++ I DDK  +     
Sbjct: 100 SQQQTAKFTYDKEIHRMKKRQGKFATDEEITRGSAMKEVLDD-GKLLIKDDKHLVNGFIS 158

Query: 143 NLNKSTKRRYIERKKQAEKLDSSTTGGFI----------NDKNKQFNEKL 182
           ++NK +  RYI+R K    +++  TG  +          N KNK FN+KL
Sbjct: 159 DINKVSNDRYIKRMK-LNAVNNDATGSKVSHDKGKTSYNNAKNKDFNDKL 207

>KNAG0B00820 Chr2 complement(151197..151820) [624 bp, 207 aa] {ON}
           Anc_3.490 YGR129W
          Length = 207

 Score = 48.9 bits (115), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 46/154 (29%), Positives = 77/154 (50%), Gaps = 27/154 (17%)

Query: 40  KPKVYSMNEDETFKD-----QKEEDTRGKLLNYSIKDYEKWQLKRTAKLKNSDGSSQQD- 93
           KPKVYS+   E   D     +  ++   KLLN  ++  E  + +R     ++    + D 
Sbjct: 67  KPKVYSLQAAEPSVDGIDGAEVVDNVTVKLLNTPLRQLEAREARRGENGDDAVARVEGDR 126

Query: 94  LAKYTYDKEIREMEKDGSLNRGKVTKARLNGKGRIQINDDKKSLEQLADNLNKSTKRRYI 153
           +AK TY KE+  +              R + +G  + N     +E+L  +LN  +K+RY+
Sbjct: 127 VAKDTYKKELALL-------------GRKSTRGTYRDN-----VERLVTHLNDVSKKRYL 168

Query: 154 ERKKQAEKLDS---STTGGFINDKNKQFNEKLSR 184
            RK + ++  +   S+  G+IN+KNKQFN+KL R
Sbjct: 169 VRKNKMKRQGARGGSSLDGYINEKNKQFNKKLQR 202

>KAFR0C01950 Chr3 (390143..390616) [474 bp, 157 aa] {ON} Anc_3.490
           YGR129W
          Length = 157

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 41/154 (26%), Positives = 73/154 (47%), Gaps = 41/154 (26%)

Query: 38  SGKPKVYSMNEDET---FKDQKEEDTRG-KLLNYSIKDYEKWQLKRTAKLKNSDGSSQQD 93
           + KPK YS+ E+E      D+ E+D+   KLL   ++++E          +     +++D
Sbjct: 33  ASKPKTYSIREEEIGAEVSDEDEDDSEIIKLLTKPLREFE---------TEAHVAENKED 83

Query: 94  LAKYTYDKEIREMEKDGSLNRGKVTKARLNGKGRIQINDDKKSLEQLADNLNKSTKRRYI 153
           + + TY+KE+        ++ GK                +K+ +E L   +N+ +  RY 
Sbjct: 84  IDRLTYNKEV--------MSLGK---------------REKRDVESLVSEMNRISDERY- 119

Query: 154 ERKKQAEKLD--SSTTGGFINDKNKQFNEKLSRQ 185
             KK A+K      T  GFIN++NK FN +L ++
Sbjct: 120 --KKGAQKRRRLKDTERGFINEQNKAFNLRLEKE 151

>TDEL0C00960 Chr3 (153572..157240) [3669 bp, 1222 aa] {ON} Anc_8.68
           YFL008W
          Length = 1222

 Score = 31.2 bits (69), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 37/77 (48%), Gaps = 17/77 (22%)

Query: 76  QLKRTAKLKNSDGSSQQDLAKYTYDKEIREMEKDGSLNRGKVTKARLNGKGRIQINDDKK 135
           QLKR  +  N+D    Q+L K  YD +I+E+E+  ++                 IND +K
Sbjct: 730 QLKRALEDTNTDIEYHQNLIKQEYDPKIQELEQKLAI-----------------INDSRK 772

Query: 136 SLEQLADNLNKSTKRRY 152
            LE+  D+L   T + +
Sbjct: 773 QLEEEKDSLQTQTFKEF 789

>NCAS0A09460 Chr1 (1880409..1883048) [2640 bp, 879 aa] {ON}
           Anc_1.272 YJL094C
          Length = 879

 Score = 30.8 bits (68), Expect = 2.3,   Method: Composition-based stats.
 Identities = 16/32 (50%), Positives = 19/32 (59%), Gaps = 2/32 (6%)

Query: 155 RKKQAEKLDSSTTGGFINDKNKQFNEKLSRQF 186
           R KQA   DS+ +  F+N KN QF E LS  F
Sbjct: 747 RGKQAT--DSTNSTIFVNSKNLQFEESLSNMF 776

>YML071C Chr13 complement(129749..131572) [1824 bp, 607 aa] {ON}
           COG8Component of the conserved oligomeric Golgi complex
           (Cog1p through Cog8p), a cytosolic tethering complex
           that functions in protein trafficking to mediate fusion
           of transport vesicles to Golgi compartments
          Length = 607

 Score = 30.4 bits (67), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 45/95 (47%), Gaps = 16/95 (16%)

Query: 64  LLNYSIKDYEKWQLKRTAKLKNSDGSSQQDLAKY-----TYDKEIREMEKDGSLNRGKVT 118
           +L  + KDYE +   R        GS  +D+A+        D++IR+   D   N  ++ 
Sbjct: 28  ILQSNTKDYESYFSSRAVP-----GSITEDIAEIDAELSALDRKIRKTLLD---NTSQII 79

Query: 119 KARLNGKGRIQINDDKKSLEQLAD---NLNKSTKR 150
              L    R Q++D  KSLEQL +   N+NK+  R
Sbjct: 80  GNILENDDRAQLDDIAKSLEQLWELDTNINKAADR 114

>Skud_13.71 Chr13 complement(127930..129549) [1620 bp, 539 aa] {ON}
           YML071C (REAL)
          Length = 539

 Score = 29.6 bits (65), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 28/91 (30%), Positives = 46/91 (50%), Gaps = 14/91 (15%)

Query: 64  LLNYSIKDYEKWQLKRTAKLKNSDGSSQQDLAKYTYDKEI----REMEKDGSLNRGKVTK 119
           +L    K+YE +   R A      GS  +D+A+   D E+    R++ K    N+ +V +
Sbjct: 28  ILQSETKEYETYFSSRAAP-----GSITEDIAEI--DAELSALDRKIRKSLLENKCQVIQ 80

Query: 120 ARLNGKGRIQINDDKKSLEQLAD---NLNKS 147
             L    R+Q+ +  KSLEQL +   N+NK+
Sbjct: 81  DILGNDDRVQLEEISKSLEQLWELDANINKA 111

>SAKL0F08162g Chr6 complement(622302..623294) [993 bp, 330 aa] {ON}
           highly similar to uniprot|Q75AN7 Ashbya gossypii ADL115W
           ADL115Wp and similar to YIL041W uniprot|P40531
           Saccharomyces cerevisiae YIL041W GVP36 Golgi-vesicle
           protein of unknown function green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm
          Length = 330

 Score = 29.3 bits (64), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 22/38 (57%)

Query: 114 RGKVTKARLNGKGRIQINDDKKSLEQLADNLNKSTKRR 151
           + K+ +ARL     IQ   +KK  E LA +LNK+ K R
Sbjct: 194 QAKIAQARLQQDTLIQTKFNKKLRETLASDLNKAVKAR 231

>TPHA0P01680 Chr16 complement(350606..352414) [1809 bp, 602 aa] {ON}
           Anc_2.26 YNL218W
          Length = 602

 Score = 28.9 bits (63), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 38/90 (42%), Gaps = 5/90 (5%)

Query: 94  LAKYTYDKEIREMEKDGSLNRGKVTKARLNGKGRIQINDDKKSLEQL----ADNLNKSTK 149
           LA+Y  + +I  M   G    GK T AR+  K   + N D K+  QL    A   N    
Sbjct: 157 LARYITEGQIPSMILWGPPGVGKTTLARIITKAASESNPDSKTSYQLVEVSATKTNSQEL 216

Query: 150 RRYIERKKQAEKLDSSTTGGFINDKNKQFN 179
           R   E+ +   KL       FI D+  +FN
Sbjct: 217 RSIFEKSRNEYKLTKRRIVLFI-DELHRFN 245

>Suva_4.321 Chr4 complement(568645..572793) [4149 bp, 1382 aa] {ON}
            YBR081C (REAL)
          Length = 1382

 Score = 28.9 bits (63), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 35/74 (47%), Gaps = 1/74 (1%)

Query: 64   LLNYSIKDYEKWQLKRTAKLKNSDGSSQQDLAKYTYDKEIREMEKDGSLNRGKVTKARLN 123
            LL    KDYE+ +    AK   S  +S + L   T D     +E+D  +++   +KARL 
Sbjct: 1236 LLPLLRKDYERSK-AYIAKQSKSSATSDRILPTSTEDSSFALLEEDQFISKKSASKARLP 1294

Query: 124  GKGRIQINDDKKSL 137
              G+I     KK +
Sbjct: 1295 PTGKISTAYKKKPI 1308

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.307    0.127    0.338 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 20,093,244
Number of extensions: 921873
Number of successful extensions: 4794
Number of sequences better than 10.0: 258
Number of HSP's gapped: 4696
Number of HSP's successfully gapped: 269
Length of query: 192
Length of database: 53,481,399
Length adjustment: 103
Effective length of query: 89
Effective length of database: 41,670,801
Effective search space: 3708701289
Effective search space used: 3708701289
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 62 (28.5 bits)