Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0F02794g3.491ON39739717550.0
KLTH0F14806g3.491ON35839911141e-151
Kwal_55.212273.491ON37640110831e-146
Skud_16.4433.491ON4204249731e-129
Ecym_12383.491ON3934119171e-121
Smik_16.4013.491ON4274349061e-119
YPR148C3.491ON4354429031e-118
KLLA0E04621g3.491ON3894198801e-115
ZYRO0D10010g3.491ON3823998571e-112
TDEL0D055903.491ON3443978401e-110
Suva_16.4773.491ON4234328251e-106
AFR309C3.491ON3644027687e-99
Kpol_1017.73.491ON3784047244e-92
TPHA0D032703.491ON3884266923e-87
CAGL0L08492g3.491ON3854156907e-87
KAFR0G036803.491ON4154346604e-82
NCAS0F035403.491ON4442586163e-75
NDAI0B058503.491ON4732845951e-71
KNAG0A079303.491ON4522804571e-51
KLLA0E04511g7.221ON3022602282e-20
KLTH0A03894g7.221ON3232522133e-18
SAKL0F08162g7.221ON3302682115e-18
Kwal_47.181487.221ON3232682072e-17
TDEL0H022407.221ON3382062082e-17
Suva_9.1597.221ON3252402072e-17
KAFR0I019507.221ON3302092037e-17
Ecym_43777.221ON3332062029e-17
ADL115W7.221ON3332101992e-16
ZYRO0D16522g7.221ON3582111993e-16
Kpol_1070.197.221ON3112591964e-16
TBLA0D042007.221ON3312361965e-16
NDAI0A026607.221ON3642451976e-16
TBLA0D029803.491ON443651978e-16
Smik_9.1507.221ON3262401931e-15
KNAG0D017607.221ON3422021931e-15
TPHA0C012307.221ON3052091921e-15
Skud_9.1287.221ON3292401912e-15
YIL041W (GVP36)7.221ON3262401903e-15
Kpol_478.227.221ON3502001861e-14
CAGL0L00891g7.221ON3412601851e-14
TBLA0B015807.221ON3862171711e-12
NCAS0A133807.221ON3292571692e-12
TPHA0B027507.221ON3632001594e-11
NDAI0D031304.340ON149563770.63
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0F02794g
         (397 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0F02794g Chr6 (238272..239465) [1194 bp, 397 aa] {ON} simila...   680   0.0  
KLTH0F14806g Chr6 complement(1212362..1213438) [1077 bp, 358 aa]...   433   e-151
Kwal_55.21227 s55 complement(739317..740447) [1131 bp, 376 aa] {...   421   e-146
Skud_16.443 Chr16 complement(780561..781823) [1263 bp, 420 aa] {...   379   e-129
Ecym_1238 Chr1 (489922..491103) [1182 bp, 393 aa] {ON} similar t...   357   e-121
Smik_16.401 Chr16 complement(698791..700074) [1284 bp, 427 aa] {...   353   e-119
YPR148C Chr16 complement(826833..828140) [1308 bp, 435 aa] {ON} ...   352   e-118
KLLA0E04621g Chr5 (412009..413178) [1170 bp, 389 aa] {ON} some s...   343   e-115
ZYRO0D10010g Chr4 (845993..847141) [1149 bp, 382 aa] {ON} simila...   334   e-112
TDEL0D05590 Chr4 complement(1008107..1009141) [1035 bp, 344 aa] ...   328   e-110
Suva_16.477 Chr16 complement(823311..824582) [1272 bp, 423 aa] {...   322   e-106
AFR309C Chr6 complement(1000078..1001172) [1095 bp, 364 aa] {ON}...   300   7e-99
Kpol_1017.7 s1017 (27496..28272,28322..28330,28419..28769) [1137...   283   4e-92
TPHA0D03270 Chr4 complement(673063..674229) [1167 bp, 388 aa] {O...   271   3e-87
CAGL0L08492g Chr12 (931048..932205) [1158 bp, 385 aa] {ON} simil...   270   7e-87
KAFR0G03680 Chr7 complement(760604..761851) [1248 bp, 415 aa] {O...   258   4e-82
NCAS0F03540 Chr6 complement(707257..708591) [1335 bp, 444 aa] {O...   241   3e-75
NDAI0B05850 Chr2 complement(1418191..1419612) [1422 bp, 473 aa] ...   233   1e-71
KNAG0A07930 Chr1 complement(1265981..1267339) [1359 bp, 452 aa] ...   180   1e-51
KLLA0E04511g Chr5 complement(406764..407672) [909 bp, 302 aa] {O...    92   2e-20
KLTH0A03894g Chr1 complement(328648..329619) [972 bp, 323 aa] {O...    87   3e-18
SAKL0F08162g Chr6 complement(622302..623294) [993 bp, 330 aa] {O...    86   5e-18
Kwal_47.18148 s47 complement(708086..709057) [972 bp, 323 aa] {O...    84   2e-17
TDEL0H02240 Chr8 (377524..378540) [1017 bp, 338 aa] {ON} Anc_7.2...    85   2e-17
Suva_9.159 Chr9 (265174..266151) [978 bp, 325 aa] {ON} YIL041W (...    84   2e-17
KAFR0I01950 Chr9 (398299..399291) [993 bp, 330 aa] {ON} Anc_7.22...    83   7e-17
Ecym_4377 Chr4 complement(796971..797972) [1002 bp, 333 aa] {ON}...    82   9e-17
ADL115W Chr4 (483164..484165) [1002 bp, 333 aa] {ON} Syntenic ho...    81   2e-16
ZYRO0D16522g Chr4 complement(1371404..1372480) [1077 bp, 358 aa]...    81   3e-16
Kpol_1070.19 s1070 (45405..46340) [936 bp, 311 aa] {ON} (45405.....    80   4e-16
TBLA0D04200 Chr4 (1038483..1039478) [996 bp, 331 aa] {ON} Anc_7....    80   5e-16
NDAI0A02660 Chr1 (599113..600207) [1095 bp, 364 aa] {ON} Anc_7.221     80   6e-16
TBLA0D02980 Chr4 (723788..725119) [1332 bp, 443 aa] {ON} Anc_3.4...    80   8e-16
Smik_9.150 Chr9 (250717..251697) [981 bp, 326 aa] {ON} YIL041W (...    79   1e-15
KNAG0D01760 Chr4 (296169..297197) [1029 bp, 342 aa] {ON} Anc_7.2...    79   1e-15
TPHA0C01230 Chr3 (280944..281861) [918 bp, 305 aa] {ON} Anc_7.22...    79   1e-15
Skud_9.128 Chr9 (245338..246327) [990 bp, 329 aa] {ON} YIL041W (...    78   2e-15
YIL041W Chr9 (276525..277505) [981 bp, 326 aa] {ON}  GVP36BAR do...    78   3e-15
Kpol_478.22 s478 (67833..68885) [1053 bp, 350 aa] {ON} (67833..6...    76   1e-14
CAGL0L00891g Chr12 (108801..109826) [1026 bp, 341 aa] {ON} simil...    76   1e-14
TBLA0B01580 Chr2 (345206..346366) [1161 bp, 386 aa] {ON} Anc_7.2...    70   1e-12
NCAS0A13380 Chr1 complement(2633641..2634630) [990 bp, 329 aa] {...    70   2e-12
TPHA0B02750 Chr2 (627808..628899) [1092 bp, 363 aa] {ON} Anc_7.2...    66   4e-11
NDAI0D03130 Chr4 (742587..747074) [4488 bp, 1495 aa] {ON} Anc_4....    34   0.63 

>SAKL0F02794g Chr6 (238272..239465) [1194 bp, 397 aa] {ON} similar
           to uniprot|Q06523 Saccharomyces cerevisiae YPR148C
           Protein of unknown function green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm in a
           punctate pattern
          Length = 397

 Score =  680 bits (1755), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/397 (86%), Positives = 343/397 (86%)

Query: 1   MSGYFSSFSLDKLTNSISSAAHKTQDKLSTAIANIQLDDPQAKLSLKVRKHYLQETLGAI 60
           MSGYFSSFSLDKLTNSISSAAHKTQDKLSTAIANIQLDDPQAKLSLKVRKHYLQETLGAI
Sbjct: 1   MSGYFSSFSLDKLTNSISSAAHKTQDKLSTAIANIQLDDPQAKLSLKVRKHYLQETLGAI 60

Query: 61  DDISKLPPQYQFLEKKCDSLEKICRRMLVVTKTFEVEGYDYPPNLSESISDWWGANRSGL 120
           DDISKLPPQYQFLEKKCDSLEKICRRMLVVTKTFEVEGYDYPPNLSESISDWWGANRSGL
Sbjct: 61  DDISKLPPQYQFLEKKCDSLEKICRRMLVVTKTFEVEGYDYPPNLSESISDWWGANRSGL 120

Query: 121 LSFMDGKKGEGSRAKAEEKDENEGFLPRSFAQALSKAAKDSGDVLRTLXXXXXXXXXXXX 180
           LSFMDGKKGEGSRAKAEEKDENEGFLPRSFAQALSKAAKDSGDVLRTL            
Sbjct: 121 LSFMDGKKGEGSRAKAEEKDENEGFLPRSFAQALSKAAKDSGDVLRTLKDEQKEPPQDED 180

Query: 181 XXXXXXINSLITMFEAWSKCEQKIDQEKAEMDSLMAKEFNKKLDKLINEDFKKVHSLRKK 240
                 INSLITMFEAWSKCEQKIDQEKAEMDSLMAKEFNKKLDKLINEDFKKVHSLRKK
Sbjct: 181 EDEDEDINSLITMFEAWSKCEQKIDQEKAEMDSLMAKEFNKKLDKLINEDFKKVHSLRKK 240

Query: 241 VEESRLKFDTLRYXXXXXXXXXXXXXXXXXXXXXVDVVEQNAPEEKAKTEGQETSEGKEH 300
           VEESRLKFDTLRY                     VDVVEQNAPEEKAKTEGQETSEGKEH
Sbjct: 241 VEESRLKFDTLRYELNLKEKEQQKAKAKEEENEKVDVVEQNAPEEKAKTEGQETSEGKEH 300

Query: 301 DLKADEKLSEDTASKIXXXXXXXXXXXXXXXHKLLEKLEDEFVSSTTEAVEIMGEITDSS 360
           DLKADEKLSEDTASKI               HKLLEKLEDEFVSSTTEAVEIMGEITDSS
Sbjct: 301 DLKADEKLSEDTASKIPESVENEEVDNEDPEHKLLEKLEDEFVSSTTEAVEIMGEITDSS 360

Query: 361 EILSLVKLFHKFQLIYHRQCVQELEASTKILDGLDNE 397
           EILSLVKLFHKFQLIYHRQCVQELEASTKILDGLDNE
Sbjct: 361 EILSLVKLFHKFQLIYHRQCVQELEASTKILDGLDNE 397

>KLTH0F14806g Chr6 complement(1212362..1213438) [1077 bp, 358 aa]
           {ON} similar to uniprot|P40531 Saccharomyces cerevisiae
           YIL041W GVP36 Golgi-vesicle protein of unknown function
           green fluorescent protein (GFP)-fusion protein localizes
           to the cytoplasm
          Length = 358

 Score =  433 bits (1114), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 228/399 (57%), Positives = 266/399 (66%), Gaps = 45/399 (11%)

Query: 1   MSGYFSSFSLDKLTNSISSAAHKTQDKLSTAIANIQLDDPQAKLSLKVRKHYLQETLGAI 60
           MS YF  FSL+KLTNSI++ AHKTQD LSTAIANIQLDDPQAKLSLK RKHYLQETLG I
Sbjct: 1   MSNYFGGFSLNKLTNSITNVAHKTQDTLSTAIANIQLDDPQAKLSLKARKHYLQETLGTI 60

Query: 61  DDISKLPPQYQFLEKKCDSLEKICRRMLVVTKTFEVEGYDYPPNLSESISDWWGANRSGL 120
           +DISKLPPQYQFLEKKCDSLEK+CRRMLVVTKT+EVEGYDYPPNLSES+SDWW +N+ GL
Sbjct: 61  EDISKLPPQYQFLEKKCDSLEKVCRRMLVVTKTYEVEGYDYPPNLSESLSDWWSSNKEGL 120

Query: 121 LSFMDGKKGEGSRAKAEEKDENEGFLPRSFAQALSKAAKDSGDVLRTLXXXXXXXXXXXX 180
             F+   K E     AE  D  E  +PRSFAQA+SKAAKDSG+V+  L            
Sbjct: 121 FGFVSSSKKEKKLEPAE--DSKEALMPRSFAQAISKAAKDSGEVMTAL-KTEEQKASAEE 177

Query: 181 XXXXXXINSLITMFEAWSKCEQKIDQEKAEMDSLMAKEFNKKLDKLINEDFKKVHSLRKK 240
                 I SLI MFEAWS C+  +DQ KAEMD+LM KEFN KL   + E FK   +LRKK
Sbjct: 178 DEEDEDITSLIKMFEAWSACQHNMDQSKAEMDALMVKEFNHKLTAFVEEKFKNARTLRKK 237

Query: 241 VEESRLKFDTLRYXXXXXXXXXXXXXXXXXXXXXVDVVEQNAPEEKAKTE--GQETSEGK 298
           VE+SRLKFDT+RY                         E    EE+ KTE   Q+T   K
Sbjct: 238 VEDSRLKFDTMRY-------------------------ELKMAEEQGKTEEAAQQTESQK 272

Query: 299 EHDLKADEKLSEDTASKIXXXXXXXXXXXXXXXHKLLEKLEDEFVSSTTEAVEIMGEITD 358
             + +A+     D++ +                 KLLEKLEDEFVS+TTEAVE MGEITD
Sbjct: 273 PQEDEAEASKDSDSSDE---------------AQKLLEKLEDEFVSNTTEAVETMGEITD 317

Query: 359 SSEILSLVKLFHKFQLIYHRQCVQELEASTKILDGLDNE 397
           S+EI++LVKLFH FQLIY++QCVQ LE S   L+ L+ +
Sbjct: 318 SAEIINLVKLFHNFQLIYYKQCVQNLETSINSLNELEGD 356

>Kwal_55.21227 s55 complement(739317..740447) [1131 bp, 376 aa] {ON}
           YPR148C - Hypothetical ORF [contig 130] FULL
          Length = 376

 Score =  421 bits (1083), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 223/401 (55%), Positives = 269/401 (67%), Gaps = 31/401 (7%)

Query: 1   MSGYFSSFSLDKLTNSISSAAHKTQDKLSTAIANIQLDDPQAKLSLKVRKHYLQETLGAI 60
           MS YF  FS +KLT+++++AAHKTQD LSTAIANIQLDDPQA LSLK RKHYLQETLG I
Sbjct: 1   MSSYFGGFSFNKLTDTLTNAAHKTQDTLSTAIANIQLDDPQAILSLKARKHYLQETLGTI 60

Query: 61  DDISKLPPQYQFLEKKCDSLEKICRRMLVVTKTFEVEGYDYPPNLSESISDWWGANRSGL 120
           +DISKLPPQYQ LEKKCDSLEK CRRMLVVTKTFEVEGYDYPPNLSES+SDWW +N+ GL
Sbjct: 61  EDISKLPPQYQLLEKKCDSLEKACRRMLVVTKTFEVEGYDYPPNLSESLSDWWSSNKEGL 120

Query: 121 LSFMDGKKGEGSRAKAEEKDENEGFLPRSFAQALSKAAKDSGDVLRTLXXXXXXXXXXXX 180
              M   K +  +            +PRSFAQA++KAAKDSGDVL  L            
Sbjct: 121 FGLMSSSKKD--KGAESAAAAKSALMPRSFAQAIAKAAKDSGDVLAAL-KDQEQQASADE 177

Query: 181 XXXXXXINSLITMFEAWSKCEQKIDQEKAEMDSLMAKEFNKKLDKLINEDFKKVHSLRKK 240
                 I  LI MF AWS+C+ KIDQ KAEMD+LMAKEFN+KL+ LI E FK    LR+K
Sbjct: 178 EDEDEDITPLIKMFSAWSECQYKIDQGKAEMDALMAKEFNQKLNALIEEKFKNASVLRRK 237

Query: 241 VEESRLKFDTLRYXXXXXXXXXXXXXXXXXXXXXVDVVEQNAPEEKAKTEGQETSEGKEH 300
           VE+SRLKFDT+RY                     V + EQ + +        E ++ KE 
Sbjct: 238 VEDSRLKFDTMRY--------------------EVKLTEQQSKQAME----NEKAQFKES 273

Query: 301 DLKADEKLSE--DTASKI--XXXXXXXXXXXXXXXHKLLEKLEDEFVSSTTEAVEIMGEI 356
           DL + E+ ++  +T++++                  +LLEKLEDEFVS+TTEAVE MGEI
Sbjct: 274 DLSSKEEGADANETSNEVGKSVTKTKEEQATNDAAQELLEKLEDEFVSNTTEAVETMGEI 333

Query: 357 TDSSEILSLVKLFHKFQLIYHRQCVQELEASTKILDGLDNE 397
           TDS+E+L+LVKLFH FQL+YHRQCVQ+LEAS   L+ L+ E
Sbjct: 334 TDSAELLNLVKLFHNFQLVYHRQCVQDLEASLSTLNELEGE 374

>Skud_16.443 Chr16 complement(780561..781823) [1263 bp, 420 aa] {ON}
           YPR148C (REAL)
          Length = 420

 Score =  379 bits (973), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 207/424 (48%), Positives = 265/424 (62%), Gaps = 32/424 (7%)

Query: 1   MSGYFSSFSLDKLTNSISSAAHKTQDKLSTAIA--NIQLDDPQAKLSLKVRKHYLQETLG 58
           MSGYFS FSL+K+T+SI++AAHKTQD L+ A+A  N+ L+DP+ +LS+K R  ++QE+LG
Sbjct: 1   MSGYFSGFSLNKITDSIATAAHKTQDTLNNALASANVNLNDPETRLSIKSRTRFVQESLG 60

Query: 59  AIDDISKLPPQYQFLEKKCDSLEKICRRMLVVTKTFEVEGYDYPPNLSESISDWWGANRS 118
            + DISKLPPQYQFLEKK DSLEK+CRR+L+V+KTFEVEGYDYPPNL+ESISDWW  N+ 
Sbjct: 61  TVSDISKLPPQYQFLEKKSDSLEKVCRRILLVSKTFEVEGYDYPPNLTESISDWWSVNKD 120

Query: 119 GLLSFMDGKKGEGSRAKAEEKDENEGFLPRSFAQALSKAAKDSGDVLRTLXXXXXXXXXX 178
           G   +   +K E +  K +  + ++ FLPRSFAQA+SKAA D     ++L          
Sbjct: 121 G---WFGSRKSENAN-KKKVSNHDDAFLPRSFAQAISKAAVDCECEFQSLKQDEKAGLKK 176

Query: 179 XXXXXXX-----------------XINSLITMFEAWSKCEQKIDQEKAEMDSLMAKEFNK 221
                                    +++LI +F++WS C + ID+ KAEMDS M KEFNK
Sbjct: 177 KSESNETAQDAEAQEEDEEDEEDEDLSNLIKVFDSWSTCYKNIDEGKAEMDSTMIKEFNK 236

Query: 222 KLDKLINEDFKKVHSLRKKVEESRLKFDTLRYXXXXXXXXXXXXXXXXXXXXXVDVVEQN 281
           KL+KLIN+DFKKVH LRKKVE+SRLKFDT+RY                        V  N
Sbjct: 237 KLEKLINKDFKKVHELRKKVEDSRLKFDTMRYEVKSKEAKLKAQKAETSKEVDDKAVSAN 296

Query: 282 APEEKAKTEGQETSEGKEHDLKADEK-----LSEDTASKIXXXXXXXXXXXXX----XXH 332
           AP    +    E       DL+ D K      + D A+ +                   +
Sbjct: 297 APISPDENPTTEDESPISKDLEGDSKKETSGSAADDAAVVKEDSKANQGDEPTIEDLEEN 356

Query: 333 KLLEKLEDEFVSSTTEAVEIMGEITDSSEILSLVKLFHKFQLIYHRQCVQELEASTKILD 392
           KLLEKLEDEFVS+TT AVEIM EITDSS+IL LVKLF  FQL+Y RQCVQE+EA+ K+L+
Sbjct: 357 KLLEKLEDEFVSNTTTAVEIMEEITDSSDILGLVKLFQNFQLVYFRQCVQEVEANLKVLN 416

Query: 393 GLDN 396
            L+N
Sbjct: 417 SLEN 420

>Ecym_1238 Chr1 (489922..491103) [1182 bp, 393 aa] {ON} similar to
           Ashbya gossypii AFR309C
          Length = 393

 Score =  357 bits (917), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 197/411 (47%), Positives = 257/411 (62%), Gaps = 43/411 (10%)

Query: 1   MSGYFSSFSLDKLTNSISSAAHKTQDKL-------STAIANIQLDDPQAKLSLKVRKHYL 53
           MS YFS+FSLDK+ ++I++AAHKTQ KL       + AI +I LDDPQ  LSL+ RKH L
Sbjct: 1   MSSYFSNFSLDKIASTINTAAHKTQQKLNETQEQLTHAIHSINLDDPQTMLSLRTRKHQL 60

Query: 54  QETLGAIDDISKLPPQYQFLEKKCDSLEKICRRMLVVTKTFEVEGYDYPPNLSESISDWW 113
           QETLG I DISKLPP+YQFLE+KCD+ EK+C R+LVV+KTFEV+GYDYPPNL+ESISDWW
Sbjct: 61  QETLGTIKDISKLPPRYQFLERKCDAFEKVCSRILVVSKTFEVDGYDYPPNLAESISDWW 120

Query: 114 GAN--RSGLLSFMDGKKGEGSRAKAE-----EKDENEGFLPRSFAQALSKAAKDSGDVLR 166
           G++  + G+  +  GKK +  + KAE     EK  NEG++P SFAQA+SKAA DS  +L+
Sbjct: 121 GSSSKKDGVF-WGFGKKSKNDKNKAEQKSSAEKKSNEGYIPPSFAQAISKAADDSITILK 179

Query: 167 TLXXXXXXXXXXXXXXXXXXINSLITMFEAWSKCEQKIDQEKAEMDSLMAKEFNKKLDKL 226
            L                  ++SL+ + EAW++ +  ID+ K +MD  M  EFNKKLD L
Sbjct: 180 ELNEEQLVNPSNGAETEDEDVDSLMPILEAWAEAQSNIDEAKQQMDQFMINEFNKKLDSL 239

Query: 227 INEDFKKVHSLRKKVEESRLKFDTLRYXXXXXXXXXXXXXXXXXXXXXVDVVEQNAPEEK 286
           +N DF KV +LRKKVEESRLKFDTLRY                     +++ +  A + K
Sbjct: 240 VNNDFLKVRALRKKVEESRLKFDTLRY--------------------ELEMRKSGASQTK 279

Query: 287 AKTEGQETSEGKEHDLKADEKLSEDTASKIXXXXXXXXXXXXXXXHK---LLEKLEDEFV 343
                 E+ +  + D     K +ED                     K   LLEK EDEFV
Sbjct: 280 ETFTTIESQQVNDKD-----KENEDNLKPTIHNNTGIGSSSDEEDQKFRLLLEKAEDEFV 334

Query: 344 SSTTEAVEIMGEITDSSEILSLVKLFHKFQLIYHRQCVQELEASTKILDGL 394
           S+TT+AV  M +ITDS  + +LVKLFH FQLIYH++CVQEL+AS  +++ L
Sbjct: 335 SNTTDAVAYMTQITDSVNLSTLVKLFHNFQLIYHKKCVQELQASLNVINTL 385

>Smik_16.401 Chr16 complement(698791..700074) [1284 bp, 427 aa] {ON}
           YPR148C (REAL)
          Length = 427

 Score =  353 bits (906), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 203/434 (46%), Positives = 261/434 (60%), Gaps = 45/434 (10%)

Query: 1   MSGYFSSFSLDKLTNSISSAAHKTQD--KLSTAIANIQLDDPQAKLSLKVRKHYLQETLG 58
           MSGYFSSFSL+K+T+SI++AAHKT D    + A AN+ L+DPQ +LS+K R  ++QE+LG
Sbjct: 1   MSGYFSSFSLNKITDSIATAAHKTHDTLNNALANANVNLNDPQTRLSIKSRTRFVQESLG 60

Query: 59  AIDDISKLPPQYQFLEKKCDSLEKICRRMLVVTKTFEVEGYDYPPNLSESISDWWGANRS 118
            I DISKLPPQYQFLEKK DSLEK+C+R+L+V+KTFEVEGYDYPPNL+ESISDWW  N+ 
Sbjct: 61  TISDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDWWSLNKD 120

Query: 119 GLLSFMDGKKGEGSRAKAEEKDENEGFLPRSFAQALSKAAKDSGDVLRTLXXXXXXXXXX 178
           G      G K      K +  + ++ FLPRSFAQA+SKAA D     + L          
Sbjct: 121 GWF----GSKKSEITNKKKGSNHDDAFLPRSFAQAISKAAVDCEFEFQNLENDEKAELKK 176

Query: 179 XXXXXXXX-----------------------INSLITMFEAWSKCEQKIDQEKAEMDSLM 215
                                          +++LI +F++WS C + ID+ K EMDS+M
Sbjct: 177 KRESTKNAQTTGAQDEENEEDEDEEEEEDEDLSNLIKVFDSWSTCYKNIDEGKTEMDSMM 236

Query: 216 AKEFNKKLDKLINEDFKKVHSLRKKVEESRLKFDTLRYXXXXXXXXXXXXXXXXXXXXXV 275
            KEFNKKL+KLIN+DFK+VH LRKKVE SRLKFDT+RY                      
Sbjct: 237 VKEFNKKLEKLINQDFKRVHELRKKVEISRLKFDTMRYEVKAKEAQLDAQKPGVTEEAHT 296

Query: 276 DVVEQNAP----------EEKAKTEGQETSEGKEHDLKADEKLSEDTA---SKIXXXXXX 322
             V  N            +EK K+     +E K+   +A+E++++D              
Sbjct: 297 KDVSANTATSLNEIPSTVDEKQKSNVNTEAESKK---EANEQVADDAVVMKEDPKDDKKD 353

Query: 323 XXXXXXXXXHKLLEKLEDEFVSSTTEAVEIMGEITDSSEILSLVKLFHKFQLIYHRQCVQ 382
                    +KLLEKLEDEFVS+TT AVE M EI DSSEIL L+KLF  FQL+Y RQCVQ
Sbjct: 354 DTPLEESEENKLLEKLEDEFVSNTTAAVETMEEIADSSEILGLIKLFQNFQLVYFRQCVQ 413

Query: 383 ELEASTKILDGLDN 396
           E+EA+ K+L+GL+N
Sbjct: 414 EVEANLKVLNGLEN 427

>YPR148C Chr16 complement(826833..828140) [1308 bp, 435 aa] {ON}
           Protein of unknown function that may interact with
           ribosomes, based on co-purification experiments; green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm in a punctate pattern
          Length = 435

 Score =  352 bits (903), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 209/442 (47%), Positives = 264/442 (59%), Gaps = 55/442 (12%)

Query: 1   MSGYFSSFSLDKLTNSISSAAHKTQD--KLSTAIANIQLDDPQAKLSLKVRKHYLQETLG 58
           MSGYFS FSL+K+T+SI++AAHKTQD    + A AN+ L+DPQ +LS+K R  ++QE+LG
Sbjct: 1   MSGYFSGFSLNKITDSIATAAHKTQDTLNNALANANVNLNDPQTRLSIKSRTRFVQESLG 60

Query: 59  AIDDISKLPPQYQFLEKKCDSLEKICRRMLVVTKTFEVEGYDYPPNLSESISDWWGANRS 118
            + DISKLPPQYQFLEKK DSLEK+C+R+L+V+KTFEVEGYDYPPNL+ESISDWW  N+ 
Sbjct: 61  TVSDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDWWSLNKD 120

Query: 119 GLLSFMDGKKGEGSRAKAEEKDENEGFLPRSFAQALSKAAKDSGDVLRTLXXXXXXXXXX 178
           G      G K   S  K +  + ++ FLPRSFAQA+SKAA D     + L          
Sbjct: 121 GWF----GSKKSESSTKKKGSNHDDAFLPRSFAQAISKAAVDCECEFQNLEHNEKAELKK 176

Query: 179 XXXXXXXX--------------------------INSLITMFEAWSKCEQKIDQEKAEMD 212
                                             +++LI +F++WS C + ID+ KAEMD
Sbjct: 177 KKESIKTAQTTEAQGADHNEEDEEDEEDEEDDEDLSNLIKVFDSWSTCYKNIDEGKAEMD 236

Query: 213 SLMAKEFNKKLDKLINEDFKKVHSLRKKVEESRLKFDTLRYXXXXXXXX-XXXXXXXXXX 271
           S+M KEFNKKL+ LIN+DFKKVH LRKKVEESRLKFDT+RY                   
Sbjct: 237 SMMVKEFNKKLETLINQDFKKVHDLRKKVEESRLKFDTMRYEVKAKEAELEAKKAEATGE 296

Query: 272 XXXVDVVEQN--------------APEEKAKTEGQETSEGKEHDLKADEKLSEDTASK-- 315
               DV  ++                +EK K+EG E    KE    A+E   +D A +  
Sbjct: 297 AHSKDVSAKDISANTTTSFDETPSTEDEKPKSEGAEEESKKE----ANEPTVDDVADRKE 352

Query: 316 --IXXXXXXXXXXXXXXXHKLLEKLEDEFVSSTTEAVEIMGEITDSSEILSLVKLFHKFQ 373
                             +KLLEKLEDEFVS+TT AVE M EITDSSEIL L+KLF  FQ
Sbjct: 353 DLKSNKVNDEPPIEESEDNKLLEKLEDEFVSNTTAAVETMEEITDSSEILGLIKLFQNFQ 412

Query: 374 LIYHRQCVQELEASTKILDGLD 395
           L+Y RQCVQE+EA+ K+L+GL+
Sbjct: 413 LVYFRQCVQEVEANLKVLNGLE 434

>KLLA0E04621g Chr5 (412009..413178) [1170 bp, 389 aa] {ON} some
           similarites with uniprot|Q06523 Saccharomyces cerevisiae
           YPR148C Protein of unknown function green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           in a punctate pattern
          Length = 389

 Score =  343 bits (880), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 196/419 (46%), Positives = 252/419 (60%), Gaps = 59/419 (14%)

Query: 5   FSSFSLDKLTNSISSAAHKTQDKLSTAIANIQLDDPQAKLSLKVRKHYLQETLGAIDDIS 64
           FS  SL+ +T+SIS+AA +TQ++ S+AI  I LDDP+ +LS+  R+H LQETLG + DIS
Sbjct: 2   FSKLSLNNITDSISNAAQRTQEQFSSAIEKIHLDDPETRLSILKRRHQLQETLGTVHDIS 61

Query: 65  KLPPQYQFLEKKCDSLEKICRRMLVVTKTFEVEGYDYPPNLSESISDWWGANRSGLLSFM 124
           +LP QY+FLE+K D+LEKIC+R+L+VTKTFEVEGYDYPPNL+ES +DWW  N+  + SF 
Sbjct: 62  QLPIQYKFLEQKSDALEKICKRLLLVTKTFEVEGYDYPPNLTESFNDWWSGNKDSIFSF- 120

Query: 125 DGKKGEGSRAKAEEKDENEGFLPRSFAQALSKAAKDSGDVLRTLXXXXXXXXXXXXXX-- 182
             KK E S  + +E  EN G LPRSFAQALSKAA DS  +L+ L                
Sbjct: 121 SKKKAEVS-PEVKETAEN-GLLPRSFAQALSKAATDSALILKQLKAEETRTNQEESQEGA 178

Query: 183 -----------------------XXXXINSLITMFEAWSKCEQKIDQEKAEMDSLMAKEF 219
                                      +++LI  FE+W+KC+  IDQ KAEMDSLM KEF
Sbjct: 179 DQKPAEETKAEPELEAEADEDEDEDEDVDNLIKAFESWTKCQLSIDQSKAEMDSLMVKEF 238

Query: 220 NKKLDKLINEDFKKVHSLRKKVEESRLKFDTLRYXXXXXXXXXXXXXXXXXXXXXVDVVE 279
           N KL KLI  DFKK H LR KV+++RL FDTLR+                       V  
Sbjct: 239 NAKLSKLIETDFKKGHELRAKVQDARLNFDTLRHEIKLKLQEKEV------------VAS 286

Query: 280 QNAPEEKAKTEGQETSEGKEHDLKAD-EKLSEDTASKIXXXXXXXXXXXXXXXHKLLEKL 338
               E+K  TE  ET E K ++   D  K  ED  S                  KL E+L
Sbjct: 287 SEEAEKKVATETPETPEKKTNEEPVDMAKTEEDPDS------------------KLFERL 328

Query: 339 EDEFVSSTTEAVEIMGEITDSSEILSLVKLFHKFQLIYHRQCVQELEASTKILDGLDNE 397
           ED+FVS+T+E VE +GE+TDSSEI+SLVKLFH FQLI+++QCV+ LE   ++L+ LD+E
Sbjct: 329 EDQFVSATSETVEFLGELTDSSEIISLVKLFHNFQLIHYKQCVKSLEEDLEVLNSLDSE 387

>ZYRO0D10010g Chr4 (845993..847141) [1149 bp, 382 aa] {ON} similar
           to uniprot|Q06523 Saccharomyces cerevisiae YPR148C
           Protein of unknown function green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm in a
           punctate pattern
          Length = 382

 Score =  334 bits (857), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 183/399 (45%), Positives = 242/399 (60%), Gaps = 20/399 (5%)

Query: 1   MSGYFSSFSLDKLTNSISSAAHKTQDKLSTAIANIQLDDPQAKLSLKVRKHYLQETLGAI 60
           MS YFSSFS   L +SI++AAH+TQDKLS A+AN+ L+DPQ +LS+K R  YL+ETLGA+
Sbjct: 1   MSEYFSSFSFKNLGDSIANAAHRTQDKLSNAVANVNLNDPQTRLSIKTRTRYLKETLGAV 60

Query: 61  DDISKLPPQYQFLEKKCDSLEKICRRMLVVTKTFEVEGYDYPPNLSESISDWWGANRSGL 120
           D+ISKLPPQY  LE+K D+LEK C+RML+VT+TFEVEGYDYPPNL ES SDWW  ++ G 
Sbjct: 61  DEISKLPPQYVLLERKSDALEKACKRMLLVTQTFEVEGYDYPPNLPESFSDWWSGSKEGW 120

Query: 121 LSFMDGKKGEGSRAKAE-EKDENEGFLPRSFAQALSKAAKDSGDVLRTLXXXXXXXXXXX 179
             F   K+ E   +K + +    +  +PRSFAQA++KA+ + G+  +             
Sbjct: 121 --FGSTKQDEDGESKIQTDGSSKDPLMPRSFAQAIAKASHECGEAYQN----SQKSEKKQ 174

Query: 180 XXXXXXXINSLITMFEAWSKCEQKIDQEKAEMDSLMAKEFNKKLDKLINEDFKKVHSLRK 239
                  +N L+ MF   S C + ID+ K EMD  +A+EFN KL++L+N DFKK+H LR 
Sbjct: 175 IDEDEDDVN-LVEMFNTLSICYRNIDEGKDEMDKSIAREFNDKLEQLLNRDFKKIHVLRN 233

Query: 240 KVEESRLKFDTLRYXXXXXXXXXXXXXXXXXXXXXVDVVEQNAPEEKAKTEGQETSE--G 297
           KVE SRLKFDT+RY                           NA E  +    QE +    
Sbjct: 234 KVENSRLKFDTMRYEMRLKEKEEKEENENTA----------NADEGPSNKNQQEPTNEPA 283

Query: 298 KEHDLKADEKLSEDTASKIXXXXXXXXXXXXXXXHKLLEKLEDEFVSSTTEAVEIMGEIT 357
           KE +     + +E   +                 +KLLE+LEDEFVS+T+EAVE M  I 
Sbjct: 284 KEEEKPTPAEPAEAQHTTKTENSNKEPMVEKPEDNKLLEQLEDEFVSNTSEAVETMTSIV 343

Query: 358 DSSEILSLVKLFHKFQLIYHRQCVQELEASTKILDGLDN 396
           + SEIL L+KLF   QL+Y+RQCVQE+EAS K L+ L+N
Sbjct: 344 EGSEILRLMKLFQNLQLVYYRQCVQEMEASLKGLNDLEN 382

>TDEL0D05590 Chr4 complement(1008107..1009141) [1035 bp, 344 aa]
           {ON} Anc_3.491 YPR148C
          Length = 344

 Score =  328 bits (840), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 184/397 (46%), Positives = 243/397 (61%), Gaps = 55/397 (13%)

Query: 1   MSGYFSSFSLDKLTNSISSAAHKTQDKLSTAIANIQLDDPQAKLSLKVRKHYLQETLGAI 60
           MSGY S+FSL+K+T+++++AAHKTQD L++AIAN+   DPQAKLSLK R  YLQETLG I
Sbjct: 1   MSGYLSNFSLNKITDTLANAAHKTQDTLNSAIANVS--DPQAKLSLKARTRYLQETLGTI 58

Query: 61  DDISKLPPQYQFLEKKCDSLEKICRRMLVVTKTFEVEGYDYPPNLSESISDWWGANRSGL 120
           DD SKLPPQYQ LEKK D+LEK C+R+L+VT+TFEVEGYDYPPNL+ESISDWW  N+ G 
Sbjct: 59  DDKSKLPPQYQSLEKKSDALEKCCKRILLVTRTFEVEGYDYPPNLTESISDWWSLNKDG- 117

Query: 121 LSFMDGKKGEGSRAKAEEKDENEGFLPRSFAQALSKAAKDSGDVLRTLXXXXXXXXXXXX 180
             +   KK E  + K +  D ++ FLPRSF+QA+SKAA D   V   L            
Sbjct: 118 --WFGTKKPE--KTKNDSSDGSDAFLPRSFSQAISKAANDCNSVFTNL------QEHGDE 167

Query: 181 XXXXXXINSLITMFEAWSKCEQKIDQEKAEMDSLMAKEFNKKLDKLINEDFKKVHSLRKK 240
                 ++++  MF++WSKC + ID+ K EMDS++ KEFN KL+K+INEDFKKVH+ RKK
Sbjct: 168 DEEDEDVSNVAKMFDSWSKCYKNIDEGKHEMDSMIRKEFNTKLEKIINEDFKKVHASRKK 227

Query: 241 VEESRLKFDTLRYXXXXXXXXXXXXXXXXXXXXXVDVVEQNAPEEKAKTEGQETSEGKEH 300
           VEESRLKFDT+RY                      +  E +  E K + E  +TSE  + 
Sbjct: 228 VEESRLKFDTVRY--------EIKLKETENAKKSTETDEASKDETKTEEEPPKTSEEDKL 279

Query: 301 DLKADEKLSEDTASKIXXXXXXXXXXXXXXXHKLLEKLEDEFVSSTTEAVEIMGEITDSS 360
             + +++   +T + +                        E +   TE+ EI+G      
Sbjct: 280 LEELEDEFVSNTTAAV------------------------EIMGEVTESAEILG------ 309

Query: 361 EILSLVKLFHKFQLIYHRQCVQELEASTKILDGLDNE 397
               L KLF  FQL+Y RQCVQE+EAS KIL  L+++
Sbjct: 310 ----LAKLFQNFQLVYFRQCVQEVEASLKILGALESD 342

>Suva_16.477 Chr16 complement(823311..824582) [1272 bp, 423 aa] {ON}
           YPR148C (REAL)
          Length = 423

 Score =  322 bits (825), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 187/432 (43%), Positives = 251/432 (58%), Gaps = 45/432 (10%)

Query: 1   MSGYFSSFSLDKLTNSISSAAHKTQDKLSTAIAN--IQLDDPQAKLSLKVRKHYLQETLG 58
           MSGY+     +K+T+SI++AAHKTQD L++A+AN  + L+DPQ +LS+K R  ++QE+LG
Sbjct: 1   MSGYW-----NKITDSIATAAHKTQDTLNSALANANVNLNDPQTRLSIKSRTRFVQESLG 55

Query: 59  AIDDISKLPPQYQFLEKKCDSLEKICRRMLVVTKTFEVEGYDYPPNLSESISDWWGANRS 118
            + DISKLPPQYQFLEKK DSLEK+C+R+L+V+KTFEVEGYDYPPNL+ESISDWW  N+ 
Sbjct: 56  TVSDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDWWSLNKD 115

Query: 119 GLLSFMDGKKGEGSRAKAEEKDENEGFLPRSFAQALSKAAKDSGDVLRTLXXXXXXXXXX 178
           G      G K     +K ++ + ++ FLPRSFAQA+SKAA D     + L          
Sbjct: 116 GWF----GSKKTEHASKKKDSNHDDTFLPRSFAQAISKAAVDCESEFKNLEQNEKEDLKQ 171

Query: 179 XXXXXXXX---------------------INSLITMFEAWSKCEQKIDQEKAEMDSLMAK 217
                                        +++LI +F++WS C + ID+ KAEMDS+M K
Sbjct: 172 KKEAKKTTQETAEQEEEEEEEEEEEDDEDLSNLIKVFDSWSTCYKNIDEGKAEMDSMMVK 231

Query: 218 EFNKKLDKLINEDF-------KKVHSLRKKVE----ESRLKFDTLRYXXXXXXXXXXXXX 266
           EFNKKL+KLINEDF       +KV   R K +    E + K + LR              
Sbjct: 232 EFNKKLEKLINEDFKKVHELRRKVEESRLKFDTMRYEGKSKEEQLRAQKDETSKEADNND 291

Query: 267 XXXXXXXXVDVV--EQNAPEEKAKTEGQETSEGKEHDLKADEKLSEDTASKIXXXXXXXX 324
                    + +  E+ A +E      +E  +  E D+       +   +          
Sbjct: 292 NSANSTSLEEALTAEKKAEKEDDAKVPEEEPKKVETDVTTANDDIDTNENPKQQPTNNQP 351

Query: 325 XXXXXXXHKLLEKLEDEFVSSTTEAVEIMGEITDSSEILSLVKLFHKFQLIYHRQCVQEL 384
                  +KLLEKLEDEFVS+TT AVE M EITDSSEILSLVKLF  FQL+Y RQC QE+
Sbjct: 352 PVEDSEENKLLEKLEDEFVSNTTAAVETMEEITDSSEILSLVKLFQNFQLVYFRQCAQEV 411

Query: 385 EASTKILDGLDN 396
           EA+ K+L+G++N
Sbjct: 412 EANLKVLNGMEN 423

>AFR309C Chr6 complement(1000078..1001172) [1095 bp, 364 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR148C
          Length = 364

 Score =  300 bits (768), Expect = 7e-99,   Method: Compositional matrix adjust.
 Identities = 172/402 (42%), Positives = 223/402 (55%), Gaps = 48/402 (11%)

Query: 1   MSGYFSSFSLDKLTNSISSAAHKTQDKLST-------AIANIQLDDPQAKLSLKVRKHYL 53
           MS YF + SLDKL N++++AA KTQ KLS        AI NI++DDP+  LSLK RK  L
Sbjct: 1   MSAYFGAISLDKLANTLNNAAQKTQQKLSETQEHLTHAIQNIKIDDPKTILSLKTRKRQL 60

Query: 54  QETLGAIDDISKLPPQYQFLEKKCDSLEKICRRMLVVTKTFEVEGYDYPPNLSESISDWW 113
           QETLG+  DIS+LPPQY FLE+KCD++E++C+++LVV+KTFEVEGYDYPPN +ESISDWW
Sbjct: 61  QETLGSAKDISQLPPQYGFLERKCDAIEQVCKKILVVSKTFEVEGYDYPPNPTESISDWW 120

Query: 114 GANRSGLLSFMDGKKGEGSRAKAEEKDENEGFLPRSFAQALSKAAKDSGDVLRTLXXXXX 173
             +         GK G   + + ++K       P SFA AL +AAK S  +++       
Sbjct: 121 NTSTKETRFLKFGKGGTDKQKEDKQKQAAGSSDPPSFAHALHRAAKGSQGIIQE-LKEQA 179

Query: 174 XXXXXXXXXXXXXINSLITMFEAWSKCEQKIDQEKAEMDSLMAKEFNKKLDKLINEDFKK 233
                        + SLI MF  W+  +  +D  K EMD  M KEFN+KL  L+  +FKK
Sbjct: 180 EEEQEQEVEIDEDVESLIKMFGTWADAQYNMDIAKREMDQFMVKEFNEKLKHLLEVEFKK 239

Query: 234 VHSLRKKVEESRLKFDTLRYXXXXXXXXXXXXXXXXXXXXXVDVVEQNAPEEKAKTEGQE 293
            H+LR+KVEESRL FDTL+Y                      D       +E  + EG  
Sbjct: 240 GHTLRRKVEESRLTFDTLKYEQHER-----------------DAALAKKQDEAKQAEGAT 282

Query: 294 TSEGKEHDLKADEKLSEDTASKIXXXXXXXXXXXXXXXHKLLEKLEDEFVSSTTEAVEIM 353
            S G      AD                          +  LE  EDEFVS+T EAVE M
Sbjct: 283 PSTGVTQSSTAD-----------------------LAFYAQLEDAEDEFVSNTAEAVEFM 319

Query: 354 GEITDSSEILSLVKLFHKFQLIYHRQCVQELEASTKILDGLD 395
             I D+++++SLVKLF  FQL+YHR+CVQELE S   L  L+
Sbjct: 320 TSIADATKLISLVKLFQNFQLVYHRKCVQELEVSLNSLTSLE 361

>Kpol_1017.7 s1017 (27496..28272,28322..28330,28419..28769) [1137
           bp, 378 aa] {ON}
           (27496..28272,28322..28330,28419..28769) [1137 nt, 379
           aa]
          Length = 378

 Score =  283 bits (724), Expect = 4e-92,   Method: Compositional matrix adjust.
 Identities = 169/404 (41%), Positives = 231/404 (57%), Gaps = 41/404 (10%)

Query: 5   FSSFSLDKLTNSISSAAHKTQDKLSTAIANIQ------LDDPQAKLSLKVRKHYLQETLG 58
           FS FS+DKLT+SIS+ A KTQ+ L+ A++N+       L+DP  KLS+K +  ++QE LG
Sbjct: 2   FSGFSIDKLTDSISNVALKTQENLTNALSNVNENLENYLNDPNTKLSIKSKARFIQEKLG 61

Query: 59  AIDD-ISKLPPQYQFLEKKCDSLEKICRRMLVVTKTFEVEGYDYPPNLSESISDWWGANR 117
            I+D  SKLPP Y  LE K D++EK  +R+L VTKT+E EGYDYPPNL+ES+SDWW    
Sbjct: 62  TINDQPSKLPPTYTDLELKTDAIEKALKRLLTVTKTYETEGYDYPPNLTESLSDWWT--- 118

Query: 118 SGLLSFMDGKKGEGSRAKAEEKDEN----EGFLPRSFAQALSKAAKDSGDVLRTLXXXXX 173
                       + +    +E DEN    + FLPRSFAQA+S A+ D+   + ++     
Sbjct: 119 -----------NDDNVTNTDENDENIQSNKSFLPRSFAQAISNASFDAASNVNSVTNTIK 167

Query: 174 XXXXXXXXXXXXXI--NSLITMFEAWSKCEQKIDQEKAEMDSLMAKEFNKKLDKLINEDF 231
                           + L  +FE+   C + ID  K EMD L+  EFN KL  LIN +F
Sbjct: 168 LNHKDDEEEEEDDEEWSDLHKIFESLGNCYRNIDNGKTEMDKLIVNEFNNKLKDLINTEF 227

Query: 232 KKVHSLRKKVEESRLKFDTLRYXXXXXXXXXXXXXXXXXXXXXVDVVEQNAPEEKAKTEG 291
           K VH LRK VE SRLKFDT+RY                     V     +  E   K   
Sbjct: 228 KNVHQLRKSVENSRLKFDTMRYELKIKEWKRTXXXMEAEDKSDVSKKGTSKKETPKKEAS 287

Query: 292 QETSEGKEHDLKADEKLSEDTASKIXXXXXXXXXXXXXXXHKLLEKLEDEFVSSTTEAVE 351
           ++ +  KE + K D     +T +                 +KLLEKLEDEFVS+T  AVE
Sbjct: 288 KKETPKKEINKKEDITNEGNTEN--------------DNDNKLLEKLEDEFVSNTQNAVE 333

Query: 352 IMGEITDSSEILSLVKLFHKFQLIYHRQCVQELEASTKILDGLD 395
            M E+TD+S+I++LVKL+  FQL+Y++QC+QE+E++ KIL+GL+
Sbjct: 334 KMEELTDNSKIINLVKLYQNFQLVYYKQCIQEIESNLKILNGLE 377

>TPHA0D03270 Chr4 complement(673063..674229) [1167 bp, 388 aa] {ON}
           Anc_3.491 YPR148C
          Length = 388

 Score =  271 bits (692), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 177/426 (41%), Positives = 232/426 (54%), Gaps = 77/426 (18%)

Query: 5   FSSFSLDKLTNSISSAAHKTQDKLSTAIANIQ------LDDPQAKLSLKVRKHYLQETLG 58
           FS+FSLDKLT+SIS+ A KTQ+  + AI ++       L+DP  KLS++ R  Y+QE LG
Sbjct: 2   FSNFSLDKLTDSISNVALKTQENFTNAITDLNNNIETILNDPNTKLSIRARSRYIQEQLG 61

Query: 59  AIDD-ISKLPPQYQFLEKKCDSLEKICRRMLVVTKTFEVEGYDYPPNLSESISDWWGANR 117
            +DD ISKLP QY  LE K DS+EKI +R+L+VT TF  EGYDYPPNL+ESISDWW    
Sbjct: 62  TLDDEISKLPQQYVELEIKTDSVEKILKRLLLVTNTFATEGYDYPPNLTESISDWWA--- 118

Query: 118 SGLLSFMDGKKGEGSRAKAEEKDENEGFLPRSFAQALSKAAKDSGDVL----RTLXXXXX 173
                              +E  EN+ FLPRSFAQAL+KA  DS  +     R +     
Sbjct: 119 ------------------EDETTENKNFLPRSFAQALAKAYSDSKLITDKAERNIKLQTS 160

Query: 174 XXXX-------------XXXXXXXXXINSLITM---FEAWSKCEQKIDQEKAEMDSLMAK 217
                                        L+T+   F+A S     ID  K EMD+++  
Sbjct: 161 PKNTGTKDENPEAGAEEEVEADDDEEDEDLVTLGKAFKALSNSFTNIDNGKNEMDTMIVN 220

Query: 218 EFNKKLDKLINEDFKKVHSLRKKVEESRLKFDTLRYXXXXXXXXXXXXXXXXXXXXXVDV 277
           EFNKKL+ L+  +FK+V  LR+ VE SRLKFDT+RY                     V +
Sbjct: 221 EFNKKLEHLLEVEFKEVAQLRRNVENSRLKFDTMRY--------------------DVKL 260

Query: 278 VEQNAPEEKAK-------TEGQETSEGKEHDLKA-DEKLSEDTASKIXXXXXXXXXXXXX 329
            E  A +E+AK        E +E SE KE + K  +EK  E   ++              
Sbjct: 261 KEAKAEQEEAKEVSTDKEIEKKE-SETKEPETKGTEEKEPETKDTEEKDPVKENEGENED 319

Query: 330 XXHKLLEKLEDEFVSSTTEAVEIMGEITDSSEILSLVKLFHKFQLIYHRQCVQELEASTK 389
             +KLLE+LEDEFVS+T+ AVE M E+TDS++IL LVKLF  FQL+Y+RQCVQE+E + K
Sbjct: 320 EDYKLLEQLEDEFVSNTSSAVEKMEELTDSAKILDLVKLFQNFQLVYYRQCVQEIENNLK 379

Query: 390 ILDGLD 395
            +  L+
Sbjct: 380 TISDLE 385

>CAGL0L08492g Chr12 (931048..932205) [1158 bp, 385 aa] {ON} similar
           to uniprot|Q06523 Saccharomyces cerevisiae YPR148c
          Length = 385

 Score =  270 bits (690), Expect = 7e-87,   Method: Compositional matrix adjust.
 Identities = 164/415 (39%), Positives = 229/415 (55%), Gaps = 59/415 (14%)

Query: 8   FSLDKLTNSISSAAHKTQDKLSTAIANIQLDDPQAKLSLKVRKHYLQETLGAIDDISKLP 67
           F+L+ +T SIS     TQ  +       Q +DP+ KLS+K +  +LQE +G   DISKLP
Sbjct: 4   FNLESITQSISEG---TQSLVQ------QFNDPKTKLSIKAKTRFLQEAIGNERDISKLP 54

Query: 68  PQYQFLEKKCDSLEKICRRMLVVTKTFEVEGYDYPPNLSESISDWWGA----NRSGLLSF 123
           PQY  LEKKCDS+EK+ +R+L+VTKT+E+EGYDYPPN+SES+S WW      N S L   
Sbjct: 55  PQYVVLEKKCDSIEKVLKRILIVTKTYEIEGYDYPPNISESLSSWWQTKEWFNISELTKN 114

Query: 124 MDGKKG-------EGSRAKAEEKDENEGFLPRSFAQALSKAAKDSGDVLRTLXXXXXXXX 176
           +  K G       E S+   +++  +EG  P SFA A+++A KDS  +  ++        
Sbjct: 115 VIPKHGNVEKAGTEASKTLTDKEVSHEG--PPSFASAIARAGKDSQLIFESIETKDEDEK 172

Query: 177 XXXXXXXXXXINSLITMFEAWSKCEQKIDQEKAEMDSLMAKEFNKKLDKLINEDFKKVHS 236
                        L+ +F+ WS C  +I   K EMD +M KEFN KL+  + ++F+K+H+
Sbjct: 173 EDID--------ELVKIFKIWSDCFYEISDSKTEMDQMMIKEFNVKLEDYLQKNFQKIHT 224

Query: 237 LRKKVEESRLKFDTLRYXXXXXXXXXXXX---XXXXXXXXXVDVVEQNAPEEKAKTEGQE 293
           LR KVEESRL FDT+RY                        +D  + N  E++A  +  E
Sbjct: 225 LRAKVEESRLNFDTMRYEVAQTSKQTDSKELGNEDETKPSSMDANKTNTEEKEAANDKVE 284

Query: 294 TSEGKE------------HDLKADEKLSEDTASKIXXXXXXXXXXXXXXXHKLLEKLEDE 341
           T E  E             D K  E L ED+ +                  +LLE+LEDE
Sbjct: 285 TKEKTETNATIADETKETKDTKDSEDLKEDSKT--------------STDGQLLEQLEDE 330

Query: 342 FVSSTTEAVEIMGEITDSSEILSLVKLFHKFQLIYHRQCVQELEASTKILDGLDN 396
           FVS+TTEAVE+M E++++SE+LSL+KLF  FQL YH+ CV+ LE S K L+ +DN
Sbjct: 331 FVSNTTEAVEVMTEVSENSELLSLIKLFQTFQLSYHQHCVKSLEQSLKDLNAIDN 385

>KAFR0G03680 Chr7 complement(760604..761851) [1248 bp, 415 aa] {ON}
           Anc_3.491 YPR148C
          Length = 415

 Score =  258 bits (660), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 169/434 (38%), Positives = 231/434 (53%), Gaps = 63/434 (14%)

Query: 5   FSSFSLDKLTNSISSAAHKTQDKLSTAIANIQLDDPQAKLSLKVRKHYLQETLGAIDD-- 62
           FS+F+ DK+TNSIS+AA   Q K++  I      D Q KL  K    + QE +G I D  
Sbjct: 2   FSNFNFDKITNSISTAAQSAQQKINDTILT---PDVQTKLHFKKTARFWQEKVGQIPDKE 58

Query: 63  ISKLPPQYQFLEKKCDSLEKICRRMLVVTKTFEVEGYDYPPNLSESISDWWGANRSGLLS 122
           ISKLP  Y  LE K D+LEKI +R+L+VTKT+E+EGYDYPPNLSES++DWW +       
Sbjct: 59  ISKLPEGYLNLENKVDALEKILKRLLIVTKTYEIEGYDYPPNLSESLNDWWWS------- 111

Query: 123 FMDGKKGEGSRAKAEEKDENEGFLPRSFAQALSKAAKDSGDVL-------RTLXXXXXXX 175
             D KK +  + K+        F+  SF  A+SKAA DS  +L       + L       
Sbjct: 112 --DLKKSKKHQEKS-------SFMNNSFPMAISKAAFDSKSILDDLKEKQQDLPKEGEEP 162

Query: 176 XXXXXXXXXXXINSLITMFEAWSKCEQKIDQEKAEMDSLMAKEFNKKLDKLINEDFKKVH 235
                        +L+ +F + S C + ID+ KAEMD+++ KEFN KL+ LIN DFKKV 
Sbjct: 163 EEEVEEEDDDEFLNLLEVFNSLSNCYKNIDKSKAEMDAMIVKEFNFKLEHLINNDFKKVS 222

Query: 236 SLRKKVEESRLKFDTLRYXXXXXXXXXXXXXXXXXXXXXV---DVVEQNAPEEKAKTEGQ 292
            LR KV++SRL+FDTLR+                     V   D  ++  P+E++  E Q
Sbjct: 223 KLRTKVQDSRLEFDTLRHEIKLKELAQESIRQENSQKTDVFKEDSTKEVPPKEESTKEEQ 282

Query: 293 -------------------------------ETSEGKEHDLKADEKLSEDTASKIXXXXX 321
                                          E +E KE +  A E  S++ A K      
Sbjct: 283 VNEESNKEETEKKKITEDKPAEDVVEKKTVEEQAEAKETEKPAKEGSSKEEAPK-EDVKH 341

Query: 322 XXXXXXXXXXHKLLEKLEDEFVSSTTEAVEIMGEITDSSEILSLVKLFHKFQLIYHRQCV 381
                     +KLLEKLEDEFVS+T  AVE+M E+T++SE+++LVKLF  FQLI+++QCV
Sbjct: 342 NGSSEEETEEYKLLEKLEDEFVSNTGAAVELMTELTETSEVINLVKLFQNFQLIHYKQCV 401

Query: 382 QELEASTKILDGLD 395
           QE+E + K LD L+
Sbjct: 402 QEIENNMKFLDQLE 415

>NCAS0F03540 Chr6 complement(707257..708591) [1335 bp, 444 aa] {ON}
           Anc_3.491 YPR148C
          Length = 444

 Score =  241 bits (616), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 128/258 (49%), Positives = 168/258 (65%), Gaps = 25/258 (9%)

Query: 5   FSSFSLDKLTNSISSAAHKTQDKLSTAIANIQLDDPQAKLSLKVRKHYLQETLGAIDDIS 64
           FS+FSLDK+TNS+++AA KT D LS AI      DP  KLSL+ +K   QE++G + DIS
Sbjct: 2   FSNFSLDKITNSLATAAQKTSDTLSNAITTAT--DPATKLSLRSQKRLFQESIGTVHDIS 59

Query: 65  KLPPQYQFLEKKCDSLEKICRRMLVVTKTFEVEGYDYPPNLSESISDWWGANRSGLLSFM 124
            LP QY  LE + D+LEK  RR+L+V+KTFE+EGYDYPPNLSES SDWW  +        
Sbjct: 60  TLPEQYTTLEARTDALEKCLRRILIVSKTFEMEGYDYPPNLSESFSDWWSLS-------- 111

Query: 125 DGKKGEGSRAKAEEKDENEGFLPRSFAQALSKAAKDS---------GDVLRTLXXXXXXX 175
                   + K +EK++ +GFLPRSFAQA+S +A+D          GD            
Sbjct: 112 ------SKKKKEQEKEDKKGFLPRSFAQAISNSAEDCVEIYQHVNDGDDEDKEENANNEE 165

Query: 176 XXXXXXXXXXXINSLITMFEAWSKCEQKIDQEKAEMDSLMAKEFNKKLDKLINEDFKKVH 235
                      + +LI  F++W+KC + IDQ KAEMDS+M KEFN KL+KL+NE+FKKVH
Sbjct: 166 ENEEEDEEDEDVKNLIKTFDSWAKCYKNIDQGKAEMDSMMMKEFNAKLEKLLNEEFKKVH 225

Query: 236 SLRKKVEESRLKFDTLRY 253
           +LRK+V++SRLKFDT+RY
Sbjct: 226 TLRKRVKDSRLKFDTVRY 243

 Score = 95.5 bits (236), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 54/64 (84%)

Query: 332 HKLLEKLEDEFVSSTTEAVEIMGEITDSSEILSLVKLFHKFQLIYHRQCVQELEASTKIL 391
           HKLLE+LED FVSST  AVE+M EITDSSEI+ LVKLF  FQL+Y+RQCVQE+EA+ K L
Sbjct: 380 HKLLEQLEDTFVSSTASAVEMMEEITDSSEIIGLVKLFQNFQLVYYRQCVQEIEANLKTL 439

Query: 392 DGLD 395
           + L+
Sbjct: 440 NELE 443

>NDAI0B05850 Chr2 complement(1418191..1419612) [1422 bp, 473 aa]
           {ON} Anc_3.491 YPR148C
          Length = 473

 Score =  233 bits (595), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 131/284 (46%), Positives = 166/284 (58%), Gaps = 37/284 (13%)

Query: 5   FSSFSLDKLTNSISSAAHKTQDKLSTAIANIQLDDPQAKLSLKVRKHYLQETLGAIDDIS 64
           FSSFSLDK+TNSI +AA K  + L+ AI      DPQ KLS+K +    QE LG I DIS
Sbjct: 2   FSSFSLDKITNSIGNAAQKATNTLNNAINTAT--DPQTKLSIKSQTRLFQEQLGTIHDIS 59

Query: 65  KLPPQYQFLEKKCDSLEKICRRMLVVTKTFEVEGYDYPPNLSESISDWWG------ANRS 118
           KLP QY+ LE K DSLEK  +R+L+V+KTFE+EGYDYPPNL+ES SDWW       ++R 
Sbjct: 60  KLPDQYKSLELKTDSLEKSIKRILLVSKTFEMEGYDYPPNLTESFSDWWNITKKSSSHRK 119

Query: 119 GLLSF-------MDGKKGEGSRAKAEEKD-ENEGFLPRSFAQALSKAAKDSGDVLRTLXX 170
             +S         D      +  +  E D  +  FLPRSFAQA+SK+A D  D+ + L  
Sbjct: 120 KQISVNNKKKNNTDNDHDNATNVEPIENDITSSSFLPRSFAQAISKSAMDCTDIYQQLSI 179

Query: 171 XXXXXXXXXXXXXXXX---------------------INSLITMFEAWSKCEQKIDQEKA 209
                                                I +LI  FE+WS C + IDQ K+
Sbjct: 180 QETATKETTIKDENEAQEEDDEDAGEEEEEDDDDDEDIQNLIKAFESWSNCYKNIDQGKS 239

Query: 210 EMDSLMAKEFNKKLDKLINEDFKKVHSLRKKVEESRLKFDTLRY 253
           EMDS+M KEFN KL+ LIN +FKKV++LRKKV +SRLKFDT+R+
Sbjct: 240 EMDSMMTKEFNNKLEDLINNEFKKVNTLRKKVADSRLKFDTVRH 283

 Score = 96.3 bits (238), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 44/64 (68%), Positives = 54/64 (84%)

Query: 332 HKLLEKLEDEFVSSTTEAVEIMGEITDSSEILSLVKLFHKFQLIYHRQCVQELEASTKIL 391
           HKLLE+LEDEFVSST  AVE+M EIT+SS I+ L+KLF  FQL+Y+RQCVQE+EA+ K L
Sbjct: 408 HKLLEQLEDEFVSSTASAVEMMTEITESSSIIGLIKLFQNFQLVYYRQCVQEIEANLKTL 467

Query: 392 DGLD 395
           + LD
Sbjct: 468 NELD 471

>KNAG0A07930 Chr1 complement(1265981..1267339) [1359 bp, 452 aa]
           {ON} Anc_3.491 YPR148C
          Length = 452

 Score =  180 bits (457), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 106/280 (37%), Positives = 152/280 (54%), Gaps = 48/280 (17%)

Query: 5   FSSFSLDKLTNSISSAAHKTQDKLSTAIANIQLDDPQAKLSLKVRKHYLQETLGAI--DD 62
           FS+FSLDKLT++I++AA   QD +   I +    D Q KL       Y QE +G I  D+
Sbjct: 2   FSNFSLDKLTSTITNAAQSAQDTIHNTILS---PDAQTKLQFLKTTRYFQEKVGTISEDE 58

Query: 63  ISKLPPQYQFLEKKCDSLEKICRRMLVVTKTFEVEGYDYPPNLSESISDWWGANRSGLLS 122
           I+KLP  YQ L++K +++EK+ +R+LVVTKTFE+EGYDYPPN++ES++ WW  +      
Sbjct: 59  IAKLPEGYQRLQEKSEAMEKVLKRLLVVTKTFELEGYDYPPNVTESLNHWWNED------ 112

Query: 123 FMDGKKGEGSRAKAEEKDENEGFLPRSFAQALSKAAKDSGDVLRTLXXXXXXXXX----- 177
                  E  + K ++  ++   L RSFA A+ KA  DS  +L  L              
Sbjct: 113 -------ENKKKKTQDFGDS-SILNRSFAIAIGKAVLDSQYILSDLKEQQKTRGTEEKKV 164

Query: 178 ------------------------XXXXXXXXXINSLITMFEAWSKCEQKIDQEKAEMDS 213
                                            +N++I+ F  WS C + IDQ KAEMDS
Sbjct: 165 KREEEAEAAEEEDEADDGEQEAEDEEEEEEDIDMNNMISAFGLWSNCYKNIDQSKAEMDS 224

Query: 214 LMAKEFNKKLDKLINEDFKKVHSLRKKVEESRLKFDTLRY 253
           ++ KEFN+KL  ++  DFK VH L  +V++SRL+FDTLR+
Sbjct: 225 MIVKEFNQKLTDMLEIDFKTVHKLCTRVQDSRLEFDTLRH 264

 Score = 79.7 bits (195), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 47/58 (81%)

Query: 340 DEFVSSTTEAVEIMGEITDSSEILSLVKLFHKFQLIYHRQCVQELEASTKILDGLDNE 397
           DEFVS+ T AVE M E+TDSSE++SLVKLF   QL+++RQCVQELEAS K LD L+ E
Sbjct: 391 DEFVSNITAAVEKMTELTDSSELISLVKLFQNIQLVHYRQCVQELEASMKSLDELEAE 448

>KLLA0E04511g Chr5 complement(406764..407672) [909 bp, 302 aa] {ON}
           similar to uniprot|P40531 Saccharomyces cerevisiae
           YIL041W GVP36 Golgi-vesicle protein of unknown function
           green fluorescent protein (GFP)-fusion protein localizes
           to the cytoplasm
          Length = 302

 Score = 92.4 bits (228), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 73/260 (28%), Positives = 123/260 (47%), Gaps = 41/260 (15%)

Query: 1   MSGYFSSFS--LDKLTNSISSAAHKTQDKLSTAIANIQLDDPQAKLSLKVRKHYLQETLG 58
           MS YF SFS  + +L+ S+S  A + Q  L     +++ + P   L     +  LQE LG
Sbjct: 1   MSQYFDSFSKKVQELSTSVSQKAQEAQ--LDQKFKDLKTNLP---LLANSTQRMLQEKLG 55

Query: 59  AIDDISKLPPQYQFLEKKCDSLEKICRRMLVVTKTFEVEGYDYPPNLSESISDWWGANRS 118
            + DIS+LP +Y  LE + ++++ I    L VTK +E E YDYP N+ ES+ ++      
Sbjct: 56  QVTDISQLPDEYVQLEHRVETIKLIYENFLKVTKIYENESYDYPSNVKESVDEFSK---- 111

Query: 119 GLLSFMDGKKGEGSRAKAEEKDEN------EGFLPRSFAQALSKAAKDSGDVLRTLXXXX 172
                + GK  + S+    E+ +N      +   P++   ALSK A  S + +       
Sbjct: 112 ----LVGGKLHDLSKVTNREQAQNVLLSSPQMKEPKTLNYALSKVALTSSEHVED----- 162

Query: 173 XXXXXXXXXXXXXXINSLITMFEAWSKCEQKIDQEKAEMDSLMAKEFNKKLDKLINEDFK 232
                           SL      +S  + KI Q + + D+++  +FNK + + + +D +
Sbjct: 163 ---------------ESLANFLAKYSDSQTKIAQLRLQQDTMIQTKFNKAIKEKLEQDIE 207

Query: 233 KVHSLRKKVEESRLKFDTLR 252
                RK VE+ RL++D +R
Sbjct: 208 TSTKARKLVEQKRLQYDVVR 227

>KLTH0A03894g Chr1 complement(328648..329619) [972 bp, 323 aa] {ON}
           similar to uniprot|P40531 Saccharomyces cerevisiae
           YIL041W GVP36 Golgi-vesicle protein of unknown function
           green fluorescent protein (GFP)-fusion protein localizes
           to the cytoplasm
          Length = 323

 Score = 86.7 bits (213), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 73/252 (28%), Positives = 117/252 (46%), Gaps = 44/252 (17%)

Query: 10  LDKLTNSISSA-AHKTQDKLSTAIANIQLDDPQAKLSLKVRKHYLQETLGAIDDISKLPP 68
           LDK    +SSA + +TQD L+T + +            +  +  +QE LG + DIS+LP 
Sbjct: 30  LDKKFRDLSSAVSQRTQD-LTTQLPSF----------AQSTQRLVQEKLGQVTDISQLPQ 78

Query: 69  QYQFLEKKCDSLEKICRRMLVVTKTFEVEGYDYPPNLSESISDWWGANRSGLLSFMDGKK 128
           +Y  LE K D +  +    L VT+ +E E YDYP N+ +S++++         S + GK 
Sbjct: 79  EYVELENKIDRVRLVYENFLKVTQVYENESYDYPNNVRDSVNEFS--------SVVAGKL 130

Query: 129 GEGSRAKAEEKDENEGFL--------PRSFAQALSKAAKDSGDVLRTLXXXXXXXXXXXX 180
            + SRA +   +E +  L        P++   ALSK A  S + L               
Sbjct: 131 HDLSRATS--TNEAQSVLIAPGPHKDPKTLNYALSKVALTSSEYLN----------KSVG 178

Query: 181 XXXXXXINSLITMFEAWSKCEQKIDQEKAEMDSLMAKEFNKKLDKLINEDFKKVHSLRKK 240
                  N+L+     +S  + K+ Q + + D+L+   FNKKL  ++  D  +    RK 
Sbjct: 179 GDDSEVSNALLK----YSDVQAKVAQARLQQDTLIQTRFNKKLRDILANDLNEAQKARKN 234

Query: 241 VEESRLKFDTLR 252
           VE  RL++D  R
Sbjct: 235 VEHKRLQYDIAR 246

 Score = 37.4 bits (85), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 28/46 (60%)

Query: 335 LEKLEDEFVSSTTEAVEIMGEITDSSEILSLVKLFHKFQLIYHRQC 380
           +E LEDEF  +T +AV +M ++  SSE+L  ++     Q  YH+Q 
Sbjct: 264 MESLEDEFAQATDDAVVVMQKVAGSSELLKELRELVAAQADYHKQS 309

>SAKL0F08162g Chr6 complement(622302..623294) [993 bp, 330 aa] {ON}
           highly similar to uniprot|Q75AN7 Ashbya gossypii ADL115W
           ADL115Wp and similar to YIL041W uniprot|P40531
           Saccharomyces cerevisiae YIL041W GVP36 Golgi-vesicle
           protein of unknown function green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm
          Length = 330

 Score = 85.9 bits (211), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 78/268 (29%), Positives = 123/268 (45%), Gaps = 45/268 (16%)

Query: 5   FSSF--SLDK----LTNSISSAAHKTQ-DK----LSTAIANIQLDDPQAKLSL-KVRKHY 52
           F++F  SL+K    L+ S+S  A + Q DK    LS A++    D   +  SL +  +  
Sbjct: 3   FNAFADSLNKKFQELSTSVSQKAQEAQLDKKFKDLSQAVSQRTQDLTTSLPSLAQSTQRL 62

Query: 53  LQETLGAIDDISKLPPQYQFLEKKCDSLEKICRRMLVVTKTFEVEGYDYPPNLSESISDW 112
           +QE LG + DIS+LP +Y  LE + D +  +    L VT+ +E E YDYP N+ +S++++
Sbjct: 63  VQERLGQVTDISQLPQEYLELENRIDRIRLVYENFLKVTQVYEHESYDYPNNVRDSVNEF 122

Query: 113 WGANRSGLLSFMDGKKGEGSRAKAEEKDENEGFL--------PRSFAQALSKAAKDSGDV 164
                S L             + A   DE +  L        P++   ALSK A  S + 
Sbjct: 123 SKTVSSKLHEL----------SHASSTDEAQNILISPGPAKDPKTLNYALSKVALTSSEY 172

Query: 165 LRTLXXXXXXXXXXXXXXXXXXINSLITMFEAWSKCEQKIDQEKAEMDSLMAKEFNKKLD 224
           L                       ++ T    +S  + KI Q + + D+L+  +FNKKL 
Sbjct: 173 L---------------SKSGHEDETIATALLKYSDVQAKIAQARLQQDTLIQTKFNKKLR 217

Query: 225 KLINEDFKKVHSLRKKVEESRLKFDTLR 252
           + +  D  K    RK+VE  RL++D  R
Sbjct: 218 ETLASDLNKAVKARKEVENKRLQYDIAR 245

 Score = 31.6 bits (70), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 25/44 (56%)

Query: 335 LEKLEDEFVSSTTEAVEIMGEITDSSEILSLVKLFHKFQLIYHR 378
           +E LEDEF  +T +A  +M ++  SSE L  +      QL Y++
Sbjct: 263 MESLEDEFAQATEDATGVMQDVIASSEFLKDLSELVSAQLAYYK 306

>Kwal_47.18148 s47 complement(708086..709057) [972 bp, 323 aa] {ON}
           YIL041W - Hypothetical ORF [contig 197] FULL
          Length = 323

 Score = 84.3 bits (207), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 78/268 (29%), Positives = 124/268 (46%), Gaps = 44/268 (16%)

Query: 5   FSSFS------LDKLTNSISSAAHKTQ-DK----LSTAIANIQLDDPQAKLSL-KVRKHY 52
           F+SF+        ++++ +S  A + Q DK    LSTA++    D      SL +  +  
Sbjct: 3   FNSFADSVNRKFQEISSQVSQRAQEAQLDKKFKDLSTAVSQKTQDFTTQLPSLAQSTQRL 62

Query: 53  LQETLGAIDDISKLPPQYQFLEKKCDSLEKICRRMLVVTKTFEVEGYDYPPNLSESISDW 112
           +QE LG + DIS+LP  Y  LE K D ++ +    L VT+ +E E YDYP N+ +S++++
Sbjct: 63  MQEKLGQVTDISQLPQDYVELENKIDRMKLVYENFLKVTQVYENESYDYPNNVRDSVNEF 122

Query: 113 WGANRSGLLSFMDGKKGEGSRAKAEEKDENEGFL--------PRSFAQALSKAAKDSGDV 164
                    S +  K  E SRA +   +E +  L        P++   ALSK A  S + 
Sbjct: 123 S--------SIVGTKLHELSRATS--TNEAQSVLISPGPHKDPKTLNYALSKVALTSSEY 172

Query: 165 LRTLXXXXXXXXXXXXXXXXXXINSLITMFEAWSKCEQKIDQEKAEMDSLMAKEFNKKLD 224
           L                      +SL+     +S  + KI Q +   D+L+  +FNKKL 
Sbjct: 173 LN----------KSPGAEDSEVSSSLLK----YSDVQAKIAQARLHQDTLIQTKFNKKLR 218

Query: 225 KLINEDFKKVHSLRKKVEESRLKFDTLR 252
             + +D  +    RK VE  RL++D  R
Sbjct: 219 AALADDLNRAQKARKNVENKRLQYDIAR 246

 Score = 36.6 bits (83), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 31/50 (62%)

Query: 335 LEKLEDEFVSSTTEAVEIMGEITDSSEILSLVKLFHKFQLIYHRQCVQEL 384
           +E LEDEF  +T +AV IM ++ +SSE+L  ++     Q  Y++Q  + L
Sbjct: 264 MESLEDEFAQATDDAVVIMQKVAESSELLKDLRELVAAQAEYYKQSAELL 313

>TDEL0H02240 Chr8 (377524..378540) [1017 bp, 338 aa] {ON} Anc_7.221
           YIL041W
          Length = 338

 Score = 84.7 bits (208), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 59/206 (28%), Positives = 97/206 (47%), Gaps = 28/206 (13%)

Query: 53  LQETLGAIDDISKLPPQYQFLEKKCDSLEKICRRMLVVTKTFEVEGYDYPPNLSESISDW 112
           +QE LG + DIS+LP +Y  LE+K D+++ I    L VT  +E E YDYP  ++ES++D+
Sbjct: 44  VQERLGQVTDISQLPREYLELERKVDTIKLIYENFLHVTSIYENESYDYPKYVTESVNDF 103

Query: 113 WGANRSGLLSFMDGKKGEGSRAKAEEKDEN------EGFLPRSFAQALSKAAKDSGDVLR 166
                      +  K  E S A +  + +N          PR+   ALSK +  S + L 
Sbjct: 104 SK--------IVAHKVQELSHASSASEAQNILITPTPAKEPRTLNYALSKVSLISSEYLN 155

Query: 167 TLXXXXXXXXXXXXXXXXXXINSLITMFEAWSKCEQKIDQEKAEMDSLMAKEFNKKLDKL 226
            +                     + ++   +S  + K+ Q + + D+++   FNK+L   
Sbjct: 156 HIGDHDEAQ--------------VASVLLKYSDLQAKVAQARLQQDTMIQTRFNKQLKDN 201

Query: 227 INEDFKKVHSLRKKVEESRLKFDTLR 252
           +  +FKK    RK VE  RL++D  R
Sbjct: 202 LEHNFKKAQKARKDVEYKRLQYDVAR 227

 Score = 32.0 bits (71), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 31/61 (50%), Gaps = 3/61 (4%)

Query: 335 LEKLEDEFVSSTTEAVEIMGEITDSSEILSLVKLFHKFQLIYHRQCVQELEASTKILDGL 394
           +E LED+F  +T +A  IM E+  +++    +K     QL YH+     +E   + + G 
Sbjct: 245 METLEDQFAQATEDATIIMQEVLSNAKFTEEIKEMANAQLTYHQTSASLIE---EFVAGF 301

Query: 395 D 395
           D
Sbjct: 302 D 302

>Suva_9.159 Chr9 (265174..266151) [978 bp, 325 aa] {ON} YIL041W
           (REAL)
          Length = 325

 Score = 84.3 bits (207), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 67/240 (27%), Positives = 114/240 (47%), Gaps = 23/240 (9%)

Query: 15  NSISSAAHKTQDKLSTAIANIQLDDPQAKLSLKVRKHYLQETLGAIDDISKLPPQYQFLE 74
           N+ +S+  K   +LST+++    D P    S +     +QE LG + DIS+LP +Y  LE
Sbjct: 4   NAFASSLSKKLQELSTSVSERTQDLPNLAQSTQ---RMVQERLGQVTDISQLPREYTELE 60

Query: 75  KKCDSLEKICRRMLVVTKTFEVEGYDYPPNLSESISDWWGANRSGLLSFMDGKKGEGSRA 134
            K D+++ I    L VT  +E   YDYP  ++ES++++  +  S L           S +
Sbjct: 61  DKVDTIKLIYNHFLGVTAIYENGSYDYPKYINESVNEFSSSLASKLTELTHA----TSAS 116

Query: 135 KAEEKDENEGFL--PRSFAQALSKAAKDSGDVLRTLXXXXXXXXXXXXXXXXXXINSLIT 192
           +A+      G +  P++   ALSK A +S + L  +                     L +
Sbjct: 117 QAQNILVAPGPIKEPKTLNYALSKVALNSSECLNKMFPTEE--------------QPLAS 162

Query: 193 MFEAWSKCEQKIDQEKAEMDSLMAKEFNKKLDKLINEDFKKVHSLRKKVEESRLKFDTLR 252
               +S  + KI Q + + D+L+  +FNKKL + ++ +  K    RK+V   RL++D  R
Sbjct: 163 SLLQFSDVQAKIAQARIQQDTLIQTKFNKKLRERVSFEIGKADKCRKEVHSMRLRYDVAR 222

>KAFR0I01950 Chr9 (398299..399291) [993 bp, 330 aa] {ON} Anc_7.221
           YIL041W
          Length = 330

 Score = 82.8 bits (203), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 59/209 (28%), Positives = 101/209 (48%), Gaps = 27/209 (12%)

Query: 50  KHYLQETLGAIDDISKLPPQYQFLEKKCDSLEKICRRMLVVTKTFEVEGYDYPPNLSESI 109
           +  +QE LG + DIS+LP +Y  LEKK DS++ I    L VT  +E E YDYP  + +S+
Sbjct: 41  QRLVQEKLGQVTDISQLPQEYLELEKKVDSIKLIHEHFLQVTSIYENESYDYPKVIKDSV 100

Query: 110 SDWWGANRSGLLSFMDGKKGEGSRAKAEEKDEN----EGFL--PRSFAQALSKAAKDSGD 163
           +D+           M  K  + S A +  + +N     G +  P++   ALSK +  + +
Sbjct: 101 NDFSKT--------MAAKITDLSHASSASEAQNILISPGPIRDPKTLNYALSKVSLTASE 152

Query: 164 VLRTLXXXXXXXXXXXXXXXXXXINSLITMFEAWSKCEQKIDQEKAEMDSLMAKEFNKKL 223
           V+  +                   ++L +    +S  + KI Q + + D+L+  +FNK L
Sbjct: 153 VINQVGSTPNE-------------SALSSKLLEFSNVQSKIAQARLQQDTLIQTKFNKAL 199

Query: 224 DKLINEDFKKVHSLRKKVEESRLKFDTLR 252
              ++    K +  RK+V+  RL++D  R
Sbjct: 200 RDDLSTSLAKANKFRKEVQNKRLQYDVAR 228

 Score = 30.8 bits (68), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 26/51 (50%)

Query: 335 LEKLEDEFVSSTTEAVEIMGEITDSSEILSLVKLFHKFQLIYHRQCVQELE 385
           +E LEDEF  +T  A  +M E+   S+ L+ +      QL Y +   Q L+
Sbjct: 246 MESLEDEFAQATENATLVMQEVIAGSDFLTSLNQMVAAQLEYFQTSAQLLQ 296

>Ecym_4377 Chr4 complement(796971..797972) [1002 bp, 333 aa] {ON}
           similar to Ashbya gossypii ADL115W
          Length = 333

 Score = 82.4 bits (202), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 58/206 (28%), Positives = 97/206 (47%), Gaps = 29/206 (14%)

Query: 53  LQETLGAIDDISKLPPQYQFLEKKCDSLEKICRRMLVVTKTFEVEGYDYPPNLSESISDW 112
           +QE LG I DIS++P +Y  +EK+ D +  I    L VT+ +E E YDYP ++SES+++ 
Sbjct: 63  VQEKLGQITDISQMPEEYVHMEKRVDKIRLIYENFLKVTQIYESETYDYPQHVSESVNEI 122

Query: 113 WGANRSGLLSFMDGKKGEGSRAKAEEKDEN------EGFLPRSFAQALSKAAKDSGDVLR 166
                      + GK  E ++A + E+ +N          P++   ALSK +  S + L 
Sbjct: 123 SKT--------VTGKIQELTKATSTEEAQNILISPGPAKDPKTLNYALSKVSLTSSEYL- 173

Query: 167 TLXXXXXXXXXXXXXXXXXXINSLITMFEAWSKCEQKIDQEKAEMDSLMAKEFNKKLDKL 226
                                N    +   +S  + +I Q + + D L+   FNK+L + 
Sbjct: 174 --------------SKSGSDSNVTADILLKYSDIQAQIAQARLQQDMLIRTRFNKQLKEK 219

Query: 227 INEDFKKVHSLRKKVEESRLKFDTLR 252
           +N +F      RK+V+  RL++D  R
Sbjct: 220 LNNEFAAAARARKEVDNKRLQYDIAR 245

>ADL115W Chr4 (483164..484165) [1002 bp, 333 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL041W
          Length = 333

 Score = 81.3 bits (199), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 58/210 (27%), Positives = 102/210 (48%), Gaps = 37/210 (17%)

Query: 53  LQETLGAIDDISKLPPQYQFLEKKCDSLEKICRRMLVVTKTFEVEGYDYPPNLSESISDW 112
           +QE LG + DIS++P +Y  LE++ D  + I    L V++ +E E YDYP ++S+S++D+
Sbjct: 63  VQERLGQVTDISQMPEEYVELEQRVDRTKLIYDNFLKVSQIYESESYDYPQHISDSVNDF 122

Query: 113 WGANRSGLLSFMDGKKGEGSRAKAEEKDENEGFL--------PRSFAQALSKAAKDSGDV 164
                      + GK  E ++A   E  E +  L        P++   ALSK A  S + 
Sbjct: 123 SKT--------VTGKVQELTKATTTE--EAQSILISPGPARNPKTLNYALSKVALTSSEY 172

Query: 165 LRTLXXXXXXXXXXXXXXXXXXINSLIT--MFEAWSKCEQKIDQEKAEMDSLMAKEFNKK 222
           L                      + ++T  +   +S  + KI Q + + D+L+   FN++
Sbjct: 173 L-----------------SKSGSDDVVTADILLKYSDVQAKIAQARLQQDTLIQTRFNRR 215

Query: 223 LDKLINEDFKKVHSLRKKVEESRLKFDTLR 252
           L + +N  F +    RK+V++ RL++D  R
Sbjct: 216 LREKLNTQFAEAMQSRKQVDQKRLQYDIAR 245

 Score = 32.7 bits (73), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 31/60 (51%), Gaps = 7/60 (11%)

Query: 335 LEKLEDEFVSSTTEAVEIMGEITDSSEILSLVKLFHKFQLIYHRQCVQELEASTKILDGL 394
           +E LED+F  ST +AV +M  + D +E L   +     QL +H+       A+ ++L G 
Sbjct: 263 METLEDQFAQSTEDAVALMQAVIDDTEFLKEFQELVTAQLGFHK-------AAAELLSGF 315

>ZYRO0D16522g Chr4 complement(1371404..1372480) [1077 bp, 358 aa]
           {ON} similar to uniprot|P40531 Saccharomyces cerevisiae
           YIL041W GVP36 Golgi-vesicle protein of unknown function
           green fluorescent protein (GFP)-fusion protein localizes
           to the cytoplasm
          Length = 358

 Score = 81.3 bits (199), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 56/211 (26%), Positives = 94/211 (44%), Gaps = 24/211 (11%)

Query: 46  LKVRKHYLQETLGAIDDISKLPPQYQFLEKKCDSLEKICRRMLVVTKTFEVEGYDYPPNL 105
           + V   Y+QE LG   DIS++P +Y  L  K D+++ I    L VT+ ++ E YDYP  +
Sbjct: 32  IPVTHRYMQEKLGHATDISEMPQEYIDLTTKVDAIKLIYNHFLQVTQVYDNESYDYPKYI 91

Query: 106 SESISDWWGANRSGLLSFMDGKKGEGSR----AKAEEKDENEGFLPRSFAQALSKAAKDS 161
           +ESI+++     S +           +     A    KD      P++   ALS+ +  S
Sbjct: 92  NESINEFSRTVGSKIQELSHASSAHEAHSILSAPGPSKD------PKTLNYALSRVSLVS 145

Query: 162 GDVLRTLXXXXXXXXXXXXXXXXXXINSLITMFEAWSKCEQKIDQEKAEMDSLMAKEFNK 221
            + +  L                     L +    +S  + ++ Q +   DSL+   FN 
Sbjct: 146 SECMEHLSTHDDAL--------------LASYLMKYSDIQSRVAQARLHQDSLVQTHFNA 191

Query: 222 KLDKLINEDFKKVHSLRKKVEESRLKFDTLR 252
           KL + I+ + K+ H +R+ VE  RL +D  R
Sbjct: 192 KLREEIDGNLKRAHRVRRDVENKRLTYDASR 222

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 14/52 (26%), Positives = 26/52 (50%)

Query: 335 LEKLEDEFVSSTTEAVEIMGEITDSSEILSLVKLFHKFQLIYHRQCVQELEA 386
           +E  E+EF  +T  A+ +M E+   +  + L++     Q  YH    Q ++A
Sbjct: 240 METAEEEFAQATENAIVVMQEVIAGANFMPLLRELAAAQWSYHETAAQRMQA 291

>Kpol_1070.19 s1070 (45405..46340) [936 bp, 311 aa] {ON}
           (45405..46340) [936 nt, 312 aa]
          Length = 311

 Score = 80.1 bits (196), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 70/259 (27%), Positives = 118/259 (45%), Gaps = 47/259 (18%)

Query: 8   FSLDKLTNSIS--------SAAHKTQDKLSTAIANIQLDDPQAKLSLKVRKHYLQETLGA 59
            S +  TNS+S        + + KTQ+  ST+I  +           +  +  +QE LG 
Sbjct: 1   MSFNSFTNSLSQKFQELSTAVSEKTQE-FSTSIPTLA----------ESTQRLVQEKLGN 49

Query: 60  IDDISKLPPQYQFLEKKCDSLEKICRRMLVVTKTFEVEGYDYPPNLSESISDWWGANRSG 119
           + DIS+LP +Y  LE++ D+++ +    L +T  +E E YDYP  +S+S++D+       
Sbjct: 50  VTDISQLPQEYIELERQVDTIKLVYEHFLQITAIYENESYDYPKYVSDSVNDFSKV---- 105

Query: 120 LLSFMDGKKGEGSRAKAEEKDEN------EGFLPRSFAQALSKAAKDSGDVLRTLXXXXX 173
                  K  E S A + ++ +N          PR+   ALSK A +S + L  L     
Sbjct: 106 ----FANKVTELSHATSAQEAQNILVTPGPAKEPRTLNYALSKVALNSSESLAQLADPNE 161

Query: 174 XXXXXXXXXXXXXINSLITMFEAWSKCEQKIDQEKAEMDSLMAKEFNKKLDKLINEDFKK 233
                         ++L+     +S  + KI Q +   D+L+  +FNK+L + +  D  K
Sbjct: 162 GPVA----------DALL----KFSDVQAKIAQTRLHQDTLIQTKFNKQLREKLELDIGK 207

Query: 234 VHSLRKKVEESRLKFDTLR 252
               RK V+  RL++D  R
Sbjct: 208 ASKARKDVQYKRLQYDVAR 226

>TBLA0D04200 Chr4 (1038483..1039478) [996 bp, 331 aa] {ON} Anc_7.221
           YIL041W
          Length = 331

 Score = 80.1 bits (196), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 68/236 (28%), Positives = 108/236 (45%), Gaps = 29/236 (12%)

Query: 19  SAAHKTQDKLSTAIANIQLDDPQAKLSLKVRKHYLQETLGAIDDISKLPPQYQFLEKKCD 78
           S + KTQ+  ST  A  Q           V++   QE LG I DIS++P +Y  LE + D
Sbjct: 20  SVSQKTQEMASTWPAYAQ-----------VQQRLAQEKLGQITDISQMPREYIDLEDRID 68

Query: 79  SLEKICRRMLVVTKTFEVEGYDYPPNLSESISDWWGA--NRSGLLSFMDGKKGEGSRAKA 136
           +L+   + +L VT+ +E   YD+P +  ES+ DW  A  +R   LS        G+  K+
Sbjct: 69  NLQNSIQVLLHVTRVYEEPAYDWPYSTQESVQDWSRAIGSRVQELSRASSASEAGNLLKS 128

Query: 137 EEKDENEGFLPRSFAQALSKAAKDSGDVLRTLXXXXXXXXXXXXXXXXXXINSLITMFEA 196
               EN    PR+   ALS+A+      + TL                     L +   A
Sbjct: 129 PVGPENG---PRTLNYALSQASL----AVSTLTSSNMPGPNGE---------GLSSGLIA 172

Query: 197 WSKCEQKIDQEKAEMDSLMAKEFNKKLDKLINEDFKKVHSLRKKVEESRLKFDTLR 252
           +S  + K+ Q +   D+ +  +FNK+L +++N    K +  RK V+  R+ +D  R
Sbjct: 173 YSDTQAKLAQIRIAQDTQVQTKFNKQLREILNNPIAKANKYRKDVQYKRVLYDIAR 228

>NDAI0A02660 Chr1 (599113..600207) [1095 bp, 364 aa] {ON} Anc_7.221
          Length = 364

 Score = 80.5 bits (197), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 65/245 (26%), Positives = 119/245 (48%), Gaps = 17/245 (6%)

Query: 15  NSISSAAHKTQDKLSTAIAN----IQLDDPQAKLSLKVRKHYLQETLGAIDDISKLPPQY 70
           NS +++ +K   +LST ++        + P      +  +  +QE LG + DIS+LP +Y
Sbjct: 5   NSFTNSFNKRLQELSTTVSQKTQEFSTNMPDINSLAQSTQRMVQERLGQVTDISQLPEEY 64

Query: 71  QFLEKKCDSLEKICRRMLVVTKTFEVEGYDYPPNLSESISDWWGANRSGLLSFMDGKKGE 130
             LE+K D+++ +    L VT TFE + YDYP    ES+ ++  +     +S ++     
Sbjct: 65  LQLERKIDTIKSVYDNFLSVTNTFEHQSYDYPNVARESVIEFSKS----AVSKVEELSHA 120

Query: 131 GSRAKAEE---KDENEGFLPRSFAQALSKAAKDSGDVLRTLXXXXXXXXXXXXXXXXXXI 187
            S ++A++    + N+   P++   ALSKA+  S +    L                  +
Sbjct: 121 TSASEAQQILTNNSNQIKEPKTLNYALSKASLISSE---QLNKQFSTDDDNNSNSDFKLV 177

Query: 188 NSLITMFEAWSKCEQKIDQEKAEMDSLMAKEFNKKLDKLINEDFKKVHSLRKKVEESRLK 247
           +S++  F   S  + KI Q + + D L+ ++FN  L   +N  F++   +RK V+  RL+
Sbjct: 178 SSILLKF---SDIQAKIAQARLQQDLLIKQKFNNNLRNDLNTSFERAQKVRKDVQNKRLQ 234

Query: 248 FDTLR 252
           +D  R
Sbjct: 235 YDVAR 239

>TBLA0D02980 Chr4 (723788..725119) [1332 bp, 443 aa] {ON} Anc_3.491
           YPR148C
          Length = 443

 Score = 80.5 bits (197), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 52/65 (80%)

Query: 333 KLLEKLEDEFVSSTTEAVEIMGEITDSSEILSLVKLFHKFQLIYHRQCVQELEASTKILD 392
           KLLE LEDEFVS T+ AVE M EIT+SS+IL L+KLF  FQL++++QC++E+E + K+L 
Sbjct: 379 KLLEHLEDEFVSHTSAAVETMEEITESSKILDLIKLFQNFQLLHYQQCIKEVETNMKLLT 438

Query: 393 GLDNE 397
            L +E
Sbjct: 439 DLTHE 443

>Smik_9.150 Chr9 (250717..251697) [981 bp, 326 aa] {ON} YIL041W
           (REAL)
          Length = 326

 Score = 79.0 bits (193), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 64/240 (26%), Positives = 113/240 (47%), Gaps = 23/240 (9%)

Query: 15  NSISSAAHKTQDKLSTAIANIQLDDPQAKLSLKVRKHYLQETLGAIDDISKLPPQYQFLE 74
           N+ +S+  K   ++ST+++    + P    S    +  +QE LG + DIS+LP +Y  LE
Sbjct: 4   NAFASSLSKKLQEISTSVSEKTQELPSLAQS---TQRMVQERLGQVTDISQLPREYTELE 60

Query: 75  KKCDSLEKICRRMLVVTKTFEVEGYDYPPNLSESISDWWGANRSGLLSFMDGKKGEGSRA 134
           +K D+++ I    L VT  +E   YDYP  ++ES++++  +  S L           S +
Sbjct: 61  EKVDTIKLIYNHFLGVTAIYENGSYDYPKYINESVNEFSRSVASKLTELTHA----TSAS 116

Query: 135 KAEEKDENEGFL--PRSFAQALSKAAKDSGDVLRTLXXXXXXXXXXXXXXXXXXINSLIT 192
           +A+      G +  P++   ALSK A +S + L  +                     L +
Sbjct: 117 EAQNILVAPGPIKEPKTLNYALSKVALNSSECLNKMLPTEE--------------QPLAS 162

Query: 193 MFEAWSKCEQKIDQEKAEMDSLMAKEFNKKLDKLINEDFKKVHSLRKKVEESRLKFDTLR 252
               +S  + KI Q + + D+L+  +FNK L + ++ +  K    RK V   RL++D  R
Sbjct: 163 ALLQFSDVQAKIAQARIQQDTLIQTKFNKNLRERLSFEIGKADKTRKDVHSMRLRYDVAR 222

>KNAG0D01760 Chr4 (296169..297197) [1029 bp, 342 aa] {ON} Anc_7.221
           YIL041W
          Length = 342

 Score = 79.0 bits (193), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 57/202 (28%), Positives = 95/202 (47%), Gaps = 17/202 (8%)

Query: 53  LQETLGAIDDISKLPPQYQFLEKKCDSLEKICRRMLVVTKTFEVEGYDYPPNLSESISDW 112
           +QE LG + DIS+LP +Y  LEK+ D+L+ +    L VT  +E E YDYP  + +S+++W
Sbjct: 44  VQEKLGQVTDISQLPQEYLELEKRVDALKLVHEHFLQVTAIYENESYDYPKYVRDSVNEW 103

Query: 113 --WGANRSGLLSFMDGKKGEGSRAKAEEKDENEGFLPRSFAQALSKAAKDSGDVLRTLXX 170
               A R   L  +     E     A    E E   P++   ALSK A +   ++  L  
Sbjct: 104 SRTVATRVSELRHV-SSAAEAQHVIAAPTQETE---PKTLHYALSKVALNGSQLVDNLDA 159

Query: 171 XXXXXXXXXXXXXXXXINSLITMFEAWSKCEQKIDQEKAEMDSLMAKEFNKKLDKLINED 230
                              L +    +S  E ++ Q + E D+ +  +FN+KL   ++ +
Sbjct: 160 PRTPRE-----------TQLSSGLLEFSGVEAELAQARLEQDAAVKAQFNEKLRGQLSGE 208

Query: 231 FKKVHSLRKKVEESRLKFDTLR 252
             +  + RK+V + RL++D  R
Sbjct: 209 IARAAAARKEVFQKRLQYDVAR 230

 Score = 34.7 bits (78), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 28/60 (46%), Gaps = 7/60 (11%)

Query: 335 LEKLEDEFVSSTTEAVEIMGEITDSSEILSLVKLFHKFQLIYHRQCVQELEASTKILDGL 394
           +E LEDEF   T  A  +M E+   +++L  V+     Q  YH       E S  IL+G 
Sbjct: 248 METLEDEFAQCTEHATIVMQEVLSQADLLGAVRRLAAAQHAYH-------ERSAAILEGF 300

>TPHA0C01230 Chr3 (280944..281861) [918 bp, 305 aa] {ON} Anc_7.221
           YIL041W
          Length = 305

 Score = 78.6 bits (192), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 56/209 (26%), Positives = 103/209 (49%), Gaps = 28/209 (13%)

Query: 50  KHYLQETLGAIDDISKLPPQYQFLEKKCDSLEKICRRMLVVTKTFEVEGYDYPPNLSESI 109
           +  +QE LG + DIS+LP +Y  LEK+ D+++ +    L +T  ++ E YDYP  +S+S+
Sbjct: 40  QRLVQEKLGNVTDISQLPQEYLELEKEIDTIKLVYEHFLKITSIYDNESYDYPKYVSDSV 99

Query: 110 SDWWGANRSGLLSFMDGKKGEGSRAKAEEKDEN----EGFL--PRSFAQALSKAAKDSGD 163
           +D+              K  + SRA + E+ +N     G +  PR+   ALSK A  S +
Sbjct: 100 NDYSK--------LFQSKIEDLSRATSAEEAQNILVTPGPITEPRTLNYALSKVALTSSE 151

Query: 164 VLRTLXXXXXXXXXXXXXXXXXXINSLITMFEAWSKCEQKIDQEKAEMDSLMAKEFNKKL 223
            L  L                  ++++ +    +S  + KI Q++ + D+L+  + NK +
Sbjct: 152 SLNQL--------------QDPNVSAVASTLLKFSDMQTKIAQQRLQQDTLIQTKVNKVI 197

Query: 224 DKLINEDFKKVHSLRKKVEESRLKFDTLR 252
            + ++   +K    R+ V+  RL++D  R
Sbjct: 198 KEKLSSLIEKATKSRRDVQYKRLQYDVAR 226

>Skud_9.128 Chr9 (245338..246327) [990 bp, 329 aa] {ON} YIL041W
           (REAL)
          Length = 329

 Score = 78.2 bits (191), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 64/240 (26%), Positives = 113/240 (47%), Gaps = 23/240 (9%)

Query: 15  NSISSAAHKTQDKLSTAIANIQLDDPQAKLSLKVRKHYLQETLGAIDDISKLPPQYQFLE 74
           N+ +S+  K   ++ST+++    + P    S +     +QE LG + DIS+LP +Y  LE
Sbjct: 4   NAFASSLSKKLQEISTSVSERTQELPNFAQSTQ---RMVQERLGQVTDISQLPREYTELE 60

Query: 75  KKCDSLEKICRRMLVVTKTFEVEGYDYPPNLSESISDWWGANRSGLLSFMDGKKGEGSRA 134
            K D+++ I    L VT  +E   YDYP  ++ES++++  +  S L           S +
Sbjct: 61  DKVDTIKLIYNHFLGVTAIYENGSYDYPKYINESVNEFSRSVASKLTELTHA----TSAS 116

Query: 135 KAEEKDENEGFL--PRSFAQALSKAAKDSGDVLRTLXXXXXXXXXXXXXXXXXXINSLIT 192
           +A+      G +  P++   ALSK + +S + L  +                     L +
Sbjct: 117 EAQNILVAPGPIKEPKTLNYALSKVSLNSSECLNKMFPAEE--------------QPLAS 162

Query: 193 MFEAWSKCEQKIDQEKAEMDSLMAKEFNKKLDKLINEDFKKVHSLRKKVEESRLKFDTLR 252
               +S  + KI Q + + D+L+  +FNKKL + ++ +  K    RK V   RL++D  R
Sbjct: 163 ALLQFSDVQAKIAQTRIQQDTLIQTKFNKKLRERLSFEIGKADKCRKDVHSMRLRYDVAR 222

>YIL041W Chr9 (276525..277505) [981 bp, 326 aa] {ON}  GVP36BAR
           domain-containing protein that localizes to both early
           and late Golgi vesicles; required for adaptation to
           varying nutrient concentrations, fluid-phase
           endocytosis, polarization of the actin cytoskeleton, and
           vacuole biogenesis
          Length = 326

 Score = 77.8 bits (190), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 64/240 (26%), Positives = 112/240 (46%), Gaps = 23/240 (9%)

Query: 15  NSISSAAHKTQDKLSTAIANIQLDDPQAKLSLKVRKHYLQETLGAIDDISKLPPQYQFLE 74
           N+ +S+  K   ++ST+++    + P    S +     +QE LG + DIS+LP +Y  LE
Sbjct: 4   NAFASSLSKKLQEISTSVSEKTQELPSLAQSTQ---RMVQERLGQVTDISQLPREYTELE 60

Query: 75  KKCDSLEKICRRMLVVTKTFEVEGYDYPPNLSESISDWWGANRSGLLSFMDGKKGEGSRA 134
            K D+++ I    L VT  +E   YDYP  ++ES++++  +  S L           S +
Sbjct: 61  DKVDTIKLIYNHFLGVTAIYENGSYDYPKYINESVNEFSRSVASKLTELTHA----TSAS 116

Query: 135 KAEEKDENEGFL--PRSFAQALSKAAKDSGDVLRTLXXXXXXXXXXXXXXXXXXINSLIT 192
           +A+      G +  P++   ALSK A +S + L  +                     L +
Sbjct: 117 EAQNILVAPGPIKEPKTLNYALSKVALNSSECLNKMFPTEE--------------QPLAS 162

Query: 193 MFEAWSKCEQKIDQEKAEMDSLMAKEFNKKLDKLINEDFKKVHSLRKKVEESRLKFDTLR 252
               +S  + KI Q + + D+L+  +FNK L + ++ +  K    RK V   RL++D  R
Sbjct: 163 ALLQFSDVQAKIAQARIQQDTLIQTKFNKNLRERLSFEIGKADKCRKDVHSMRLRYDVAR 222

>Kpol_478.22 s478 (67833..68885) [1053 bp, 350 aa] {ON}
           (67833..68885) [1053 nt, 351 aa]
          Length = 350

 Score = 76.3 bits (186), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 55/200 (27%), Positives = 91/200 (45%), Gaps = 24/200 (12%)

Query: 53  LQETLGAIDDISKLPPQYQFLEKKCDSLEKICRRMLVVTKTFEVEGYDYPPNLSESISDW 112
           ++E LG +DDIS LP +Y  LE K D+ + +    L +T  +E E YDYP   SES++++
Sbjct: 39  VKEKLGQVDDISPLPQEYLDLELKIDTYKSVYEHFLKITSIYERESYDYPKEFSESVNEF 98

Query: 113 WGANRSGLLSFMDGKKGEGSRAKAEEKDENEGFLPRSFAQALSKAAKDSGDVLRTLXXXX 172
             +  + +  F +G   EGS  K           PR+   A+SK +  + +  + L    
Sbjct: 99  TDSIGNKMYEFSNGVSTEGSSGKT----------PRTLNYAVSKVSMGASEQFQKL---- 144

Query: 173 XXXXXXXXXXXXXXINSLITMFEAWSKCEQKIDQEKAEMDSLMAKEFNKKLDKLINEDFK 232
                         I +L+T        E  I + +   D  +  +FN +L + I +  +
Sbjct: 145 -------HDTDDKRIANLLT---NVGNAEASIAEARLLQDHSIQAKFNFQLREEIAQSIE 194

Query: 233 KVHSLRKKVEESRLKFDTLR 252
           +    RK+V   RLK+D  R
Sbjct: 195 RASKYRKEVYHKRLKYDIAR 214

 Score = 34.3 bits (77), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 28/50 (56%)

Query: 335 LEKLEDEFVSSTTEAVEIMGEITDSSEILSLVKLFHKFQLIYHRQCVQEL 384
           LE LEDEF  +T +A+ +M EI  ++     +K F   +L YH + V  L
Sbjct: 230 LEILEDEFNHATKDAIMVMQEIISNNRFEQNLKDFAAAKLAYHEKSVDAL 279

>CAGL0L00891g Chr12 (108801..109826) [1026 bp, 341 aa] {ON} similar
           to uniprot|P40531 Saccharomyces cerevisiae YIL041w
          Length = 341

 Score = 75.9 bits (185), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 66/260 (25%), Positives = 117/260 (45%), Gaps = 47/260 (18%)

Query: 5   FSSFS------LDKLTNSISSAAHKTQDKLSTAIANIQLDDPQAKLSLKVRKHYLQETLG 58
           F+SF+      L   +N++S   H+    LST I  +           +  +  +QE LG
Sbjct: 4   FNSFANSLRENLQSFSNTVSQKTHE----LSTNIPTL----------AQSTQRMVQEKLG 49

Query: 59  AIDDISKLPPQYQFLEKKCDSLEKICRRMLVVTKTFEVEGYDYPPNLSESISDWWGANRS 118
            + DIS+LP +Y  LE K D+++ +    L VT  +E E YDYP  +SES++++      
Sbjct: 50  QVTDISQLPQEYLELENKVDTIKIVYEHFLQVTAVYENESYDYPKYVSESVNEFSKN--- 106

Query: 119 GLLSFMDGKKGEGSRAKAEEKDEN----EGFL--PRSFAQALSKAAKDSGDVLRTLXXXX 172
                M  K  E S+A +  + +N     G +  P++   A+SK A ++ + L       
Sbjct: 107 -----MAAKVQELSKATSATEAQNILVAPGPVKEPKTLNYAMSKVALNASEYLNHSFDDP 161

Query: 173 XXXXXXXXXXXXXXINSLITMFEAWSKCEQKIDQEKAEMDSLMAKEFNKKLDKLINEDFK 232
                            L  +   +S  + K+ Q + + D+ +  +FNK + + + E   
Sbjct: 162 MDAK-------------LSKVLLNYSDVQTKVAQARLQQDTQIQTKFNKVIRENLAESIA 208

Query: 233 KVHSLRKKVEESRLKFDTLR 252
           + +  RK V+  RL++D  R
Sbjct: 209 RANKARKDVQSKRLQYDVAR 228

>TBLA0B01580 Chr2 (345206..346366) [1161 bp, 386 aa] {ON} Anc_7.221
           YIL041W
          Length = 386

 Score = 70.5 bits (171), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 53/217 (24%), Positives = 92/217 (42%), Gaps = 39/217 (17%)

Query: 53  LQETLGAIDDISKLPPQYQFLEKKCDSLEKICRRMLVVTKTFEVEGYDYPPNLSESISDW 112
           +QE  G + DIS LP +Y  LE++ DS++ +    L +T  +E E YDYP ++ +SI+++
Sbjct: 1   MQEKFGQVTDISPLPQEYLDLEQQVDSIKLVYDHFLRITTVYENESYDYPKDVRDSITEF 60

Query: 113 WGANRSGLLSFMDG-----------------KKGEGSRAKAEEKDENEGFLPRSFAQALS 155
                S +                       +    S       ++N    PR+   ALS
Sbjct: 61  QKTASSRVQELQTKISNSSDNSHSSGSVEPMRTSVSSVGSINNYNQNS---PRTLNNALS 117

Query: 156 KAAKDSGDVLRTLXXXXXXXXXXXXXXXXXXINSLITMFEAWSKCEQKIDQEKAEMDSLM 215
           KAA  + + L+                         T+F ++S+ E  I  E+ + D ++
Sbjct: 118 KAALFAAEQLKMDKDSS-------------------TVFHSFSEAESIISDERIKQDKII 158

Query: 216 AKEFNKKLDKLINEDFKKVHSLRKKVEESRLKFDTLR 252
            K FN +L  ++       +  RK V+  RL++D  R
Sbjct: 159 QKSFNTELKNVLTNRIDVANKHRKDVQNKRLQYDISR 195

>NCAS0A13380 Chr1 complement(2633641..2634630) [990 bp, 329 aa] {ON}
           Anc_7.221
          Length = 329

 Score = 69.7 bits (169), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 68/257 (26%), Positives = 112/257 (43%), Gaps = 40/257 (15%)

Query: 5   FSSF--SLDKLTNSISSAAHKTQDKLSTAIANIQLDDPQAKLSLKVRKHYLQETLGAIDD 62
           F+SF  S  K  + +SS   +   +LST + N+           +  +  +QE LG + D
Sbjct: 4   FNSFTNSFSKTLSELSSTVSQKTQELSTNLPNLA----------QSTQRMVQERLGQVTD 53

Query: 63  ISKLPPQYQFLEKKCDSLEKICRRMLVVTKTFEVEGYDYPPNLSESISDWWGANRSGLLS 122
           IS+LP +Y  LE K DS+++I    L V+  +E + YDYP    ES+ ++     S    
Sbjct: 54  ISQLPEEYLELEMKLDSIKQIYDNFLAVSSVYEQQSYDYPYVAKESLIEFSKTAAS---- 109

Query: 123 FMDGKKGEGSRAKAEEKDEN-------EGFLPRSFAQALSKAAKDSGDVLRTLXXXXXXX 175
               K  E S A +  + +N       +   P++   ALSK A  S + L          
Sbjct: 110 ----KVEELSHASSAHEAQNILTTSSTQIKEPKTLNFALSKVALKSSEHLNQF------- 158

Query: 176 XXXXXXXXXXXINSLITMFEAWSKCEQKIDQEKAEMDSLMAKEFNKKLDKLINEDFKKVH 235
                        S  +    +S  + KI Q + + D L+ ++FN  L   +  +  K  
Sbjct: 159 ------NDNEAFKSSASALLNFSNIQAKIAQARLQQDLLIKQKFNDALRHDLATNIAKAT 212

Query: 236 SLRKKVEESRLKFDTLR 252
            +RK+V+  RL++D  R
Sbjct: 213 KVRKEVQSKRLQYDIAR 229

 Score = 34.3 bits (77), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 26/42 (61%)

Query: 335 LEKLEDEFVSSTTEAVEIMGEITDSSEILSLVKLFHKFQLIY 376
           +E LED+F  +T  A  +M ++ D+S+I+S V    + QL Y
Sbjct: 247 METLEDDFAQATEHATIVMQDVIDNSDIVSRVNELARAQLAY 288

>TPHA0B02750 Chr2 (627808..628899) [1092 bp, 363 aa] {ON} Anc_7.221
           YIL041W
          Length = 363

 Score = 65.9 bits (159), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 53/200 (26%), Positives = 86/200 (43%), Gaps = 26/200 (13%)

Query: 53  LQETLGAIDDISKLPPQYQFLEKKCDSLEKICRRMLVVTKTFEVEGYDYPPNLSESISDW 112
           ++E LG   DIS LP +Y  LE K D++++I    L VT  +E E YDYP    ES   +
Sbjct: 39  MKEKLGQAKDISTLPQEYVELETKIDTMKEIYEHFLKVTMVYEKESYDYPKEFGES---F 95

Query: 113 WGANRSGLLSFMDGKKGEGSRAKAEEKDENEGFLPRSFAQALSKAAKDSGDVLRTLXXXX 172
           W         F D   GE   A    +  N+  +P++   AL      + + ++ L    
Sbjct: 96  W--------EFTDS-VGEKFSALNISEHNNKVKIPKTLNYALHNVFLTANEKVKLLHEPL 146

Query: 173 XXXXXXXXXXXXXXINSLITMFEAWSKCEQKIDQEKAEMDSLMAKEFNKKLDKLINEDFK 232
                          NSL     + S+ E  I + +   DSL+    N +L + ++++F+
Sbjct: 147 D--------------NSLSETLASLSETEADIAEARLHQDSLVKSRINYQLKEELSQNFE 192

Query: 233 KVHSLRKKVEESRLKFDTLR 252
           +    RK V   R  +D  +
Sbjct: 193 RAAKYRKAVHHKRFNYDVAK 212

 Score = 31.6 bits (70), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 30/56 (53%), Gaps = 3/56 (5%)

Query: 338 LEDEFVSSTTEAVEIMGEITDSSEILSLVKLFHKFQLIYHRQCVQELEASTKILDG 393
           L+DEF  +T +A  +M EI  +S +  ++K     QL+YH++    L    K LD 
Sbjct: 233 LKDEFEQATKDATIVMQEIISNSRLEHILKELAVSQLVYHQRSTDLL---NKFLDA 285

>NDAI0D03130 Chr4 (742587..747074) [4488 bp, 1495 aa] {ON} Anc_4.340
          Length = 1495

 Score = 34.3 bits (77), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 31/63 (49%), Gaps = 11/63 (17%)

Query: 20   AAHKTQDKLSTAIANIQLDDPQAK----LSLK-------VRKHYLQETLGAIDDISKLPP 68
            A HK     S  IA + L DPQ +    L+LK       ++  Y +E L  I D+ ++P 
Sbjct: 1432 AHHKLSKDKSLGIAQVNLGDPQIQKDENLALKLNDGHVIIKLDYAKEALENIPDVPQIPE 1491

Query: 69   QYQ 71
            QYQ
Sbjct: 1492 QYQ 1494

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.311    0.128    0.350 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 35,242,079
Number of extensions: 1341051
Number of successful extensions: 6075
Number of sequences better than 10.0: 58
Number of HSP's gapped: 6143
Number of HSP's successfully gapped: 82
Length of query: 397
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 285
Effective length of database: 40,638,807
Effective search space: 11582059995
Effective search space used: 11582059995
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 67 (30.4 bits)