Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0F02772g3.492ON77377333600.0
KLTH0F14828g3.492ON8365149061e-109
Kwal_55.212293.492ON7874758701e-104
Skud_7.4413.492ON8074688242e-97
KLLA0D16236g3.492ON8714998264e-97
Smik_6.2263.492ON8394698236e-97
YGR130C3.492ON8164678191e-96
NCAS0E008103.492ON6924706247e-70
CAGL0I10516g3.492ON8134755991e-65
Kpol_480.143.492ON6996205886e-65
NDAI0G009403.492ON6564755294e-57
TDEL0D056003.492ON7003495173e-55
Ecym_12373.492ON7272915132e-54
ZYRO0D09988g3.492ON9943614927e-51
TPHA0D042503.492ON6292614103e-41
AFR310C3.492ON6232953294e-31
KNAG0B008103.492ON7573162673e-23
KAFR0C019603.492ON5632642191e-17
Suva_7.4183.492ON8311511898e-14
KNAG0A079403.492ON2751561508e-10
TBLA0C044803.492ON8022021201e-05
KAFR0G036903.492ON3632111181e-05
NDAI0B058603.492ON6811041102e-04
NCAS0F035503.492ON44142890.044
TPHA0O015602.81ON31051790.58
KNAG0L021405.702ON1608197734.6
KNAG0F013302.81ON62642734.6
TBLA0G017906.281ON143241734.7
KNAG0A072002.572ON16966695.4
Kwal_27.110013.209ON408229716.2
Kwal_26.77882.479ON126768726.4
Kpol_529.202.16ON95757716.9
KLLA0C03784g3.106ON622207717.7
TDEL0A054908.604ON78188709.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0F02772g
         (773 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0F02772g Chr6 (234381..236702) [2322 bp, 773 aa] {ON} simila...  1298   0.0  
KLTH0F14828g Chr6 complement(1213675..1216185) [2511 bp, 836 aa]...   353   e-109
Kwal_55.21229 s55 complement(741011..743374) [2364 bp, 787 aa] {...   339   e-104
Skud_7.441 Chr7 complement(730608..733031) [2424 bp, 807 aa] {ON...   322   2e-97
KLLA0D16236g Chr4 complement(1366718..1369333) [2616 bp, 871 aa]...   322   4e-97
Smik_6.226 Chr6 complement(369198..371717) [2520 bp, 839 aa] {ON...   321   6e-97
YGR130C Chr7 complement(751394..753844) [2451 bp, 816 aa] {ON} C...   320   1e-96
NCAS0E00810 Chr5 (148764..150842) [2079 bp, 692 aa] {ON} Anc_3.4...   244   7e-70
CAGL0I10516g Chr9 (1039201..1041642) [2442 bp, 813 aa] {ON} simi...   235   1e-65
Kpol_480.14 s480 (29882..31981) [2100 bp, 699 aa] {ON} (29882..3...   231   6e-65
NDAI0G00940 Chr7 (196273..198243) [1971 bp, 656 aa] {ON} Anc_3.4...   208   4e-57
TDEL0D05600 Chr4 complement(1009252..1011354) [2103 bp, 700 aa] ...   203   3e-55
Ecym_1237 Chr1 (487203..489386) [2184 bp, 727 aa] {ON} similar t...   202   2e-54
ZYRO0D09988g Chr4 (842706..845690) [2985 bp, 994 aa] {ON} weakly...   194   7e-51
TPHA0D04250 Chr4 complement(917249..919138) [1890 bp, 629 aa] {O...   162   3e-41
AFR310C Chr6 complement(1001490..1003361) [1872 bp, 623 aa] {ON}...   131   4e-31
KNAG0B00810 Chr2 (148815..151088) [2274 bp, 757 aa] {ON} Anc_3.4...   107   3e-23
KAFR0C01960 Chr3 complement(390752..392443) [1692 bp, 563 aa] {O...    89   1e-17
Suva_7.418 Chr7 complement(721506..724001) [2496 bp, 831 aa] {ON...    77   8e-14
KNAG0A07940 Chr1 complement(1267543..1268370) [828 bp, 275 aa] {...    62   8e-10
TBLA0C04480 Chr3 complement(1084476..1086884) [2409 bp, 802 aa] ...    51   1e-05
KAFR0G03690 Chr7 complement(762143..763234) [1092 bp, 363 aa] {O...    50   1e-05
NDAI0B05860 Chr2 complement(1420277..1422322) [2046 bp, 681 aa] ...    47   2e-04
NCAS0F03550 Chr6 complement(708778..710103) [1326 bp, 441 aa] {O...    39   0.044
TPHA0O01560 Chr15 (312823..313755) [933 bp, 310 aa] {ON} Anc_2.8...    35   0.58 
KNAG0L02140 Chr12 (381286..386112) [4827 bp, 1608 aa] {ON} Anc_5...    33   4.6  
KNAG0F01330 Chr6 complement(239604..241484) [1881 bp, 626 aa] {O...    33   4.6  
TBLA0G01790 Chr7 complement(464679..468977) [4299 bp, 1432 aa] {...    33   4.7  
KNAG0A07200 Chr1 (1131083..1131592) [510 bp, 169 aa] {ON}              31   5.4  
Kwal_27.11001 s27 complement(593288..594514) [1227 bp, 408 aa] {...    32   6.2  
Kwal_26.7788 s26 (511530..515333) [3804 bp, 1267 aa] {ON} YKL101...    32   6.4  
Kpol_529.20 s529 (59125..61998) [2874 bp, 957 aa] {ON} (59125..6...    32   6.9  
KLLA0C03784g Chr3 (344101..345969) [1869 bp, 622 aa] {ON} weakly...    32   7.7  
TDEL0A05490 Chr1 (962132..964477) [2346 bp, 781 aa] {ON} Anc_8.6...    32   9.2  

>SAKL0F02772g Chr6 (234381..236702) [2322 bp, 773 aa] {ON} similar
           to uniprot|P53278 Saccharomyces cerevisiae YGR130C
           Protein of unknown function green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm in a
           punctate pattern
          Length = 773

 Score = 1298 bits (3360), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 669/773 (86%), Positives = 669/773 (86%)

Query: 1   MSIFKKKQQVDPFAHLLXXXXXXXXXNFLRKVVTNXXXXXXXXDYSSPFRSQQELIAAKN 60
           MSIFKKKQQVDPFAHLL         NFLRKVVTN        DYSSPFRSQQELIAAKN
Sbjct: 1   MSIFKKKQQVDPFAHLLQPEQPQEQPNFLRKVVTNKKKEEEEKDYSSPFRSQQELIAAKN 60

Query: 61  VKAKKFPXXXXXXXXXXXXDLGYKVIDSAKRRAKDISVPRYLKNTDEKQRKKLDKLEFKE 120
           VKAKKFP            DLGYKVIDSAKRRAKDISVPRYLKNTDEKQRKKLDKLEFKE
Sbjct: 61  VKAKKFPTVSATSGTASAADLGYKVIDSAKRRAKDISVPRYLKNTDEKQRKKLDKLEFKE 120

Query: 121 NHLQYLKDSQKIVDVRKKNKEEQPXXXXXXXXXXXEKPEGIEEVEDVGGSVGKEEITSKE 180
           NHLQYLKDSQKIVDVRKKNKEEQP           EKPEGIEEVEDVGGSVGKEEITSKE
Sbjct: 121 NHLQYLKDSQKIVDVRKKNKEEQPAAVAAATADAVEKPEGIEEVEDVGGSVGKEEITSKE 180

Query: 181 HSVPELTSVEDTVEPTQELVEEPVGELVQEPVEDLVQEPVQENVDDLASFTPSNSSVGVF 240
           HSVPELTSVEDTVEPTQELVEEPVGELVQEPVEDLVQEPVQENVDDLASFTPSNSSVGVF
Sbjct: 181 HSVPELTSVEDTVEPTQELVEEPVGELVQEPVEDLVQEPVQENVDDLASFTPSNSSVGVF 240

Query: 241 DSPTDEIVEAVPILEGSDHEGGTRETTADDELQDDEPPIPKPDVIXXXXXXXXXXXXXDQ 300
           DSPTDEIVEAVPILEGSDHEGGTRETTADDELQDDEPPIPKPDVI             DQ
Sbjct: 241 DSPTDEIVEAVPILEGSDHEGGTRETTADDELQDDEPPIPKPDVIETTETHKTTTGKEDQ 300

Query: 301 AEQELEEGQADGLAHGLAQPIDPNKAPRVPFKAKTGVFALWTRSDKQDQPLATPQDPEYI 360
           AEQELEEGQADGLAHGLAQPIDPNKAPRVPFKAKTGVFALWTRSDKQDQPLATPQDPEYI
Sbjct: 301 AEQELEEGQADGLAHGLAQPIDPNKAPRVPFKAKTGVFALWTRSDKQDQPLATPQDPEYI 360

Query: 361 VRTDKGYMSKAIYDKLEYDEQVHQNELATFNKEQADKYDATEKEYNDKLTLLQSQIDELQ 420
           VRTDKGYMSKAIYDKLEYDEQVHQNELATFNKEQADKYDATEKEYNDKLTLLQSQIDELQ
Sbjct: 361 VRTDKGYMSKAIYDKLEYDEQVHQNELATFNKEQADKYDATEKEYNDKLTLLQSQIDELQ 420

Query: 421 ATMEQLRLDTKEKIKVSESELSKKMLDLNATHISSKNVIFKETENIKTQKIAERDEITAK 480
           ATMEQLRLDTKEKIKVSESELSKKMLDLNATHISSKNVIFKETENIKTQKIAERDEITAK
Sbjct: 421 ATMEQLRLDTKEKIKVSESELSKKMLDLNATHISSKNVIFKETENIKTQKIAERDEITAK 480

Query: 481 HEEVKAEIEELNVLKKQVDAEFNEYQAKLDDLTAQLDSKVEKIQELNDKQMEITGLIAEL 540
           HEEVKAEIEELNVLKKQVDAEFNEYQAKLDDLTAQLDSKVEKIQELNDKQMEITGLIAEL
Sbjct: 481 HEEVKAEIEELNVLKKQVDAEFNEYQAKLDDLTAQLDSKVEKIQELNDKQMEITGLIAEL 540

Query: 541 NQKKLEIETETRDAEELHKESTGILESIKNKEYLPKINAIDSQVATLLGSLTLIKQENAN 600
           NQKKLEIETETRDAEELHKESTGILESIKNKEYLPKINAIDSQVATLLGSLTLIKQENAN
Sbjct: 541 NQKKLEIETETRDAEELHKESTGILESIKNKEYLPKINAIDSQVATLLGSLTLIKQENAN 600

Query: 601 QKTEFAAITXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKAEDARLKHEEEL 660
           QKTEFAAIT                                      KAEDARLKHEEEL
Sbjct: 601 QKTEFAAITKRLEEERKAHEEKLRREEEERKRLEEERLQKQREELEAKAEDARLKHEEEL 660

Query: 661 RQIKEEHEKALNDANVQLAXXXXXXXXXXXXXTRLAGEKAIQEQERAQEADLALKQELME 720
           RQIKEEHEKALNDANVQLA             TRLAGEKAIQEQERAQEADLALKQELME
Sbjct: 661 RQIKEEHEKALNDANVQLAKEKEEREVVEREKTRLAGEKAIQEQERAQEADLALKQELME 720

Query: 721 KRRKQAEAVDAAEQARKISTQKKSVLSNPSQNLTRESSLYDYETVEEIITVDE 773
           KRRKQAEAVDAAEQARKISTQKKSVLSNPSQNLTRESSLYDYETVEEIITVDE
Sbjct: 721 KRRKQAEAVDAAEQARKISTQKKSVLSNPSQNLTRESSLYDYETVEEIITVDE 773

>KLTH0F14828g Chr6 complement(1213675..1216185) [2511 bp, 836 aa]
           {ON} weakly similar to uniprot|P53278 Saccharomyces
           cerevisiae YGR130C Protein of unknown function green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm in a punctate pattern
          Length = 836

 Score =  353 bits (906), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 217/514 (42%), Positives = 313/514 (60%), Gaps = 58/514 (11%)

Query: 301 AEQELEEGQ--ADGLAHGLAQPIDPNKAPRVPFKAKTGVFALWTRSDKQDQPLATPQDPE 358
            EQ   EG+  ADG+     +P D  + PRVPF   TG+FALWTRSDK+ QP+A+P DPE
Sbjct: 330 GEQPATEGKINADGVPE---KPKDIKETPRVPFA--TGIFALWTRSDKRGQPVASPNDPE 384

Query: 359 YIVRTDKGYMSKAIYDKLEYDEQVHQNELATFNKEQADKYDATEKEYNDKLTLLQSQIDE 418
           +IV+ DKGYMSKA+YD LEY+E +H+ E+  + KE   KY+A   EY D+LT L+SQI E
Sbjct: 385 FIVKFDKGYMSKALYDTLEYEEAIHKREMDDYTKEHDAKYEAKANEYEDRLTSLKSQIAE 444

Query: 419 LQATMEQLRLDTKEKIKVSESELSKKMLDLNATHISSKNVIFKETENIKTQKIAERDEIT 478
           L+ATME L+ DT EKI++SE++LS +M+DLNA H SSKNVIFKETEN+K  K+ E++ + 
Sbjct: 445 LEATMETLQKDTTEKIEISEAKLSAQMIDLNAEHSSSKNVIFKETENMKAAKVEEKEGVE 504

Query: 479 AKHEEVKAEIEELNVLKKQVDAEFNEYQAKLDDLTAQLDSKVEKIQELNDKQMEITGLIA 538
           AK E+VK E+EEL  L+ ++DAE  E+Q ++D+LTA+LD+K+  IQELN +Q E+   I 
Sbjct: 505 AKQEDVKTELEELEKLRAEIDAENREHQGRVDELTAELDAKLAAIQELNTQQAELQASID 564

Query: 539 ELNQKKLEIETETRDAEELHKESTGILESIKNKEYLPKINAIDSQVATLLGSLTLIKQEN 598
           +L Q+K  + +E   A+E H  +  +LESI+NKEYLPK+NAID++++ LL SLT++KQE 
Sbjct: 565 DLQQQKDALISEANAADEQHGSNVAVLESIENKEYLPKLNAIDTKISELLTSLTVVKQET 624

Query: 599 ANQKTEFAAITXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKAEDARLKHEE 658
           AN KTEFAA++                                      + +  R +H++
Sbjct: 625 ANHKTEFAAVS-----------KRLEEEDEERKEKLRQEEENRKRLEAERLQKQREEHDQ 673

Query: 659 ELRQIKEEHEKALNDANVQLAXXXXX-------XXXXXXXXTRLAGEKAIQEQERAQEAD 711
           ++  +++EHE+ L +A+ + A                     +L GEKAI+EQE A+ AD
Sbjct: 674 QILLLQQEHERQLAEASQKAAEHEQALLKEREQRELVERERVKLQGEKAIREQEEAKAAD 733

Query: 712 LALKQELMEKRRKQAEAVDAAEQA-----RKISTQKKS------------VLSNPSQN-- 752
            AL++E+ ++   +A A+D AE A     ++I+ QKK+            +L  P Q   
Sbjct: 734 KALEEEIKQRNHSRALALDGAEAAVQKSQKEITEQKKTPLLPASEQKETPLLPAPVQKET 793

Query: 753 -------------LTRE-SSLYDYETVEEIITVD 772
                        LT + SSLY+Y T +EI TV+
Sbjct: 794 PLLPAPESAQPKALTNDNSSLYEYFTEKEIRTVN 827

 Score =  129 bits (325), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 67/137 (48%), Positives = 85/137 (62%), Gaps = 8/137 (5%)

Query: 3   IFKKKQQVDPFAHLLXXXXXXXX---XNFLRKVVTNXXXXXXXXDYSSPFRSQQELIAAK 59
           +FKK+Q  DP  HL              FL KVV+          Y+SPFR+ Q L AA+
Sbjct: 1   MFKKRQ--DPLEHLFQQSEPQTGDADKGFLHKVVSKEQEQSA---YNSPFRTSQSLAAAQ 55

Query: 60  NVKAKKFPXXXXXXXXXXXXDLGYKVIDSAKRRAKDISVPRYLKNTDEKQRKKLDKLEFK 119
             K +KFP            D+GYKVID+A+RRAKDI+VPRYL+  DE+QR++LDKLE K
Sbjct: 56  KRKMQKFPTVSASVSAHSSSDMGYKVIDAARRRAKDIAVPRYLQGNDERQRRRLDKLERK 115

Query: 120 ENHLQYLKDSQKIVDVR 136
           E+ L+Y KDSQ+IVDVR
Sbjct: 116 EDALKYKKDSQRIVDVR 132

>Kwal_55.21229 s55 complement(741011..743374) [2364 bp, 787 aa] {ON}
           YGR130C - 1:1 [contig 130] FULL
          Length = 787

 Score =  339 bits (870), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 207/475 (43%), Positives = 282/475 (59%), Gaps = 32/475 (6%)

Query: 317 LAQPIDPNKAPRVPFKAKTGVFALWTRSDKQDQPLATPQDPEYIVRTDKGYMSKAIYDKL 376
           L +P +    PRVPF   TG+FALWTRSDK+ QP+A+P DPE+IV+ DKGYMSKA+YD L
Sbjct: 317 LQKPKNIKDTPRVPFA--TGIFALWTRSDKRGQPVASPDDPEFIVKFDKGYMSKALYDTL 374

Query: 377 EYDEQVHQNELATFNKEQADKYDATEKEYNDKLTLLQSQIDELQATMEQLRLDTKEKIKV 436
           EY+E VH+ E+  + KE  DKYDA  +EY D LT L+SQI EL+ATMEQL+LDT +KI +
Sbjct: 375 EYEEAVHKQEMDQYTKENTDKYDAKAQEYEDHLTSLKSQIAELEATMEQLQLDTTDKINI 434

Query: 437 SESELSKKMLDLNATHISSKNVIFKETENIKTQKIAERDEITAKHEEVKAEIEELNVLKK 496
           S +ELS +M++ NA H ++KNVIFKETEN K  KI E+  + AK +EVKAE EEL   + 
Sbjct: 435 SAAELSARMIESNAKHSNTKNVIFKETENSKAAKIDEKAAVVAKQDEVKAENEELEAQRA 494

Query: 497 QVDAEFNEYQAKLDDLTAQLDSKVEKIQELNDKQMEITGLIAELNQKKLEIETETRDAEE 556
           + DA   E  +++D+LT QLDSK   IQELND+Q EI   I  L Q+K  +  +   A+E
Sbjct: 495 EADATNQELLSRIDELTTQLDSKQSAIQELNDQQAEIQASIDALEQQKDTLVADATAADE 554

Query: 557 LHKESTGILESIKNKEYLPKINAIDSQVATLLGSLTLIKQENANQKTEFAAITXXXXXXX 616
           LH  +  ILE I NK+YLPKINA+DSQ++ LL SL L+KQE ANQ TEFAA++       
Sbjct: 555 LHNSNIAILEGISNKDYLPKINALDSQISQLLSSLALVKQETANQHTEFAAVS------- 607

Query: 617 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKAEDARLKHEEELRQIKEEHEKALNDAN- 675
                                          + +  R +H++ +  +++EHE+ L +A+ 
Sbjct: 608 ----KRLEEENEERKEKLRLEEENRKRLEAERFQKQRDEHDQHVLTLQQEHERQLAEASQ 663

Query: 676 ------VQLAXXXXXXXXXXXXXTRLAGEKAIQEQERAQEADLALKQELMEKRRKQ---- 725
                 + L               RL GEKAIQEQE+A+ AD AL+ E+ E+   +    
Sbjct: 664 KAADTELLLQQEREKRELVERERVRLQGEKAIQEQEQAKLADKALEDEVKERNHNRAQAI 723

Query: 726 -AEAVDAAEQARKISTQKKSVLSNPSQ-------NLTRESSLYDYETVEEIITVD 772
            A     A  A+ IS      LS P +       + T ++SLY+Y T +E+  V+
Sbjct: 724 DAAEAARARNAKSISNNNAPALSTPKEDEKLNIKDATTDNSLYEYFTEKEVRYVN 778

>Skud_7.441 Chr7 complement(730608..733031) [2424 bp, 807 aa] {ON}
           YGR130C (REAL)
          Length = 807

 Score =  322 bits (824), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 188/468 (40%), Positives = 287/468 (61%), Gaps = 24/468 (5%)

Query: 320 PIDPNKAPRVPFKAK-----TGVFALW---TRSDKQ-------DQPLATPQDPEYIVRT- 363
           PIDP+KAP+VPFK +     TG+FALW   T S  Q         P+ATP++PE IV+T 
Sbjct: 344 PIDPSKAPKVPFKERPKKERTGIFALWKSPTSSSAQKGGVTAPSNPVATPENPELIVKTK 403

Query: 364 DKGYMSKAIYDKLEYDEQVHQNELATFNKEQADKYDATEKEYNDKLTLLQSQIDELQATM 423
           + GY+SKA+YDK+ YDE+VHQ  LA    ++  KYDAT   Y+++L  LQ+QIDE++ +M
Sbjct: 404 EHGYLSKAVYDKINYDEKVHQAWLADLKAKEKAKYDATSTGYSERLQDLQNQIDEIENSM 463

Query: 424 EQLRLDTKEKIKVSESELSKKMLDLNATHISSKNVIFKETENIKTQKIAERDEITAKHEE 483
           + +R +T EKI+VS++ L K+++D+N  H + K +IFK+TEN+K QK+ E+DE+  K   
Sbjct: 464 KAMRKETSEKIEVSKNRLVKQIIDVNTAHNNKKLMIFKDTENMKNQKLQEKDEVLGKQTA 523

Query: 484 VKAEIEELNVLKKQVDAEFNEYQAKLDDLTAQLDSKVEKIQELNDKQMEITGLIAELNQK 543
           VK+EI+ELN  K  V  EFN++   L +L+ QLD+++ KI ++N KQ ++   I  L +K
Sbjct: 524 VKSEIDELNSAKTNVQKEFNDWTTNLSNLSQQLDAQIFKINQINLKQSKVQNEIDALQKK 583

Query: 544 KLEIETETRDAEELHKESTGILESIKNKEYLPKINAIDSQVATLLGSLTLIKQENANQKT 603
           K ++  +T + ++LH+ +   LES++NKEYLP+IN ID+QV+TLL  +T+I+QENAN+KT
Sbjct: 584 KEDLIAQTEENKKLHERNVQTLESVENKEYLPQINDIDNQVSTLLNKMTIIRQENANEKT 643

Query: 604 EFAAITXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKAEDARLKHEEELRQI 663
           E +AIT                                      +A  A+L HE+++ Q+
Sbjct: 644 ELSAITKRLEDERRAHEEQLKLEAEERKRKEENLLEKQRQELEEQAHQAQLDHEQQITQV 703

Query: 664 KEEHEKALNDANVQLAXXXXXXXXXXXXXTRLAGEKAIQEQERAQEADLALKQELMEKRR 723
           K+ +   L +   +LA             TRL GEKAI+EQ R + +D ALKQE++ K+ 
Sbjct: 704 KQTYNDQLTELQDKLAAEEKELEAVKRERTRLQGEKAIEEQTRQKSSDEALKQEILGKQH 763

Query: 724 KQAEAVDAAEQARKISTQ--KKSVLSNPSQNLTRESSLYDYETVEEII 769
           KQAE + AAE+    ++   K  +L      + ++ SLY+Y T E+++
Sbjct: 764 KQAEGLHAAEKHNIPNSHSPKNEIL------VPKDDSLYEYHTEEDVM 805

>KLLA0D16236g Chr4 complement(1366718..1369333) [2616 bp, 871 aa]
           {ON} weakly similar to uniprot|P53278 Saccharomyces
           cerevisiae YGR130C Protein of unknown function green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm in a punctate pattern
          Length = 871

 Score =  322 bits (826), Expect = 4e-97,   Method: Compositional matrix adjust.
 Identities = 198/499 (39%), Positives = 294/499 (58%), Gaps = 44/499 (8%)

Query: 316 GLAQPIDPNKAPRVPFK----------------AKTGVFALWTRSDK------------- 346
            ++ P D N APRVPF                 A +G+FAL+ RS K             
Sbjct: 375 AISPPPDINSAPRVPFTPSGANKAGTAAATSGIAASGLFALFKRSKKPESSTKVAANAAA 434

Query: 347 ------QDQPLATPQDPEYIVRTDKGYMSKAIYDKLEYDEQVHQNELATFNKEQADKYDA 400
                  D P+ATP+DPE IVRT +GY+SK++YDKL+YDE  HQ +LA ++KEQ ++Y+ 
Sbjct: 435 GTVVPGDDAPVATPEDPELIVRTQEGYVSKSVYDKLQYDEDQHQAKLALYSKEQDERYET 494

Query: 401 TEKEYNDKLTLLQSQIDELQATMEQLRLDTKEKIKVSESELSKKMLDLNATHISSKNVIF 460
             +EY +K+  +Q++I EL A MEQ+RL+ +EK+K+ + E S+ +L+ N  HI++K  ++
Sbjct: 495 KAQEYEEKIQSIQAEIAELDAQMEQVRLEHEEKLKLKQVEKSQALLETNVKHINAKGDLY 554

Query: 461 KETENIKTQKIAERDEITAKHEEVKAEIEELNVLKKQVDAEFNEYQAKLDDLTAQLDSKV 520
           K+TE IK Q I+++++    H+ V++EI+EL +LK +V  E  E+++K+++LTA+LD+K 
Sbjct: 555 KQTEEIKNQTISDKEDKEVAHQTVQSEIDELLLLKDEVAKENQEHESKVEELTAELDNKT 614

Query: 521 EKIQELNDKQMEITGLIAELNQKKLEIETETRDAEELHKESTGILESIKNKEYLPKINAI 580
             + E   K+ E    I  L ++K  +E E ++A+ELH+++   +ESI NKEYLPK+N I
Sbjct: 615 SALNESLAKKDETNAEIQALEEEKARLEQEIKEAQELHQQNVSKIESIDNKEYLPKVNEI 674

Query: 581 DSQVATLLGSLTLIKQENANQKTEFAAITXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 640
           ++++++LL SL LI+QE ANQK EF+++T                               
Sbjct: 675 NTEISSLLASLGLIQQEIANQKVEFSSVTRRLEEERKQHEEQLLKEKEERERLEKERLEK 734

Query: 641 XXXXXXXKAEDARLKHEEELRQIKEEHEKALNDANV-------QLAXXXXXXXXXXXXXT 693
                  +AE+ARLKHEEEL  +K+ H++AL +A +       QL              T
Sbjct: 735 QRTEYEKQAEEARLKHEEELANLKQTHDEALKEAQLQREAAAKQLEEEQQRREQVERERT 794

Query: 694 RLAGEKAIQEQERAQEADLALKQELMEKRRKQAEAVDAAEQARKISTQKKSVLSNPSQNL 753
           RL GEKAI+ Q+R    D  L+ E  EK R+QAEA  A E A K S+ KK+  + P  N 
Sbjct: 795 RLQGEKAIEAQQRGNPEDKRLEAEHEEKLRRQAEAASAVENALK-SSNKKTKAAVPPANT 853

Query: 754 TRESSLYDYETVEEIITVD 772
           T  SSLYDYETVEE+ITVD
Sbjct: 854 TN-SSLYDYETVEEVITVD 871

>Smik_6.226 Chr6 complement(369198..371717) [2520 bp, 839 aa] {ON}
           YGR130C (REAL)
          Length = 839

 Score =  321 bits (823), Expect = 6e-97,   Method: Compositional matrix adjust.
 Identities = 189/469 (40%), Positives = 287/469 (61%), Gaps = 26/469 (5%)

Query: 320 PIDPNKAPRVPF-----KAKTGVFALW----------TRSDKQDQPLATPQDPEYIVRT- 363
           PIDP+KAP+VPF     K KTG+FALW          + +     P+ATP+ PE IV+T 
Sbjct: 376 PIDPSKAPKVPFQERPRKGKTGIFALWKSSTSSSAQKSNTAAPSNPVATPEKPELIVKTK 435

Query: 364 DKGYMSKAIYDKLEYDEQVHQNELATFNKEQADKYDATEKEYNDKLTLLQSQIDELQATM 423
           + GY+SKA+YDK+ YDE+VHQ  L      +  KYDA  KEY +KL  LQ+QIDE++ +M
Sbjct: 436 EHGYLSKAVYDKINYDEKVHQAWLTDLRAREKAKYDAKNKEYEEKLQDLQNQIDEVEDSM 495

Query: 424 EQLRLDTKEKIKVSESELSKKMLDLNATHISSKNVIFKETENIKTQKIAERDEITAKHEE 483
           + +R +T EKI+VS++ L K+++D+NA H + K +IFK+TEN+K QK+ E++ +  K   
Sbjct: 496 KAMRKETSEKIEVSKNRLVKQIIDVNAAHNNKKLMIFKDTENMKNQKLEEKNVVLNKQTN 555

Query: 484 VKAEIEELNVLKKQVDAEFNEYQAKLDDLTAQLDSKVEKIQELNDKQMEITGLIAELNQK 543
           VK++I+ELN  K  V  +FN++   L +L+ QLD+++ KI ++N KQ ++   I  L QK
Sbjct: 556 VKSQIDELNSEKTNVQKDFNDWTTNLSNLSQQLDAQIFKINQINLKQSKVQDEIDSLEQK 615

Query: 544 KLEIETETRDAEELHKESTGILESIKNKEYLPKINAIDSQVATLLGSLTLIKQENANQKT 603
           K  + T+T++ E+LH+++  +LES++N+EYLP+IN ID+Q++TLL  +T+IKQENAN+KT
Sbjct: 616 KNALVTQTQENEKLHEKNVQVLESVENREYLPQINDIDNQISTLLNEMTIIKQENANEKT 675

Query: 604 EFAAITXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKAEDARLKHEEELRQI 663
           + +AIT                                      +A  A+L HEE++ Q+
Sbjct: 676 QLSAITKRLEDERRAHEEQLKLEAEERKRKEENLLEKQRQELEEQARQAQLDHEEQITQV 735

Query: 664 KEEHEKALNDANVQLAXXXXXXXXXXXXXTRLAGEKAIQEQERAQEADLALKQELMEKRR 723
           K+ +   L +   +LA             TRL GEKAI+EQ R + AD ALKQE++ K+ 
Sbjct: 736 KKTYNDQLTELQDKLAAEEKELETVKREKTRLQGEKAIEEQTRQRNADEALKQEILSKQH 795

Query: 724 KQAEAVDAAEQARKISTQKKSVLSNPSQN---LTRESSLYDYETVEEII 769
           KQAE + AAE+  KI         +P +N   + ++ SLY+Y T E+++
Sbjct: 796 KQAEGLHAAERY-KIPN------DHPQKNKNVVPKDDSLYEYHTEEDVM 837

 Score = 77.8 bits (190), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 54/152 (35%), Positives = 71/152 (46%), Gaps = 25/152 (16%)

Query: 7   KQQVDPFAHLLXXXXXXXXX----------NFLRKVVTNXXXXXXXXDYSSPFRSQQELI 56
           +Q  DPF  L+                    FL+KVV+N        ++ SPFR  Q+ +
Sbjct: 7   RQNDDPFTQLINQSSENGQSKQAQQKENPYQFLQKVVSNEPKGKE--EWISPFR--QDAL 62

Query: 57  AAK---------NVKAKKFPXXXXXXXXXXXX--DLGYKVIDSAKRRAKDISVPRYLKNT 105
           A+K         + K +KFP              DLGYK I    +RAKDI  P YL   
Sbjct: 63  ASKQNNNRLYVEDAKNRKFPTVSATSAYSKQQPKDLGYKNIPKNAKRAKDIRFPTYLTQN 122

Query: 106 DEKQRKKLDKLEFKENHLQYLKDSQKIVDVRK 137
           +E+Q + L +LE KE HLQYLK  QKI D+ K
Sbjct: 123 EERQYQLLTELELKEKHLQYLKKCQKITDLTK 154

>YGR130C Chr7 complement(751394..753844) [2451 bp, 816 aa] {ON}
           Component of the eisosome with unknown function;
           GFP-fusion protein localizes to the cytoplasm;
           specifically phosphorylated in vitro by mammalian
           diphosphoinositol pentakisphosphate (IP7)
          Length = 816

 Score =  320 bits (819), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 187/467 (40%), Positives = 289/467 (61%), Gaps = 24/467 (5%)

Query: 321 IDPNKAPRVPF-----KAKTGVFALW---TRSDKQ-------DQPLATPQDPEYIVRT-D 364
           IDP+KAP+VPF     K +TG+FALW   T S  Q         P+ATP++PE IV+T +
Sbjct: 354 IDPSKAPKVPFQEPSRKERTGIFALWKSPTSSSTQKSKTAAPSNPVATPENPELIVKTKE 413

Query: 365 KGYMSKAIYDKLEYDEQVHQNELATFNKEQADKYDATEKEYNDKLTLLQSQIDELQATME 424
            GY+SKA+YDK+ YDE++HQ  LA    ++ DKYDA  KEY +KL  LQ+QIDE++ +M+
Sbjct: 414 HGYLSKAVYDKINYDEKIHQAWLADLRAKEKDKYDAKNKEYKEKLQDLQNQIDEIENSMK 473

Query: 425 QLRLDTKEKIKVSESELSKKMLDLNATHISSKNVIFKETENIKTQKIAERDEITAKHEEV 484
            +R +T EKI+VS++ L KK++D+NA H + K +I K+TEN+K QK+ E++E+  K   V
Sbjct: 474 AMREETSEKIEVSKNRLVKKIIDVNAEHNNKKLMILKDTENMKNQKLQEKNEVLDKQTNV 533

Query: 485 KAEIEELNVLKKQVDAEFNEYQAKLDDLTAQLDSKVEKIQELNDKQMEITGLIAELNQKK 544
           K+EI++LN  K  V  EFN++   L +L+ QLD+++ KI ++N KQ ++   I  L +KK
Sbjct: 534 KSEIDDLNNEKTNVQKEFNDWTTNLSNLSQQLDAQIFKINQINLKQGKVQNEIDNLEKKK 593

Query: 545 LEIETETRDAEELHKESTGILESIKNKEYLPKINAIDSQVATLLGSLTLIKQENANQKTE 604
            ++ T+T + ++LH+++  +LES++NKEYLP+IN ID+Q+++LL  +T+IKQENAN+KT+
Sbjct: 594 EDLVTQTEENKKLHEKNVQVLESVENKEYLPQINDIDNQISSLLNEVTIIKQENANEKTQ 653

Query: 605 FAAITXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKAEDARLKHEEELRQIK 664
            +AIT                                      +A  A+L HE+++ Q+K
Sbjct: 654 LSAITKRLEDERRAHEEQLKLEAEERKRKEENLLEKQRQELEEQAHQAQLDHEQQITQVK 713

Query: 665 EEHEKALNDANVQLAXXXXXXXXXXXXXTRLAGEKAIQEQERAQEADLALKQELMEKRRK 724
           + +   L +   +LA             TRL  EKAI+EQ R + AD ALKQE++ ++ K
Sbjct: 714 QTYNDQLTELQDKLATEEKELEAVKRERTRLQAEKAIEEQTRQKNADEALKQEILSRQHK 773

Query: 725 QAEAVDAAEQAR--KISTQKKSVLSNPSQNLTRESSLYDYETVEEII 769
           QAE + AAE  +     +QK + +      L ++ SLY+Y T E+++
Sbjct: 774 QAEGIHAAENHKIPNDRSQKNTSV------LPKDDSLYEYHTEEDVM 814

>NCAS0E00810 Chr5 (148764..150842) [2079 bp, 692 aa] {ON} Anc_3.492
           YGR130C
          Length = 692

 Score =  244 bits (624), Expect = 7e-70,   Method: Compositional matrix adjust.
 Identities = 163/470 (34%), Positives = 256/470 (54%), Gaps = 30/470 (6%)

Query: 320 PIDPNKAPRVPF-------KAKTGVFALWTRSDKQDQPLATPQDPEYIVRTDK-GYMSKA 371
           PIDP  AP VPF       K+K    A     +K   P+A+P + E IV+T + GY+SKA
Sbjct: 235 PIDPALAPMVPFSLATPNQKSKKETEA----PEKPSNPVASPTNQEEIVKTAQFGYLSKA 290

Query: 372 IYDKLEYDEQVHQNELATFNKEQADKYDATEKEYNDKLTLLQSQIDELQATMEQLRLDTK 431
           +YDK++YDEQ H+  LA +  +Q +KY+A  +EY   L  + +Q+ EL   +E+  LDTK
Sbjct: 291 VYDKIQYDEQQHKKWLADYETKQNEKYEAKMQEYKKSLQDMDNQMSELNDLIEKCELDTK 350

Query: 432 EKIKVSESELSKKMLDLNATHISSKNVIFKETENIKTQKIAERDEITAKHEEVKAEIEEL 491
           EKI V   +L KK+ D     I+ K  IF ET+ IK +K++E++ +   + EVK  I+EL
Sbjct: 351 EKIDVMHGQLVKKVFDKKGVQINDKMKIFNETKQIKLEKLSEKENVLNDNTEVKQTIDEL 410

Query: 492 NVLKKQVDAEFNEYQAKLDDLTAQLDSKVEKIQELNDKQMEITGLIAELNQKKLEIETET 551
              K +V +E++ +   + ++ ++LD+K+ KI ++N  QM +   I  L  +K  ++ E 
Sbjct: 411 TNEKNKVRSEYDNWTTNMTNIGSELDAKLFKISQINVTQMNLQNKIDALTSQKNNLQDEI 470

Query: 552 RDAEELHKESTGILESIKNKEYLPKINAIDSQVATLLGSLTLIKQENANQKTEFAAITXX 611
              + +H  +  ++ES+ NKEYLPK+N ID+++  LL  +T++KQENAN+K + A IT  
Sbjct: 471 AKNKNIHDSNVKLVESVDNKEYLPKLNDIDNEINGLLNQMTIVKQENANEKVQLAEITKK 530

Query: 612 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKAEDARLKHEEELRQIKEEHEKAL 671
                                               KA   ++ H++E+  +K ++E  L
Sbjct: 531 LEDERRAHEEQLQLEAEERKRQEENLLGKQRDELEAKANTMQVNHQQEIDALKNDYETKL 590

Query: 672 NDANVQLAXXXXXXXXXXXXXTRLAGEKAIQEQERAQEADLALKQELMEKRRKQAEAVDA 731
            +   QL              TRL GEKA+ EQ+R ++AD  LK E+ EK+ KQAEA  A
Sbjct: 591 EEFKNQLKQEQDQLDQVKRQKTRLEGEKALDEQKRQKDADDVLKNEIFEKQHKQAEAFSA 650

Query: 732 AE----------QARKISTQKKSVLSNPSQNLTRESSLYDYETVEEIITV 771
           A+           AR+I+ + K     PS   ++++SLYDYET E+++ V
Sbjct: 651 AQLKGRKHPLAALAREITGEAK-----PS---SKDNSLYDYETEEDVMYV 692

 Score = 66.2 bits (160), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 47/165 (28%), Positives = 71/165 (43%), Gaps = 28/165 (16%)

Query: 2   SIFKKKQQVDPFAHLL------------XXXXXXXXXNFLRKVVTNXXXXXXX------- 42
           SI   K++ DPF HL                      +FL++VV+               
Sbjct: 4   SILSFKRRDDPFDHLFEEAEAAEAAKHNTSMAPRTTSSFLQRVVSTTSSTTQKQPKKKIA 63

Query: 43  -------XDYSSPFRSQQELIAAKNVKAKKFPXXXXXXXXXXXX--DLGYKVIDSAKRRA 93
                   DY+SPFR++   +  +N K ++FP                G+  I   +  A
Sbjct: 64  ASEAKAMSDYASPFRAEYSNVNVQNEKTRRFPTVSATSNYTLKNPKQKGFTTIKKGQNFA 123

Query: 94  KDISVPRYLKNTDEKQRKKLDKLEFKENHLQYLKDSQKIVDVRKK 138
           KDI  P YL   +++Q+ +L  LE KE  L+YL+DSQ I+D+ KK
Sbjct: 124 KDIYFPNYLTENEQRQQAELLILEKKEKDLKYLQDSQNIIDLTKK 168

>CAGL0I10516g Chr9 (1039201..1041642) [2442 bp, 813 aa] {ON} similar
           to uniprot|P53278 Saccharomyces cerevisiae YGR130c
          Length = 813

 Score =  235 bits (599), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 172/475 (36%), Positives = 264/475 (55%), Gaps = 51/475 (10%)

Query: 319 QPIDPNKAPRVPF--KAKTG--VFALWTRSDKQ-----------------DQPLATPQDP 357
           QP D  K PR+P+  + ++G    + + R+D                   D P+ATP++P
Sbjct: 368 QPYD--KVPRIPYTEQPESGKKFSSFFKRNDNAGHPVITDVPVIPDQSQLDFPIATPENP 425

Query: 358 EYIVRTDK-GYMSKAIYDKLEYDEQVHQNELATFNKEQADKYDATEKEYNDKLTLLQSQI 416
           E I +T++ GYMSK IYDK+ YDE  H+  L  F K +  KYD   +EYN++L  LQ +I
Sbjct: 426 ELIAKTEEYGYMSKPIYDKVVYDETNHRRWLKGFKKSEKAKYDDKMEEYNNELEELQKEI 485

Query: 417 DELQATMEQLRLDTKEKIKVSESELSKKMLDLNATHISSKNVIFKETENIKTQKIAERDE 476
           D +  +ME L+ +T +KI+VSE+ L KK+ + N  H   KN IFKETENIK QKI ++ E
Sbjct: 486 DMINESMENLKKETADKIEVSENNLVKKIFERNTLHNEQKNKIFKETENIKNQKIQQKKE 545

Query: 477 ITAKHEEVKAEIEELNVLKKQVDAEFNEYQAKLDDLTAQLDSKVEKIQELNDKQMEITGL 536
           I  KH  V+ EI +LN  KK+V  EF+++   +  L  QLD+K+ K+ ++  KQ E    
Sbjct: 546 ILDKHAVVQDEITQLNDRKKEVREEFDKWTTNMTTLGQQLDAKIMKVTQITMKQDETQKE 605

Query: 537 IAELNQKKLEIETETRDAEELHKESTGILESIKNKEYLPKINAIDSQVATLLGSLTLIKQ 596
           I +L  +K E + +   A++ H+E   ++ES +NKEYLPKI+ ID+Q++ LL  L +IKQ
Sbjct: 606 IEKLETQKKEYQAQIDAAKKEHEEGQKVVESYENKEYLPKIHTIDNQISELLNELAIIKQ 665

Query: 597 ENANQKTEFAAITXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKAEDARLKH 656
           ENAN++TE + IT                                      KAE  + +H
Sbjct: 666 ENANEQTELSKITKELEEERRAHEEKLKLEAEERERQEKNLLEKQRLELEEKAEQQKREH 725

Query: 657 EEELRQIKEEHEKALNDANVQLAXXXXXXXXXXXXXTRLAGEKAIQEQERAQEADLALKQ 716
           EE++R++KE++E  LN+   Q                 L  EK ++E  R +     +K+
Sbjct: 726 EEQVRKMKEQYENELNNVKKQ--------------KESLETEKLVEEHNRNEN----IKK 767

Query: 717 ELMEKRRKQAEAVDAAEQARKISTQKKSVLSNPSQNLTRESSLYDYETVEEIITV 771
           E+++K+RKQAEA  AA        Q KS+ +N + ++ +++SLY+++T EEI+ V
Sbjct: 768 EVLDKQRKQAEAQHAA--------QTKSIATNAANDM-QDNSLYEFKTEEEIMYV 813

>Kpol_480.14 s480 (29882..31981) [2100 bp, 699 aa] {ON}
           (29882..31981) [2100 nt, 700 aa]
          Length = 699

 Score =  231 bits (588), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 194/620 (31%), Positives = 309/620 (49%), Gaps = 65/620 (10%)

Query: 28  FLRKVVTNXXXXXXXXDYSSPFRSQQELIAAKNVKAKK---FPXXXXXXXXXXXX--DLG 82
            L+KVV+         +Y SPFR    + AA   KAKK   FP              +LG
Sbjct: 25  MLKKVVS----RDHNVEYVSPFRDPSNVQAANYAKAKKMERFPTVSASSHFSRMSPNELG 80

Query: 83  YKVIDSAKRRAKDISVPRYLKNTDEKQRKKLDKLEFKENHLQYLKDSQKIVD---VRKKN 139
           YK I  + +RAKDIS P +L   + +Q   +  LE KE +L+YL++SQ +++      + 
Sbjct: 81  YKNISKSTKRAKDISFPSFLIANERRQGGIITDLELKEANLKYLRNSQILLNENGTSTQT 140

Query: 140 KEEQPXXXXXXXXXXXEKPEGIEEVEDVGGSVGKEEITSKEHSVPELTSVEDTVEPTQEL 199
           KE              +             + G EE TS E    E+ S E+    T E 
Sbjct: 141 KESSDEESSGDETSTDDATSTEASSTSTITTEGSEEETSNEQESTEIVSEEEVA--TIEN 198

Query: 200 VEEPVGELVQEPVE----------DLVQEPVQENVDDLASFTP------SNSSVGVFDSP 243
           V    G + QE +E          D V + ++E+    AS T       S +S G  +  
Sbjct: 199 VS-SAGSVDQETIENEPTSTSLEADTVNQVIEEDRSQ-ASITKAVEEPESATSTGAQNEL 256

Query: 244 TDEIVEAVPILEGSDHEGGTRETTADDELQDDEPPIPKPDVIXXXXXXXXXXXXXDQAEQ 303
             E  E    +EGSD    +     + E                           D++ Q
Sbjct: 257 ETEEGEVNAPIEGSDANTKSENVEEEPEEG------------EEEEGNEPHEETEDESVQ 304

Query: 304 ELEEGQADGLAHGLAQPIDPNKAPRV------PFKAKTGVFALWTRSDKQD------QPL 351
           E EE         L +PI+P++AP +      P  + TG+ A++  +   +       P+
Sbjct: 305 ETEE-------KSLVEPINPDEAPMLHMGPPQPQSSSTGIMAIFKGNSSSNIQPVSKNPM 357

Query: 352 ATPQDPEYIVRTDK-GYMSKAIYDKLEYDEQVHQNELATFNKEQADKYDATEKEYNDKLT 410
           ++P++PEY+++T + GY+SKA+YDK++YD+ VHQ  L      + +KY   + EY D L 
Sbjct: 358 SSPENPEYVIKTKQHGYLSKAVYDKVQYDQSVHQRWLDNLETTEEEKYQNKKTEYEDNLA 417

Query: 411 LLQSQIDELQATMEQLRLDTKEKIKVSESELSKKMLDLNATHISSKNVIFKETENIKTQK 470
            +QS+ID +   M++L+L T +KI+V E +L K +LD+  TH  SKN IFKETE +K +K
Sbjct: 418 DIQSKIDNIHDLMDELKLKTSQKIEVMEYQLVKNILDMTQTHNDSKNKIFKETELMKLEK 477

Query: 471 IAERDEITAKHEEVKAEIEELNVLKKQVDAEFNEYQAKLDDLTAQLDSKVEKIQELNDKQ 530
           +  + +  +K  E++ EIE L+  +  V  +FNE+ +KL+++TAQLD+K+E I+  N ++
Sbjct: 478 LNAKQDFISKQAEIRKEIENLSEEQTGVTDDFNEWNSKLNEITAQLDAKIEDIRAKNQQK 537

Query: 531 MEITGLIAELNQKKLEIETETRDAEELHKESTGILESIK-NKEYLPKINAIDSQVATLLG 589
           ++I   +A+LN  K+E+E E +  EE+HK +T +L  +   K YLP+IN ID+++A  L 
Sbjct: 538 LDIEQEMAKLNISKMELEEEIKKNEEIHKNNTELLTDLNVRKNYLPRINEIDNEIAGRLE 597

Query: 590 SLTLIKQENANQKTEFAAIT 609
            L+ IK+E   +      +T
Sbjct: 598 KLSTIKKETIEENNRLTILT 617

>NDAI0G00940 Chr7 (196273..198243) [1971 bp, 656 aa] {ON} Anc_3.492
           YGR130C
          Length = 656

 Score =  208 bits (529), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 161/475 (33%), Positives = 247/475 (52%), Gaps = 25/475 (5%)

Query: 317 LAQPIDPNKAPRVPFKAKT--------GVFALWTRSDKQDQPLATPQDPEYIVRTDK-GY 367
           L +PIDP   P V F+  T            +    +K+  P ATP   E IV+T K G 
Sbjct: 187 LEKPIDPKLTPMVSFQLSTPPVNNKNKKTQVVPEEEEKERNPKATPNSKEEIVKTKKFGI 246

Query: 368 MSKAIYDKLEYDEQVHQNELATFNKEQADKYDATEKEYNDKLTLLQSQIDELQATMEQLR 427
           +SK+IYD+L+YD+Q H+  LA++  E  +KYD   +EY ++L  L  +I      +EQ +
Sbjct: 247 LSKSIYDQLQYDQQQHEQYLASYKAEMQEKYDVKMQEYENELKSLDEKIVASNELIEQCK 306

Query: 428 LDTKEKIKVSESELSKKMLDLNATHISSKNVIFKETENIKTQKIAERDEITAKHEEVKAE 487
            DT  K+ +  +EL K+M D  +     K  IF ET+ IK +KI E+  +    ++V  E
Sbjct: 307 KDTDAKLDIMNAELVKRMFDERSVQTDDKMKIFSETKLIKREKIDEKINVEELDDQVVGE 366

Query: 488 IEELNVLKKQVDAEFNEYQAKLDDLTAQLDSKVEKIQELNDKQMEITGLIAELNQKKLEI 547
           I++LN  K++V  EFNE+   + ++  QLD+K+ KI+++N  QM +   I  LN +KL +
Sbjct: 367 IDQLNKEKEKVYDEFNEWTFNMTNIAEQLDAKLFKIKQINITQMNLQNKIDGLNNEKLGL 426

Query: 548 ETETRDAEELHKESTGILESIKNKEYLPKINAIDSQVATLLGSLTLIKQENANQKTEFAA 607
             E    +  H  +   +E++ NK+YLPK+N IDSQ+  LL  LTLIKQENAN+K + + 
Sbjct: 427 TKEIEANKFTHANNVETIENVDNKQYLPKLNNIDSQINDLLNQLTLIKQENANEKIQLSE 486

Query: 608 ITXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKAEDARLKHEEELRQIKEEH 667
           +T                                      KA D +L HE E+  +K  +
Sbjct: 487 LTQKLEKERMDHEEKLKLDAEERKRQEENLLGKQREELEQKANDLQLNHETEMTNLKTSY 546

Query: 668 EKALNDANVQLAXXXXXXXXXXXXXTRLAGEKAIQEQERAQEADLALKQELMEKRRKQAE 727
           E+ L D   +L              +RL G KAI++Q+R +++D  LK E++ K+ +QAE
Sbjct: 547 EQQLADFKSKLMEQQDKVDDLKLQKSRLEGSKAIEDQDRQKQSDNVLKNEILSKQHQQAE 606

Query: 728 AVDAAEQARKISTQKKSVLSNPSQNLTRES-----------SLYDYETVEEIITV 771
           A +A + A     QKK   S  +++L +ES           SL++YET EEI+ V
Sbjct: 607 AYNAVQLA-----QKKKNASPVAEDLMKESHIPALSKAKDDSLFEYETEEEIMYV 656

 Score = 55.1 bits (131), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 38/101 (37%), Positives = 52/101 (51%), Gaps = 9/101 (8%)

Query: 44  DYSSPFRSQQELIA-----AKNVKAKKFPXXXXXX--XXXXXXDLGYKVIDSAKRRAKDI 96
           +Y SPFRS   L+       +N K K+FP              ++G+K I   K  AKDI
Sbjct: 67  EYLSPFRSN--LVTNNKAYIQNEKTKRFPTVSATSNYTNRTSKEMGFKKIPKDKNFAKDI 124

Query: 97  SVPRYLKNTDEKQRKKLDKLEFKENHLQYLKDSQKIVDVRK 137
             P YL   +++Q+ +L KL   E  LQY KDSQ I+D+ K
Sbjct: 125 FFPSYLTQNEQRQQIELTKLVKLEKDLQYKKDSQNIIDLTK 165

>TDEL0D05600 Chr4 complement(1009252..1011354) [2103 bp, 700 aa]
           {ON} Anc_3.492 YGR130C
          Length = 700

 Score =  203 bits (517), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 122/349 (34%), Positives = 200/349 (57%), Gaps = 3/349 (0%)

Query: 322 DPNKAPRVPFKAKTGVF---ALWTRSDKQDQPLATPQDPEYIVRTDKGYMSKAIYDKLEY 378
           DP   P V   A    F      +       P ATP++PE++V+T  GY++K IYDK+  
Sbjct: 310 DPRSVPMVALPAAPRAFLDKIFKSPPAPVPNPPATPENPEHVVKTKDGYLTKVIYDKITL 369

Query: 379 DEQVHQNELATFNKEQADKYDATEKEYNDKLTLLQSQIDELQATMEQLRLDTKEKIKVSE 438
            ++ H   +A + K++  K+D    E N K+  L++QI E++  M QLR DT  KI+VSE
Sbjct: 370 QDRQHNEWIAKYKKDEQQKFDDKRAESNRKINSLRAQIKEIKNEMAQLRSDTDAKIEVSE 429

Query: 439 SELSKKMLDLNATHISSKNVIFKETENIKTQKIAERDEITAKHEEVKAEIEELNVLKKQV 498
           +EL++K  ++   HI  KN +FK+TE IK+QK++E+D +  K  EV+ EI+ELN+ K++V
Sbjct: 430 NELTRKFFEMTQVHIQKKNQVFKDTEVIKSQKLSEKDSVLDKQGEVQKEIDELNIEKEKV 489

Query: 499 DAEFNEYQAKLDDLTAQLDSKVEKIQELNDKQMEITGLIAELNQKKLEIETETRDAEELH 558
           + E  ++   +++L+A++D+KV  ++E+N KQ      I +L Q+K++I  +       H
Sbjct: 490 EEECQKWTKDIEELSARIDAKVADLEEVNVKQKNTQEEINKLQQQKVDILDQIEKNNLTH 549

Query: 559 KESTGILESIKNKEYLPKINAIDSQVATLLGSLTLIKQENANQKTEFAAITXXXXXXXXX 618
            E+  ++E  KNK YLPK+N +D+Q++ LLG LT I+Q  AN++TE +AIT         
Sbjct: 550 AENEKVIEGAKNKTYLPKLNEVDNQISVLLGQLTTIRQHCANERTELSAITKKLDKERLE 609

Query: 619 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXKAEDARLKHEEELRQIKEEH 667
                                        KA++AR KHE+E++++K ++
Sbjct: 610 HEEKLKLEAENRRRKEEDLLGKQRKELEAKAQEAREKHEQEMQKLKTDY 658

>Ecym_1237 Chr1 (487203..489386) [2184 bp, 727 aa] {ON} similar to
           Ashbya gossypii AFR310C
          Length = 727

 Score =  202 bits (513), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 109/291 (37%), Positives = 191/291 (65%), Gaps = 4/291 (1%)

Query: 320 PIDPNKAPRVPFK-AKTGVFALWTRSDKQDQPLATPQDPEYIVRTDKGYMSKAIYDKLEY 378
           P    K  R PFK +K G+FALW RS+K ++  ATP+DPE+IV T+KGYMSK IYD+LEY
Sbjct: 290 PPTKQKGHRGPFKFSKKGIFALWKRSEKPEKLNATPEDPEFIVLTEKGYMSKNIYDRLEY 349

Query: 379 DEQVHQNELATFNKEQADKYDATEKEYNDKLTLLQSQIDELQATMEQLRLDTKEKIKVSE 438
           +E++HQ +LA+ ++  A KY+ T + Y +KL  L ++I E+ A M+QL+  T+ ++K  E
Sbjct: 350 EEELHQEKLASLDQNSAAKYEDTARAYEEKLASLNNEIAEVHAAMDQLKSQTENEMKAIE 409

Query: 439 SELSKKMLDLNATHISSKNVIFKETENIKTQKIAERDEITAKHEEVKAEIEELNVLKKQV 498
           + LS+ ++D+ A H   K  + KE EN K  KI E++ I  K  +V+ E+E L  L+ + 
Sbjct: 410 ASLSQNLMDIQAKHDEQKETLLKEAENEKNAKITEKNTINEKLTQVEPELEALKRLELER 469

Query: 499 DAEFNEYQAKLDDLTAQLDSKVEKIQELNDKQMEITGLIAELNQKKLEIETETRDAEELH 558
             E  +YQ+++  LTA+LD+++ ++Q ++D+Q E+   +A L +++++IE +  ++  + 
Sbjct: 470 KVELQQYQSEVQALTAELDARLGELQNVSDEQTEVNLSMAALEERRVQIEKDISESNAVV 529

Query: 559 KESTGILESIKNKEYLPKINAIDSQVATLLGSLTLIKQENANQKTEFAAIT 609
             +  +L++++N    P I A+D+QV+ +  +++ ++QE+A QK E   ++
Sbjct: 530 ANNKELLQNLENH---PSIAALDNQVSEVTRTVSAVEQEHAAQKDELTELS 577

 Score = 89.0 bits (219), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 55/147 (37%), Positives = 76/147 (51%), Gaps = 19/147 (12%)

Query: 2   SIFKKKQQVDPFAHLLXXXXXXXXXN--FLRKVVTNXXXXX---------XXXDYSSPFR 50
           SIFKK +Q DPF  LL            F++KV  +                 +Y SPFR
Sbjct: 3   SIFKKNKQPDPFKELLDNEEDKHGTTELFVKKVTNHRKASEDDGTQGNVEGGGEYVSPFR 62

Query: 51  SQQELIAAKNVKAKKFPXXXXXXXXXXXXDLGYKVIDSAKRRAKDISVPRYLKNTDEKQR 110
             + +  A+ ++  KFP                +V D+ KR+A+DI+ PR    TD KQ+
Sbjct: 63  DDKAVAEAERIRDLKFPTTGHHST--------VRVKDNVKRKAQDIAEPRSFGTTDLKQQ 114

Query: 111 KKLDKLEFKENHLQYLKDSQKIVDVRK 137
           K+LD+L  KEN L+YL++SQKIVDVRK
Sbjct: 115 KQLDELGMKENQLEYLRNSQKIVDVRK 141

>ZYRO0D09988g Chr4 (842706..845690) [2985 bp, 994 aa] {ON} weakly
           similar to uniprot|P53278 Saccharomyces cerevisiae
           YGR130C Protein of unknown function green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           in a punctate pattern
          Length = 994

 Score =  194 bits (492), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 120/361 (33%), Positives = 196/361 (54%), Gaps = 9/361 (2%)

Query: 320 PIDPNKAPRV----PFKAKTGVFALWTRSDKQDQ----PLATPQDPEYIVRTDK-GYMSK 370
           P+D    PRV      + K  +F+++ R  K       PLATP++PE +V+TD+ G++SK
Sbjct: 450 PVDYAAVPRVVTFPEVEKKRSIFSIFGRKKKSQNRAPNPLATPENPEILVKTDREGFLSK 509

Query: 371 AIYDKLEYDEQVHQNELATFNKEQADKYDATEKEYNDKLTLLQSQIDELQATMEQLRLDT 430
           A+YDK++Y+   H   L  F   +  +Y+  + +Y+++L  L+ ++++L+ +M++++ D 
Sbjct: 510 AVYDKVKYENHKHSEWLTEFISSEKKRYEEKQVDYDNRLEELKKEVEKLEESMQEIKDDA 569

Query: 431 KEKIKVSESELSKKMLDLNATHISSKNVIFKETENIKTQKIAERDEITAKHEEVKAEIEE 490
            E I++    LSKK L+    +I  KN IF ET+ I+ QK  E DEI  + EEV+ EI  
Sbjct: 570 NELIEIRHGRLSKKFLESTQQYIEKKNAIFHETKAIQDQKDKETDEIKHRQEEVQKEIAA 629

Query: 491 LNVLKKQVDAEFNEYQAKLDDLTAQLDSKVEKIQELNDKQMEITGLIAELNQKKLEIETE 550
           LN  K  +  EF  +  +L D +A LD+K+  +  L  K  +    I EL+ KK  +E E
Sbjct: 630 LNAEKDNIHREFIGWTNRLADYSAHLDAKMYSLHTLQQKHTKTQAQIDELSHKKAVLEKE 689

Query: 551 TRDAEELHKESTGILESIKNKEYLPKINAIDSQVATLLGSLTLIKQENANQKTEFAAITX 610
               +E H ++T  +E   NKEYLPK++ ID +++ LLG L++IKQE+AN+K +  +IT 
Sbjct: 690 MAAHKETHAKNTKAVEKHANKEYLPKVHEIDDKISNLLGELSVIKQESANEKLKLGSITK 749

Query: 611 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKAEDARLKHEEELRQIKEEHEKA 670
                                                 A   + +HEEELR++K+++EK 
Sbjct: 750 KLESERQAHEEQLKLEAEERERKEKDLLGKQREEHEAVAAGLKKQHEEELRKMKQDYEKR 809

Query: 671 L 671
           L
Sbjct: 810 L 810

 Score = 53.9 bits (128), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 50/93 (53%), Gaps = 2/93 (2%)

Query: 44  DYSSPFRSQQELIAAKNVKAKKFPXXXXXX--XXXXXXDLGYKVIDSAKRRAKDISVPRY 101
           +++SPFR +     A+  + ++FP              +LGY+ +    RRAKDI  P Y
Sbjct: 68  EFASPFRLESNEKDAEKRRLQRFPTVSPNSVFSKVHPKELGYRTMGRGSRRAKDIQFPIY 127

Query: 102 LKNTDEKQRKKLDKLEFKENHLQYLKDSQKIVD 134
           L+  + +Q + L ++E +E  L Y+K+SQ + D
Sbjct: 128 LRENEARQDQLLTEVEIREQKLAYIKNSQIVHD 160

 Score = 31.6 bits (70), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 16/24 (66%), Positives = 19/24 (79%), Gaps = 2/24 (8%)

Query: 748 NPSQNLTRESSLYDYETVEEIITV 771
           NPS   +RESSL+DYET EEI +V
Sbjct: 972 NPS--ASRESSLFDYETEEEIRSV 993

>TPHA0D04250 Chr4 complement(917249..919138) [1890 bp, 629 aa] {ON}
           Anc_3.492 YGR130C
          Length = 629

 Score =  162 bits (410), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 94/261 (36%), Positives = 163/261 (62%), Gaps = 2/261 (0%)

Query: 351 LATPQDPEYIVRTDK-GYMSKAIYDKLEYDEQVHQNELATFNKEQADKYDATEKEYNDKL 409
           +A+P++PEY+VRT++   +SKA+YD++ Y++++H   L  FN  + +KY+  ++EY DKL
Sbjct: 315 VASPENPEYLVRTNEYNIVSKAVYDQMNYEQKLHSEWLKNFNAAEDEKYNTKKQEYEDKL 374

Query: 410 TLLQSQIDELQATMEQLRLDTKEKIKVSESELSKKMLDLNATHISSKNVIFKETENIKTQ 469
             LQ Q+D+++   +   +  ++KI++ E +L K +LD+ + +   K  + KETE +K Q
Sbjct: 375 VELQKQLDDIEEKKKISNMKKQQKIEIMEYQLVKNVLDVQSKYNVDKGKVIKETELMKLQ 434

Query: 470 KIAERDEITAKHEEVKAEIEELNVLKKQVDAEFNEYQAKLDDLTAQLDSKVEKIQELNDK 529
           KI  ++++ AK  +VK EIE+LN  K+ +  E+N +   L++LT  LD K+ KI+ +N+ 
Sbjct: 435 KINAKEDLLAKQLDVKNEIEKLNNEKEAITNEYNIWNGNLENLTTLLDEKIAKIEAINEN 494

Query: 530 QMEITGLIAELNQKKLEIETETRDAEELHKESTGILESIK-NKEYLPKINAIDSQVATLL 588
            M I   I  L  KKL +E E +D EE  K +  +L+ +   K+YLP++N ID Q+A   
Sbjct: 495 NMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLNVEKDYLPRLNEIDEQIAAKF 554

Query: 589 GSLTLIKQENANQKTEFAAIT 609
             L +IK E  ++  + + +T
Sbjct: 555 DKLAIIKNETISENNQLSILT 575

>AFR310C Chr6 complement(1001490..1003361) [1872 bp, 623 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR130C
          Length = 623

 Score =  131 bits (329), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 87/295 (29%), Positives = 171/295 (57%), Gaps = 5/295 (1%)

Query: 318 AQPIDPNKAPRVPFKAKTG--VFALWTRSDKQDQ--PLATPQDPEYIVRTDKGYMSKAIY 373
           A P+  N    +PFK + G  +  L+   DK+    P  TP++PE ++ T++GYMSKA+Y
Sbjct: 244 AGPLS-NIMSHMPFKLQKGGKLGGLFKHHDKEQLLVPNGTPEEPEVVLLTNRGYMSKAVY 302

Query: 374 DKLEYDEQVHQNELATFNKEQADKYDATEKEYNDKLTLLQSQIDELQATMEQLRLDTKEK 433
           D+L  +E+ H   L   +++ A  Y    + Y  ++  L ++I +L+A +  L+ +T+ +
Sbjct: 303 DRLNDEEKAHLGRLVNSDEDAAQDYQLVSQHYEKEIADLDAEISKLRADITALQAETEGQ 362

Query: 434 IKVSESELSKKMLDLNATHISSKNVIFKETENIKTQKIAERDEITAKHEEVKAEIEELNV 493
           I   E+ LSK + D+ A +   ++V+ ++ E  + +++A+++EI  +++E++ EI+ L  
Sbjct: 363 IDGLEASLSKNIQDMKAENADKQHVLHEQAEAQRAEQLADKEEIVHQNQELQPEIDRLRK 422

Query: 494 LKKQVDAEFNEYQAKLDDLTAQLDSKVEKIQELNDKQMEITGLIAELNQKKLEIETETRD 553
           LK+    E  E QA++D L  QLD++  +++ + D+Q E++ ++A L ++K ++E E  D
Sbjct: 423 LKENTAVEITECQARIDQLQQQLDAQSRELRLVTDQQAEVSVVLATLQEQKAQLEREVAD 482

Query: 554 AEELHKESTGILESIKNKEYLPKINAIDSQVATLLGSLTLIKQENANQKTEFAAI 608
           + E  K +   LE +   +Y   +  ID++ + +L  +  I+QE   Q+ E  A+
Sbjct: 483 SNEFTKRNREALERLNQTDYTATVREIDAKNSEILTEIAKIRQEIEFQRKELVAL 537

 Score = 67.4 bits (163), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 52/151 (34%), Positives = 69/151 (45%), Gaps = 27/151 (17%)

Query: 1   MSIFKKK-QQVDPFAHL--LXXXXXXXXXNFLRK---------VVTNXXXXXXXXDYSSP 48
           +++FKKK +  DPF  L  L          FLR+          VT         +Y SP
Sbjct: 3   IALFKKKLKPADPFEELSGLPEEKKKDPTEFLRQSHHPPTGGAAVTGDASHD---EYYSP 59

Query: 49  FRSQQELIAAKNVKAKKFPXXXXXXXXXXXXDLGYKVIDSAKRRAKDISVPRYLKNTDEK 108
           FR    +  A      KFP              G  V + A+RR  DI  P+ L   DE+
Sbjct: 60  FRDAIAVEEAHGSGTLKFPTT------------GTHVTEEARRRVPDIDEPKRLSTVDER 107

Query: 109 QRKKLDKLEFKENHLQYLKDSQKIVDVRKKN 139
           QR++L +LE KE  L+  K+SQKIVDVR K+
Sbjct: 108 QRQQLQELELKEGQLRLYKESQKIVDVRGKS 138

>KNAG0B00810 Chr2 (148815..151088) [2274 bp, 757 aa] {ON} Anc_3.492
           YGR130C
          Length = 757

 Score =  107 bits (267), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 88/316 (27%), Positives = 163/316 (51%), Gaps = 35/316 (11%)

Query: 319 QPIDPNKAPRV-----------PFKAKTGVFALWTRSDKQDQPLATPQ----DPEYIVRT 363
           +P+DP   P++           P     GV    T+    D P+  PQ     PE +++ 
Sbjct: 255 KPVDPATQPKLYVDLDSLQLIDPGSTAVGVS---TKQRLMDTPVTNPQATEDTPELLLKL 311

Query: 364 DK-GYMSKAIYDKLEYDEQVHQNELATFNKEQADKYDATEKEYNDKLTLLQSQIDELQAT 422
            K G++S A+++K+ YD++VH+ E+A + +EQ  K+    +EY  KL  +  +   + A 
Sbjct: 312 PKYGHVSAAVFNKVLYDDKVHKAEMADYQREQESKFAKKLQEYEQKLAQVDDRKLSVLAK 371

Query: 423 MEQLRLDTKEKIKVSESELSKKMLDLNATHISSKNVIFKETENIKTQKIAERDEITAKHE 482
           M   +LD   K +V E++  K++ D NAT   SK  +  E + +K QK+ +   I+ K  
Sbjct: 372 MNDAKLDKIAKSEVIENQKIKQLFDSNATFNDSKVKVLHEAQLVKLQKLQDLKFISQKKT 431

Query: 483 EVKAEIEELNVLKKQVDAEFNEYQAKLDDLTAQLDSKVEKIQELNDKQMEITGLIAELNQ 542
            ++ E+ +L + K   + +++ +   L ++T +LD+++ K+ + N KQ +IT  I +L Q
Sbjct: 432 LMQHEVNQLTLEKSHAEKDYHLWTTNLTNITERLDAQLFKLSQFNHKQDKITRQIRDLTQ 491

Query: 543 KKLEIETETRDAEELHKES---------TGILESIKNKEYLPKINAIDSQVATLLGSLTL 593
           +K E+E E  DA +  K +         TG  + +K+ E +   ++I  +    L SL +
Sbjct: 492 RKTELEAEI-DANQFSKGNADRNLADLETG--QHLKSHELVKVTDSIQGK----LDSLAV 544

Query: 594 IKQENANQKTEFAAIT 609
           +KQE + ++ +   IT
Sbjct: 545 VKQEISGERLKLIGIT 560

 Score = 49.3 bits (116), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 32/97 (32%), Positives = 48/97 (49%), Gaps = 6/97 (6%)

Query: 44  DYSSPFRSQQELIAAKNV----KAKKFPXXXXXX--XXXXXXDLGYKVIDSAKRRAKDIS 97
           +Y SPFR  Q   A+K      + KKFP              +LG+  +   +RRA+DI 
Sbjct: 47  EYVSPFRGGQLTKASKKQLQLQRTKKFPTVSATSLYNSYNTRELGFSKVTDDQRRARDIV 106

Query: 98  VPRYLKNTDEKQRKKLDKLEFKENHLQYLKDSQKIVD 134
            P YL   +++QR  L  LE +E  L +L+  Q ++D
Sbjct: 107 FPEYLLENEDRQRLILKDLEKREQTLLHLQRCQSVLD 143

>KAFR0C01960 Chr3 complement(390752..392443) [1692 bp, 563 aa] {ON}
           Anc_3.492 YGR130C
          Length = 563

 Score = 89.0 bits (219), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 73/264 (27%), Positives = 141/264 (53%), Gaps = 14/264 (5%)

Query: 350 PLATPQDPEYIVRTDKGY-MSKAIYDKLEYDEQVHQNELATFNKEQADKYDATEKEYNDK 408
           P+A+P++ E +V+   G  +SK +YDK+E+D +V+   +  +  +Q +K +  + EYN+K
Sbjct: 247 PVASPENKETVVKLTSGKKISKYVYDKIEHDTKVNDQYIVKYQNDQLNKLNKLKSEYNEK 306

Query: 409 LTLLQSQIDELQATMEQLRLDTKEKIKVSESELSKKMLDLNATHISSKNVIFKETENIKT 468
           +  +Q +  +    +E L L++    +V +++L K ++D  AT   +K  I ++T  +K 
Sbjct: 307 IKSIQLEKFKTLNEIENLNLESFNNFEVIQNKLVKNLMDSTATFSDNKVKILRKTGQLKL 366

Query: 469 QKIAERDEITAKHEEVKAEIEELNVLKKQVDAEFNEYQAKLDDLTAQLDSKVEKIQELND 528
           QK+ E   +  K   ++ E   +NV K      FN     L+++  +LD+K+ K+ + N 
Sbjct: 367 QKLNELKFLNQKRNLIRREANMINVEKDSYKTNFNYINCSLNEILQELDAKLFKLSQDNI 426

Query: 529 KQMEITGLIAELNQKK--LEIETETRDAEELH-KESTGILESIKNKEYLPKINAIDSQVA 585
           +   +   I +L  KK  L  E ++ + ++LH  + +  LE          +N +D Q+ 
Sbjct: 427 RNENLEHEINKLQSKKQTLLDEIDSIEYKKLHPDDDSKQLE----------LNEMDEQIN 476

Query: 586 TLLGSLTLIKQENANQKTEFAAIT 609
           + L +L LIKQE  N+K + + +T
Sbjct: 477 SKLSNLNLIKQEIINEKLKISKLT 500

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 36/113 (31%), Positives = 56/113 (49%), Gaps = 5/113 (4%)

Query: 28  FLRKVVTNXXXXXXXXD-YSSPFR----SQQELIAAKNVKAKKFPXXXXXXXXXXXXDLG 82
           FL KV TN        + Y+SPFR    S+++    +++K  KFP               
Sbjct: 33  FLSKVNTNKSKENDDENKYNSPFRNNAPSREQKKQLQDLKTAKFPLVSATSTYNTDTKDV 92

Query: 83  YKVIDSAKRRAKDISVPRYLKNTDEKQRKKLDKLEFKENHLQYLKDSQKIVDV 135
           YK +D  K  A+DI  P  L + + +Q + L  L+ K++ L  LKDS +++DV
Sbjct: 93  YKDLDPKKNFARDIKFPSRLIDNENRQNQILLDLKIKQDALDRLKDSLQVIDV 145

>Suva_7.418 Chr7 complement(721506..724001) [2496 bp, 831 aa] {ON}
           YGR130C (REAL)
          Length = 831

 Score = 77.4 bits (189), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 52/151 (34%), Positives = 69/151 (45%), Gaps = 18/151 (11%)

Query: 1   MSIFKKKQQVDPFAHLLXXXXXXXXX--------NFLRKVVTNXXXXXXXXDYSSPFR-- 50
           M     +Q+ DPF  L+                  FL+KVV+N        D+ SPFR  
Sbjct: 1   MLFNTSRQEDDPFTQLINQSSAQNQQVQQQEKPYQFLQKVVSNEPKGKE--DWVSPFRQD 58

Query: 51  ----SQQELIAAKNVKAKKFPXXXXXX--XXXXXXDLGYKVIDSAKRRAKDISVPRYLKN 104
               +Q   +   + K +KFP              DLGYK I    +RAKDI  P YL  
Sbjct: 59  ALSGNQNNRLYVHDAKNRKFPTVSATSPYSKQQPQDLGYKNIPKDVKRAKDIKFPTYLTK 118

Query: 105 TDEKQRKKLDKLEFKENHLQYLKDSQKIVDV 135
            +E+Q + L +LE KE HL+YLK  QKI D+
Sbjct: 119 NEERQYQLLTELELKEKHLKYLKKCQKITDL 149

>KNAG0A07940 Chr1 complement(1267543..1268370) [828 bp, 275 aa] {ON}
           Anc_3.492 YGR130C
          Length = 275

 Score = 62.4 bits (150), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 47/156 (30%), Positives = 76/156 (48%), Gaps = 12/156 (7%)

Query: 317 LAQPIDPNKAPRVPFKAKTGVFALWTRSDKQDQPLATPQDPEYIV------RTDKGYMSK 370
           + +P+D  K P++P+           R+     P+ATP+ PE +V       T+K Y SK
Sbjct: 93  VREPVDIQKVPKIPYSEYGQCNEAEFRN-----PVATPETPEEVVIYKHLNGTNKAY-SK 146

Query: 371 AIYDKLEYDEQVHQNELATFNKEQADKYDATEKEYNDKLTLLQSQIDELQATMEQLRLDT 430
            I+D ++ D   H   L +   +  D+     +EYN +L +L  QI   +A M  LR   
Sbjct: 147 EIFDNIQRDICNHNAWLLSREGKANDQCATKMEEYNKQLAVLDDQIKSEKAAMNNLRRKQ 206

Query: 431 KEKIKVSESELSKKMLDLNATHISSKNVIFKETENI 466
           +  I ++E+ L+K  L       + KN I+KETE +
Sbjct: 207 QRAIDLNENRLTKTFLLQTQQFTAEKNKIYKETERL 242

 Score = 36.2 bits (82), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 34/58 (58%), Gaps = 1/58 (1%)

Query: 80  DLGYKVIDSAKRRAKDISVPRYLKNTDEKQRKKLDKLEFKENHLQYLKDSQKIVDVRK 137
           +LGYK     K+ A++I  P  L   + +QR  L  L+ KE HL +LK SQ++V + K
Sbjct: 29  ELGYKQ-KFPKKYAREIHFPAELTENEMRQRAILQDLDEKEQHLDHLKKSQRVVYIDK 85

>TBLA0C04480 Chr3 complement(1084476..1086884) [2409 bp, 802 aa]
           {ON} Anc_3.492 YGR130C
          Length = 802

 Score = 50.8 bits (120), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 51/202 (25%), Positives = 97/202 (48%), Gaps = 23/202 (11%)

Query: 350 PLATPQDPEYIVRT----DKGYMSKAIYDKLEYDEQVHQNELATFNKEQADKYDATEKEY 405
           P ATP++PE +V+T    +   +SK++YD + Y+ +VH   +  +  +   KY    +E+
Sbjct: 377 PKATPKNPELLVKTRYNNNSIILSKSVYDLVNYNIKVHNKRVKDYINDSNIKYKEKNEEF 436

Query: 406 NDKLTLLQSQIDELQATMEQLRLDTKEKI-KVSESELSKKMLDLNATHISSKNVIFKETE 464
           N+ +  L  +I  ++  +    +D K KI  +    + K  +D+   H   + ++ K   
Sbjct: 437 NNSINELDLKIKSIEKDI----IDYKAKIDSLMNDNVEKNDIDIENYH---EKMLIK--- 486

Query: 465 NIKTQKIAERDEIT----AKHEEVKAEIEELNVLKKQVDAE--FNEYQAKLDDLTAQLDS 518
             K Q I + DEIT    +        ++  + + KQ D      +++++   L  Q+DS
Sbjct: 487 --KNQIIKKNDEITYILQSSPPTAAISLDTKDAVTKQSDCTPLIKDWKSEQSKLNEQIDS 544

Query: 519 KVEKIQELNDKQMEITGLIAEL 540
           KV  I++LN    ++   I EL
Sbjct: 545 KVNVIKQLNKNLADVKQKITEL 566

 Score = 48.9 bits (115), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 46/96 (47%), Gaps = 5/96 (5%)

Query: 45  YSSPFRSQQ---ELIAAKNVKAKKFPXXXXXX--XXXXXXDLGYKVIDSAKRRAKDISVP 99
           Y SPFR  Q    +  A   K  ++P              DLGYK I  + +RAKDI  P
Sbjct: 56  YKSPFRDTQTPSNMNVALKKKNHRYPTISATSPYSNMTPQDLGYKNIHPSTKRAKDIPFP 115

Query: 100 RYLKNTDEKQRKKLDKLEFKENHLQYLKDSQKIVDV 135
             L   + +Q K   +L  KE+ L YL+ SQK++ V
Sbjct: 116 VLLIENEIRQDKLFAQLTEKESQLDYLQKSQKLIKV 151

>KAFR0G03690 Chr7 complement(762143..763234) [1092 bp, 363 aa] {ON}
           Anc_3.492 YGR130C
          Length = 363

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 57/211 (27%), Positives = 106/211 (50%), Gaps = 35/211 (16%)

Query: 317 LAQPIDPNKAPRVPFKAKTGVFALWTRSDKQD--QPLATPQDPEYIV--RTDKG---YMS 369
           + +PI+    P++P    + VF     + K++    LATPQ+ E ++  R   G   Y S
Sbjct: 153 IEKPINIYSVPKIP----SYVFTKVPGNKKKELKNSLATPQNKEQVIVLRKKDGLLYYFS 208

Query: 370 KAIYDKLEYDEQVHQNELATFNKEQADKYDATEKEYNDKLTLLQSQIDELQATMEQLRLD 429
           K ++D ++Y+ ++H ++L   N +  +++ +   EY+ +++ L ++ID     +E     
Sbjct: 209 KEVFDNIQYENKIHHDKLKKLNAKGDERHASKINEYDTQVSNLNTKID-----IEN---- 259

Query: 430 TKEKIKVSESELS--KKMLDLNATHISSKNVIFKETE--NIKTQKIAERDEITAKHEEVK 485
             EKI+   S++S  K   D  +T    KN +FK TE  N KT+   E + I  +  +++
Sbjct: 260 --EKIRKLNSKISHFKDFSDFKST----KNYLFKMTEYNNTKTRLYGEIEAIKNQRNQLE 313

Query: 486 AEIEELNVLKKQVDAEFNE----YQAKLDDL 512
              + + V  K+VD   N     Y+ K DD+
Sbjct: 314 QN-QPVAVKPKKVDEPINRRSKLYEIKTDDV 343

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 40/58 (68%), Gaps = 3/58 (5%)

Query: 81  LGYKVIDS---AKRRAKDISVPRYLKNTDEKQRKKLDKLEFKENHLQYLKDSQKIVDV 135
           +GYK I +   +++ AKDI  PR L+  +E Q   L++L+ KEN+L++LKDSQ +V +
Sbjct: 80  VGYKTIPTDRKSRKIAKDIDFPRSLRENEEAQTNFLNELKTKENNLKFLKDSQNLVYI 137

>NDAI0B05860 Chr2 complement(1420277..1422322) [2046 bp, 681 aa]
           {ON} 
          Length = 681

 Score = 47.0 bits (110), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 31/104 (29%), Positives = 54/104 (51%), Gaps = 2/104 (1%)

Query: 347 QDQPLATPQDPEYIVRT--DKGYMSKAIYDKLEYDEQVHQNELATFNKEQADKYDATEKE 404
           Q  P+AT  +PE +++   DK  ++K  YDKL    Q H N +   N E ++ Y+   K 
Sbjct: 381 QLNPIATTTNPEILIKLNDDKTIITKQTYDKLLELNQDHANWMINNNGESSNLYNTKFKT 440

Query: 405 YNDKLTLLQSQIDELQATMEQLRLDTKEKIKVSESELSKKMLDL 448
           Y +KL  L  QI+     +  ++ DT +  +++++ L+ K   L
Sbjct: 441 YQEKLNKLNEQINHHNLIISMIKKDTLKNKELNDAILTNKRFQL 484

>NCAS0F03550 Chr6 complement(708778..710103) [1326 bp, 441 aa] {ON} 
          Length = 441

 Score = 38.9 bits (89), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 28/42 (66%)

Query: 92  RAKDISVPRYLKNTDEKQRKKLDKLEFKENHLQYLKDSQKIV 133
           R  +I  P +LK  +EKQ+  L  L+ KE +LQ LK+SQ+I+
Sbjct: 92  RNPNIVTPEFLKGKEEKQKNDLFNLQMKEQNLQRLKNSQRII 133

 Score = 37.7 bits (86), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 49/100 (49%), Gaps = 6/100 (6%)

Query: 350 PLATPQDPEYIVRTDKG---YMSKAIYDKLEYDEQVHQNELATFNKEQADKYDATEKEYN 406
           P+ATPQ+PE +V+  +     +SK  YD+L   +  H   L ++N E    Y+   + Y 
Sbjct: 180 PIATPQNPEILVQLTENQNKIVSKETYDRLVQVQSEHDAWLKSYNAENMANYNQRHQWYQ 239

Query: 407 DKLTLLQSQIDELQATMEQLRLDTKEKIKVSESELSKKML 446
            ++ +L  +I   Q     L  D    ++VSE   +K ++
Sbjct: 240 KQIDVLDEKIRYYQEMSNVLEADY---LRVSEINKNKALV 276

>TPHA0O01560 Chr15 (312823..313755) [933 bp, 310 aa] {ON} Anc_2.81
           YHR146W
          Length = 310

 Score = 35.0 bits (79), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 31/51 (60%)

Query: 173 KEEITSKEHSVPELTSVEDTVEPTQELVEEPVGELVQEPVEDLVQEPVQEN 223
           K EIT +  S  E    E+T E  +  V EPVGE V+ PVE+ ++ PV+EN
Sbjct: 152 KPEITPESESNGEENVQENTFESGEVPVGEPVGEPVEHPVEEQIEVPVKEN 202

>KNAG0L02140 Chr12 (381286..386112) [4827 bp, 1608 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1608

 Score = 32.7 bits (73), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 54/197 (27%), Positives = 88/197 (44%), Gaps = 39/197 (19%)

Query: 361 VRTDKGYMSKAIYDK---LEYDEQVH--QNELATFNKEQADKYDATEKEYNDKLTLLQSQ 415
           V++D    S+ I  K   L   +Q+   QNEL   N + A K    E++Y  K+  L   
Sbjct: 561 VKSDMNAKSELIACKRENLSLTQQISTKQNELDELNSKSAQK----ERDYQLKIAELSVA 616

Query: 416 IDELQATMEQLRLDTKEKIKVSESELS---------KKMLDLNATH------ISSKNVIF 460
            ++ ++      L T+EK ++ + + S         KK+L L   +      IS K +  
Sbjct: 617 ANKCKSWENSFHLLTEEKTQMEQKQRSLFDKIQQESKKLLQLETRNKELEVKISGKELHR 676

Query: 461 KETENIKTQKI--------AERDEITAKHEEVKAEIEELNVLKKQVDAEFNEYQAKLDDL 512
           K +E   + KI        +  +++  K EEVK  IE       + + +   YQ  +D+L
Sbjct: 677 KRSEETLSSKITFLSEENKSLHNDLAFKEEEVKQFIE-------KSEKQIKWYQQNIDEL 729

Query: 513 TAQLDSKVEKIQELNDK 529
           + Q  +K  KI ELNDK
Sbjct: 730 SEQNKNKSNKIIELNDK 746

>KNAG0F01330 Chr6 complement(239604..241484) [1881 bp, 626 aa] {ON}
           Anc_2.81 YHR146W
          Length = 626

 Score = 32.7 bits (73), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 28/42 (66%), Gaps = 1/42 (2%)

Query: 197 QELVEEPVGELVQEPVEDLVQEPVQENVDDLASFT-PSNSSV 237
           +E+ +EPV E VQE V++ VQEP  E  ++LA+ T P   S+
Sbjct: 342 KEVAQEPVQEPVQESVQEPVQEPTAETPNNLANSTEPDGKSI 383

>TBLA0G01790 Chr7 complement(464679..468977) [4299 bp, 1432 aa] {ON}
           Anc_6.281 YMR192W
          Length = 1432

 Score = 32.7 bits (73), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 21/41 (51%)

Query: 189 VEDTVEPTQELVEEPVGELVQEPVEDLVQEPVQENVDDLAS 229
           VE   EP  ELV  P  +LV EPV +   EP  E V  L +
Sbjct: 469 VEPVAEPINELVTNPTSKLVTEPVAETAIEPAVEPVSKLPT 509

>KNAG0A07200 Chr1 (1131083..1131592) [510 bp, 169 aa] {ON} 
          Length = 169

 Score = 31.2 bits (69), Expect = 5.4,   Method: Composition-based stats.
 Identities = 16/66 (24%), Positives = 34/66 (51%)

Query: 467 KTQKIAERDEITAKHEEVKAEIEELNVLKKQVDAEFNEYQAKLDDLTAQLDSKVEKIQEL 526
           + Q++  R+  ++   +  AE+E + +LK+Q      E + +LD +        E ++EL
Sbjct: 97  RVQRVVAREITSSVQLKDSAELERVQMLKEQYSQRIGELELQLDSMERLCGEMEEFLEEL 156

Query: 527 NDKQME 532
           N K+ +
Sbjct: 157 NLKRQQ 162

>Kwal_27.11001 s27 complement(593288..594514) [1227 bp, 408 aa] {ON}
           YDL001W - Hypothetical ORF [contig 32] FULL
          Length = 408

 Score = 32.0 bits (71), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 55/229 (24%), Positives = 103/229 (44%), Gaps = 17/229 (7%)

Query: 367 YMSKAIYDKLEYDEQVHQNELATFNKEQADKYDATEKEYNDKLTLLQSQIDELQATMEQL 426
           Y    ++   E +E+   N+L  F KE+  + D   +++N  +T  QS    +      L
Sbjct: 188 YGVVVMWGFTEREEKAFLNDLEKFEKEKLAEEDVQLEQFNYYIT--QSYQPRIYNDFITL 245

Query: 427 RLDTKEKIKVSESELSKKMLDLNATHISSKNVIFKETENIKTQKIAERDEITAKHEEVKA 486
           R  +   IK+S S    + + ++       N I ++T++I  Q+IA   +++   E++  
Sbjct: 246 RDGSNYMIKLSISHAIAQSVKISLFEELVDNTI-EDTQDIP-QQIASSGKVSMGKEDIMK 303

Query: 487 EIEELNVLKKQVDAEFNEYQAKLDDLTAQL-DSKVEKIQELNDKQMEITGLIAELNQKKL 545
            I EL +L+  +    N + + LD       + ++E I       +EI   +A LNQ +L
Sbjct: 304 SIGELFILRINI----NLHGSVLDSPEIMWSEPQLEPIYHATRGYLEINQRVALLNQ-RL 358

Query: 546 EIETETRDAEELHKESTGILESIKNKEYLPKINAIDSQVATLLGSLTLI 594
           E+     D  ++ KE  G      ++EYL  I  +   V  L+  + +I
Sbjct: 359 EV---ISDLLQMLKEQLG----HSHEEYLEFIIIVLVGVEVLVSLINII 400

>Kwal_26.7788 s26 (511530..515333) [3804 bp, 1267 aa] {ON} YKL101W
           (HSL1) - Putative protein kinase homologous to S. pombe
           cdr1/nim1 [contig 55] FULL
          Length = 1267

 Score = 32.3 bits (72), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 38/68 (55%), Gaps = 3/68 (4%)

Query: 193 VEPTQELVEEPVGELVQEPVEDLVQEPVQENVDDLAS-FTPSNSSVGVFDSPTDEIVE-- 249
           VEP Q+  ++P+ +  Q+P +  VQ+PVQ+ +  LA   +P+  + GV  S      E  
Sbjct: 574 VEPAQKPDQKPIQKPAQKPAQQFVQKPVQKPIQKLAPQPSPARETSGVRKSTAMPRTEKP 633

Query: 250 AVPILEGS 257
           ++P  +GS
Sbjct: 634 SIPSPQGS 641

>Kpol_529.20 s529 (59125..61998) [2874 bp, 957 aa] {ON}
           (59125..61998) [2874 nt, 958 aa]
          Length = 957

 Score = 32.0 bits (71), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 34/57 (59%), Gaps = 4/57 (7%)

Query: 497 QVDAEFNEYQAKLDDLTAQLDSKVEKIQ----ELNDKQMEITGLIAELNQKKLEIET 549
           ++ A FNE    + +L A+LDS V+ ++    EL++K  EI  L  +  Q+KL IET
Sbjct: 444 ELQANFNEANNTIKNLNAKLDSFVKNLEEANSELSNKDKEINELTLKSTQQKLSIET 500

>KLLA0C03784g Chr3 (344101..345969) [1869 bp, 622 aa] {ON} weakly
           similar to uniprot|Q06704 Saccharomyces cerevisiae
           YLR309C IMH1 Protein involved in vesicular transport,
           mediates transport between an endosomal compartment and
           the Golgi, contains a Golgi-localization (GRIP) domain
           that interacts with activated Arl1p-GTP to localize
           Imh1p to the Golgi
          Length = 622

 Score = 32.0 bits (71), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 60/207 (28%), Positives = 100/207 (48%), Gaps = 33/207 (15%)

Query: 403 KEYNDKLTLLQSQIDELQATMEQLRLDTKEKIKVSESELSKKMLDLNATHISSKNVIFKE 462
           KE N KL  L+S       T EQ   D K K+  +E +L  ++ D+   ++  KN   KE
Sbjct: 284 KECNAKLCTLES-------TKEQEDEDIKFKLAQTE-DLKARLEDITNKYV--KNT--KE 331

Query: 463 TENIKTQKIAERDEITAKHEEVKAEIEELNVLKKQVDAEFNEYQAKLDDLTAQLDSKVEK 522
            +N+K    AE + +  K +EV     E N + KQ    F EY+ ++  L+ Q++++V K
Sbjct: 332 IDNVK----AENNNLKLKLKEVI----EFNNICKQF---FVEYKGQIALLSEQINNEVTK 380

Query: 523 IQELNDKQMEITGLIAELNQKKLEIETETRDAEELHKESTGILESIKNKEYLPKINAIDS 582
            + L +KQ  I+        + +E+      +E L   S G+L+ ++ K+YL  IN    
Sbjct: 381 NETLKEKQERISKNYESEKSRNMEL------SESL-AVSQGVLQDME-KKYLENINKTTG 432

Query: 583 QVATLLGSLTLIKQENANQKTEFAAIT 609
               ++  L+    EN + KT+   IT
Sbjct: 433 --PEIVQDLSCSHAENLDLKTKIEKIT 457

>TDEL0A05490 Chr1 (962132..964477) [2346 bp, 781 aa] {ON} Anc_8.604
           YOR195W
          Length = 781

 Score = 31.6 bits (70), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 28/88 (31%), Positives = 49/88 (55%), Gaps = 6/88 (6%)

Query: 471 IAERDEITAKHEEVKAEIEELNVLKKQVDAEFNEYQAKLDDLTAQLDSKVEKIQELNDKQ 530
           +AE +E+ A+   ++AE+E L V     +A+ N+ + +L +   + +  V ++QEL D  
Sbjct: 467 LAELNEVIAQRANLEAELEALRVAS---EADGNKLRDQLHEAVTRSNLMVLEVQELKDHS 523

Query: 531 MEITGLIAELNQKKLEIETETRDAEELH 558
               GL A LN +  EIE  ++  EEL+
Sbjct: 524 ---DGLQAGLNARVSEIEQMSKKIEELN 548

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.306    0.126    0.328 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 70,040,525
Number of extensions: 3037162
Number of successful extensions: 20209
Number of sequences better than 10.0: 1477
Number of HSP's gapped: 19321
Number of HSP's successfully gapped: 2570
Length of query: 773
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 656
Effective length of database: 40,065,477
Effective search space: 26282952912
Effective search space used: 26282952912
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 43 (22.0 bits)
S2: 70 (31.6 bits)