Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0F02750g3.493ON1701707661e-105
KLLA0D16280g3.493ON1691705322e-69
KLTH0F14850g3.493ON1711715312e-69
TDEL0D056103.493ON1751755175e-67
Kwal_55.212383.493ON1701705095e-66
Skud_16.4443.493ON1731734862e-62
TBLA0C044903.493ON1861434761e-60
YPR149W (NCE102)3.493ON1731734741e-60
Smik_16.4023.493ON1731734741e-60
TPHA0D032803.493ON1841844646e-59
CAGL0I10494g3.493ON1721724611e-58
CAGL0L08448g3.493ON1731734592e-58
ZYRO0D09966g3.493ON1781784491e-56
KAFR0C019703.493ON1791464411e-55
NDAI0G009303.493ON1761764411e-55
Suva_16.4783.493ON1661734383e-55
NDAI0B058803.493ON1821824394e-55
Suva_7.4193.493ON1741744367e-55
Kpol_1017.63.493ON1871464343e-54
Smik_6.2273.493ON1741744315e-54
YGR131W (FHN1)3.493ON1741744272e-53
NCAS0E008003.493ON1741744184e-52
AFR312W3.493ON1681704167e-52
TBLA0D029603.493ON1891454049e-50
Skud_7.4423.493ON1741743907e-48
KNAG0B008003.493ON1821453901e-47
Ecym_12363.493ON1691703844e-47
KNAG0A079503.493ON1821453831e-46
KAFR0G037003.493ON1861453692e-44
NCAS0F035603.493ON1831463465e-41
Smik_4.212.61ON316150770.10
Kwal_23.46502.61ON385161770.11
Skud_4.352.61ON31763720.49
Kwal_23.4058singletonON216157681.3
YDL218W2.61ON31763681.6
Suva_4.272.61ON322150681.6
TDEL0H00180singletonON257142645.2
SAKL0F10076g7.297ON45329638.2
ZYRO0B07612g4.212ON60891638.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0F02750g
         (170 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0F02750g Chr6 complement(232715..233227) [513 bp, 170 aa] {O...   299   e-105
KLLA0D16280g Chr4 (1370792..1371301) [510 bp, 169 aa] {ON} simil...   209   2e-69
KLTH0F14850g Chr6 (1217267..1217782) [516 bp, 171 aa] {ON} simil...   209   2e-69
TDEL0D05610 Chr4 (1011746..1012273) [528 bp, 175 aa] {ON} Anc_3....   203   5e-67
Kwal_55.21238 s55 (744992..745504) [513 bp, 170 aa] {ON} YPR149W...   200   5e-66
Skud_16.444 Chr16 (783546..784067) [522 bp, 173 aa] {ON} YPR149W...   191   2e-62
TBLA0C04490 Chr3 (1088664..1089224) [561 bp, 186 aa] {ON} Anc_3....   187   1e-60
YPR149W Chr16 (829918..830439) [522 bp, 173 aa] {ON}  NCE102Prot...   187   1e-60
Smik_16.402 Chr16 (701857..702378) [522 bp, 173 aa] {ON} YPR149W...   187   1e-60
TPHA0D03280 Chr4 (676013..676567) [555 bp, 184 aa] {ON} Anc_3.49...   183   6e-59
CAGL0I10494g Chr9 complement(1037855..1038373) [519 bp, 172 aa] ...   182   1e-58
CAGL0L08448g Chr12 complement(928396..928917) [522 bp, 173 aa] {...   181   2e-58
ZYRO0D09966g Chr4 (841449..841985) [537 bp, 178 aa] {ON} weakly ...   177   1e-56
KAFR0C01970 Chr3 (393616..394155) [540 bp, 179 aa] {ON} Anc_3.49...   174   1e-55
NDAI0G00930 Chr7 complement(194039..194569) [531 bp, 176 aa] {ON...   174   1e-55
Suva_16.478 Chr16 (826406..826906) [501 bp, 166 aa] {ON} YPR149W...   173   3e-55
NDAI0B05880 Chr2 (1422880..1423428) [549 bp, 182 aa] {ON} Anc_3....   173   4e-55
Suva_7.419 Chr7 (724883..725407) [525 bp, 174 aa] {ON} YGR131W (...   172   7e-55
Kpol_1017.6 s1017 complement(22157..22720) [564 bp, 187 aa] {ON}...   171   3e-54
Smik_6.227 Chr6 (372610..373134) [525 bp, 174 aa] {ON} YGR131W (...   170   5e-54
YGR131W Chr7 (754726..755250) [525 bp, 174 aa] {ON}  FHN1Protein...   169   2e-53
NCAS0E00800 Chr5 complement(147211..147735) [525 bp, 174 aa] {ON...   165   4e-52
AFR312W Chr6 (1004068..1004574) [507 bp, 168 aa] {ON} Syntenic h...   164   7e-52
TBLA0D02960 Chr4 complement(721934..722503) [570 bp, 189 aa] {ON...   160   9e-50
Skud_7.442 Chr7 (733950..734474) [525 bp, 174 aa] {ON} YGR131W (...   154   7e-48
KNAG0B00800 Chr2 complement(147427..147975) [549 bp, 182 aa] {ON...   154   1e-47
Ecym_1236 Chr1 complement(485252..485761) [510 bp, 169 aa] {ON} ...   152   4e-47
KNAG0A07950 Chr1 (1269265..1269813) [549 bp, 182 aa] {ON} Anc_3....   152   1e-46
KAFR0G03700 Chr7 (763909..764469) [561 bp, 186 aa] {ON} Anc_3.49...   146   2e-44
NCAS0F03560 Chr6 (710517..711068) [552 bp, 183 aa] {ON} Anc_3.49...   137   5e-41
Smik_4.21 Chr4 (44522..45472) [951 bp, 316 aa] {ON} YDL218W (REAL)     34   0.10 
Kwal_23.4650 s23 (802842..803999) [1158 bp, 385 aa] {ON} YDL218W...    34   0.11 
Skud_4.35 Chr4 (62864..63817) [954 bp, 317 aa] {ON} YDL218W (REAL)     32   0.49 
Kwal_23.4058 s23 complement(551392..552042) [651 bp, 216 aa] {ON...    31   1.3  
YDL218W Chr4 (66493..67446) [954 bp, 317 aa] {ON} Putative prote...    31   1.6  
Suva_4.27 Chr4 (54848..55816) [969 bp, 322 aa] {ON} YDL218W (REAL)     31   1.6  
TDEL0H00180 Chr8 (19833..20606) [774 bp, 257 aa] {ON}                  29   5.2  
SAKL0F10076g Chr6 complement(773641..775002) [1362 bp, 453 aa] {...    29   8.2  
ZYRO0B07612g Chr2 (598538..600364) [1827 bp, 608 aa] {ON} highly...    29   8.6  

>SAKL0F02750g Chr6 complement(232715..233227) [513 bp, 170 aa] {ON}
           similar to uniprot|Q12207 Saccharomyces cerevisiae
           YPR149W NCE102 and to uniprot|P53279 Saccharomyces
           cerevisiae YGR131W
          Length = 170

 Score =  299 bits (766), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 155/170 (91%)

Query: 1   MLSILDNSLRLVNFAFLVIILGLTGSLIATQDEHSPRVNFAIFTAAFALVTDSFYAVFAN 60
           MLSILDNSLRLVNFAFLVIILGLTGSLIATQDEHSPRVNFAIFTAAFALVTDSFYAVFAN
Sbjct: 1   MLSILDNSLRLVNFAFLVIILGLTGSLIATQDEHSPRVNFAIFTAAFALVTDSFYAVFAN 60

Query: 61  LFSAFAWPILLVTWDFLNFVFTFSAATALAVGIRTHSCTNESYLFSNNITQGSTDRCRKA 120
           LFSAFAWPILLVTWDFLNFVFTFSAATALAVGIRTHSCTNESYLFSNNITQGSTDRCRKA
Sbjct: 61  LFSAFAWPILLVTWDFLNFVFTFSAATALAVGIRTHSCTNESYLFSNNITQGSTDRCRKA 120

Query: 121 QATVAFLYFSFFIFLTKLVLSVINVXXXXXXXXXXXXXXXNVGVPTISQV 170
           QATVAFLYFSFFIFLTKLVLSVINV               NVGVPTISQV
Sbjct: 121 QATVAFLYFSFFIFLTKLVLSVINVFSSGAFGSGSGSRRANVGVPTISQV 170

>KLLA0D16280g Chr4 (1370792..1371301) [510 bp, 169 aa] {ON} similar
           to uniprot|Q12207 Saccharomyces cerevisiae YPR149W
           NCE102 and to uniprot|P53279 Saccharomyces cerevisiae
           YGR131W
          Length = 169

 Score =  209 bits (532), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 109/170 (64%), Positives = 124/170 (72%), Gaps = 1/170 (0%)

Query: 1   MLSILDNSLRLVNFAFLVIILGLTGSLIATQDEHSPRVNFAIFTAAFALVTDSFYAVFAN 60
           MLSILDNSLR VNF FL+I+LGL G+LIATQD  S RVNFAIF A F +V DS YA+ AN
Sbjct: 1   MLSILDNSLRGVNFVFLIIVLGLVGNLIATQDHSSSRVNFAIFAAVFGIVFDSLYALIAN 60

Query: 61  LFSAFAWPILLVTWDFLNFVFTFSAATALAVGIRTHSCTNESYLFSNNITQGSTDRCRKA 120
             SA AWPI+LV+ DFLN+VFTFSAATALAVGIR  SCTN+S+   N I +GS DRCRKA
Sbjct: 61  FISALAWPIILVSLDFLNWVFTFSAATALAVGIRGGSCTNDSFTSGNKIAEGSKDRCRKA 120

Query: 121 QATVAFLYFSFFIFLTKLVLSVINVXXXXXXXXXXXXXXXNVGVPTISQV 170
           QA+  FLYFSF IFL K +LS++N                 VGVPTISQV
Sbjct: 121 QASTVFLYFSFAIFLVKFILSIVNA-ITSGAFGTSSNRKTQVGVPTISQV 169

>KLTH0F14850g Chr6 (1217267..1217782) [516 bp, 171 aa] {ON} similar
           to uniprot|Q12207 Saccharomyces cerevisiae YPR149W
           NCE102 and to uniprot|P53279 Saccharomyces cerevisiae
           YGR131W
          Length = 171

 Score =  209 bits (531), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 120/171 (70%), Positives = 135/171 (78%), Gaps = 1/171 (0%)

Query: 1   MLSILDNSLRLVNFAFLVIILGLTGSLIATQDEHS-PRVNFAIFTAAFALVTDSFYAVFA 59
           MLSILDNSLR +NFAFLVIILGLTGSL AT   H+ P+VNFAIFTAAF L+ DS YA+ A
Sbjct: 1   MLSILDNSLRALNFAFLVIILGLTGSLAATHKTHNNPQVNFAIFTAAFGLLFDSLYAIPA 60

Query: 60  NLFSAFAWPILLVTWDFLNFVFTFSAATALAVGIRTHSCTNESYLFSNNITQGSTDRCRK 119
           N  SA AWP+L+  +DFLNFVFTF+AATALAV IRTHSCTN+ YL SN +TQGSTDRCRK
Sbjct: 61  NFVSALAWPLLIAVFDFLNFVFTFAAATALAVAIRTHSCTNQDYLDSNTVTQGSTDRCRK 120

Query: 120 AQATVAFLYFSFFIFLTKLVLSVINVXXXXXXXXXXXXXXXNVGVPTISQV 170
           AQA+VAFLYFSFFIFL KL LS++N+               NVGVPTISQV
Sbjct: 121 AQASVAFLYFSFFIFLAKLGLSLVNLISVGAFGAGSSRRTGNVGVPTISQV 171

>TDEL0D05610 Chr4 (1011746..1012273) [528 bp, 175 aa] {ON} Anc_3.493
           YPR149W
          Length = 175

 Score =  203 bits (517), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 110/175 (62%), Positives = 131/175 (74%), Gaps = 5/175 (2%)

Query: 1   MLSILDNSLRLVNFAFLVIILGLTGSLIATQDEHSPRVNFAIFTAAFALVTDSFYAVFAN 60
           ML+I+DN+LRLVNFAFLVI+LGL G LI+++D HS RVNF +F AAF +VTDSFY + AN
Sbjct: 1   MLAIVDNALRLVNFAFLVILLGLVGELISSEDGHSSRVNFCMFAAAFGIVTDSFYGILAN 60

Query: 61  LFSAFAWPILLVTWDFLNFVFTFSAATALAVGIRTHSCTNESYLFSNNITQGSTDRCRKA 120
           ++  FAWP++L   DFLNF FTFSAATALAVGIRTHSC N+ YL SNNITQGST RCR A
Sbjct: 61  IWEVFAWPVILFALDFLNFAFTFSAATALAVGIRTHSCKNQDYLDSNNITQGSTQRCRLA 120

Query: 121 QATVAFLYFSFFIFLTKLVLSVINVX-----XXXXXXXXXXXXXXNVGVPTISQV 170
           QA+VAF YFSFFIFL K+++S+I +                     VGVPTISQV
Sbjct: 121 QASVAFFYFSFFIFLAKMIMSLIGIITNGPFSSRTTLTSRRRKSAQVGVPTISQV 175

>Kwal_55.21238 s55 (744992..745504) [513 bp, 170 aa] {ON} YPR149W
           (NCE102) - Involved in secretion of proteins that lack
           classical secretory signal sequences [contig 130] FULL
          Length = 170

 Score =  200 bits (509), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 109/170 (64%), Positives = 132/170 (77%)

Query: 1   MLSILDNSLRLVNFAFLVIILGLTGSLIATQDEHSPRVNFAIFTAAFALVTDSFYAVFAN 60
           MLSILDNSLR  NF FL+I+LGLTGSL AT+D ++P+VNFA+F AAF L+ D+ YA+ AN
Sbjct: 1   MLSILDNSLRAANFVFLLIVLGLTGSLAATRDNNNPQVNFAVFAAAFGLLFDTLYAIPAN 60

Query: 61  LFSAFAWPILLVTWDFLNFVFTFSAATALAVGIRTHSCTNESYLFSNNITQGSTDRCRKA 120
             SA AWP+L+  +DFLNFVFTF+AATALAV IR HSCTN  Y+ +N +TQGS+DRCRKA
Sbjct: 61  FISALAWPLLIAVFDFLNFVFTFAAATALAVAIRVHSCTNSDYVDNNKVTQGSSDRCRKA 120

Query: 121 QATVAFLYFSFFIFLTKLVLSVINVXXXXXXXXXXXXXXXNVGVPTISQV 170
           QA+VAFLYF+FF+FL KL LS++NV               NVGVPTISQV
Sbjct: 121 QASVAFLYFAFFVFLVKLALSLVNVFSVGAFSTSSGRKSANVGVPTISQV 170

>Skud_16.444 Chr16 (783546..784067) [522 bp, 173 aa] {ON} YPR149W
           (REAL)
          Length = 173

 Score =  191 bits (486), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 100/173 (57%), Positives = 118/173 (68%), Gaps = 3/173 (1%)

Query: 1   MLSILDNSLRLVNFAFLVIILGLTGSLIATQDEHSPRVNFAIFTAAFALVTDSFYAVFAN 60
           ML+  DN LR++NF FLVI++GL  SL+ TQD +S RVNF +F AA+ + TDS Y VFAN
Sbjct: 1   MLAPADNILRIINFLFLVIVIGLISSLLNTQDRNSSRVNFCMFAAAYGIFTDSLYGVFAN 60

Query: 61  LFSAFAWPILLVTWDFLNFVFTFSAATALAVGIRTHSCTNESYLFSNNITQGSTDRCRKA 120
            F   AWP++L T DFLNFVFTF+A T LAVGIR HSC N SY+ SN ITQGS  RCR+A
Sbjct: 61  FFEPLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNRSYVDSNGITQGSGTRCRQA 120

Query: 121 QATVAFLYFSFFIFLTKLVLSVINVXXXXX---XXXXXXXXXXNVGVPTISQV 170
           QA VAFLYFS  IFL K ++SV N+                   VGVPTISQV
Sbjct: 121 QAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSGSFSKRRRTGQVGVPTISQV 173

>TBLA0C04490 Chr3 (1088664..1089224) [561 bp, 186 aa] {ON} Anc_3.493
           YPR149W
          Length = 186

 Score =  187 bits (476), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 94/143 (65%), Positives = 113/143 (79%), Gaps = 2/143 (1%)

Query: 1   MLSILDNSLRLVNFAFLVIILGLTGSLIATQDE-HSPRVNFAIFTAAFALVTDSFYAVFA 59
           MLS   N LR++NF FLVII G+ G LI ++   HSPRVN+ +F A FALVTDSFYA+ A
Sbjct: 1   MLSRTANVLRIINFCFLVIITGMIGKLIESEKRPHSPRVNYCMFAAPFALVTDSFYAIPA 60

Query: 60  NLF-SAFAWPILLVTWDFLNFVFTFSAATALAVGIRTHSCTNESYLFSNNITQGSTDRCR 118
           N + S FAWPILL ++DFLNF FTF+A T L+VGIRTHSC N+ YLFSN ITQGST+RCR
Sbjct: 61  NFWPSPFAWPILLWSFDFLNFTFTFTAGTVLSVGIRTHSCLNKHYLFSNKITQGSTERCR 120

Query: 119 KAQATVAFLYFSFFIFLTKLVLS 141
            AQA++AF YFSFFI+L +LV S
Sbjct: 121 LAQASIAFYYFSFFIYLVQLVKS 143

>YPR149W Chr16 (829918..830439) [522 bp, 173 aa] {ON}  NCE102Protein
           of unknown function; contains transmembrane domains;
           involved in secretion of proteins that lack classical
           secretory signal sequences; component of the
           detergent-insoluble glycolipid-enriched complexes (DIGs)
          Length = 173

 Score =  187 bits (474), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 97/173 (56%), Positives = 115/173 (66%), Gaps = 3/173 (1%)

Query: 1   MLSILDNSLRLVNFAFLVIILGLTGSLIATQDEHSPRVNFAIFTAAFALVTDSFYAVFAN 60
           ML++ DN LR++NF FLVI +GL  SL+ TQ  HS RVN+ +F  A+ + TDS Y VFAN
Sbjct: 1   MLALADNILRIINFLFLVISIGLISSLLNTQHRHSSRVNYCMFACAYGIFTDSLYGVFAN 60

Query: 61  LFSAFAWPILLVTWDFLNFVFTFSAATALAVGIRTHSCTNESYLFSNNITQGSTDRCRKA 120
                AWP++L T DFLNFVFTF+A T LAVGIR HSC N SY+ SN ITQGS  RCR+A
Sbjct: 61  FIEPLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNSSYVDSNKITQGSGTRCRQA 120

Query: 121 QATVAFLYFSFFIFLTKLVLSVINVXXXXX---XXXXXXXXXXNVGVPTISQV 170
           QA VAFLYFS  IFL K ++SV N+                   VGVPTISQV
Sbjct: 121 QAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSGSFSKRRRTGQVGVPTISQV 173

>Smik_16.402 Chr16 (701857..702378) [522 bp, 173 aa] {ON} YPR149W
           (REAL)
          Length = 173

 Score =  187 bits (474), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 96/173 (55%), Positives = 116/173 (67%), Gaps = 3/173 (1%)

Query: 1   MLSILDNSLRLVNFAFLVIILGLTGSLIATQDEHSPRVNFAIFTAAFALVTDSFYAVFAN 60
           ML++ DN LR++NF FLVI + L  SL+ TQD+HS RVN+ +F  A+ + TDS Y VFAN
Sbjct: 1   MLALADNILRIINFLFLVISIALISSLLNTQDKHSSRVNYCMFACAYGIFTDSLYGVFAN 60

Query: 61  LFSAFAWPILLVTWDFLNFVFTFSAATALAVGIRTHSCTNESYLFSNNITQGSTDRCRKA 120
                AWP++L T DFLNFVFTF+A T LAVGIR HSC N SY+ SN ITQGS  RCR+A
Sbjct: 61  FIEPLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNSSYVDSNKITQGSGTRCRQA 120

Query: 121 QATVAFLYFSFFIFLTKLVLSVINVXXX---XXXXXXXXXXXXNVGVPTISQV 170
           QA VAFLYFS  IFL K ++S+ N+                   VGVPTISQV
Sbjct: 121 QAAVAFLYFSCAIFLAKTLMSIFNMISNGAFGSGSFSKRRRTGQVGVPTISQV 173

>TPHA0D03280 Chr4 (676013..676567) [555 bp, 184 aa] {ON} Anc_3.493
           YPR149W
          Length = 184

 Score =  183 bits (464), Expect = 6e-59,   Method: Compositional matrix adjust.
 Identities = 107/184 (58%), Positives = 123/184 (66%), Gaps = 14/184 (7%)

Query: 1   MLSILDNSLRLVNFAFLVIILGLTGSLIATQDEHSPRVNFAIFTAAFALVTDSFYAVFAN 60
           ML + DN LR VNF F VI LGL GSL+ATQ++HS RVN+ IF   FALVTD+FY   AN
Sbjct: 1   MLGLADNILRGVNFCFFVICLGLVGSLLATQNQHSSRVNYCIFVPPFALVTDTFYGALAN 60

Query: 61  LFS-AFAWPILLVTWDFLNFVFTFSAATALAVGIRTHSCTNESYLFSNNITQGSTDRCRK 119
           ++S   AWPI+L  +DFLNF FTF+A T LAVG RTHSCTN+SYL SNNITQGSTDRCRK
Sbjct: 61  IWSTPLAWPIILFCFDFLNFAFTFTAGTVLAVGTRTHSCTNQSYLDSNNITQGSTDRCRK 120

Query: 120 AQATVAFLYFSFFIFLTKLVLSVINVXXXXXXXXXX-------------XXXXXNVGVPT 166
           AQA  AF YFSFFIFL KL++S IN+                             +GVP 
Sbjct: 121 AQAATAFFYFSFFIFLAKLIMSSINLFTNGALGSMSFGRRRGGAGVGVPGAASPQIGVPN 180

Query: 167 ISQV 170
           ISQV
Sbjct: 181 ISQV 184

>CAGL0I10494g Chr9 complement(1037855..1038373) [519 bp, 172 aa]
           {ON} highly similar to uniprot|Q12207 Saccharomyces
           cerevisiae YPR149w NCE2 or uniprot|P53279 Saccharomyces
           cerevisiae YGR131w
          Length = 172

 Score =  182 bits (461), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 92/172 (53%), Positives = 113/172 (65%), Gaps = 2/172 (1%)

Query: 1   MLSILDNSLRLVNFAFLVIILGLTGSLIATQDEHSPRVNFAIFTAAFALVTDSFYAVFAN 60
           MLS+ DN LR+VN  FL+I +GL  SLI T+  HS RVNF +F AA+ + TDS Y +FAN
Sbjct: 1   MLSVADNLLRIVNAVFLIICIGLASSLINTRKRHSSRVNFCLFAAAYGIATDSLYGIFAN 60

Query: 61  LFSAFAWPILLVTWDFLNFVFTFSAATALAVGIRTHSCTNESYL-FSNNITQGSTDRCRK 119
            F   AWP++L   DFLNFVFTF+A T LAVGIR HSC N+ YL     I QGS  RCR+
Sbjct: 61  FFEPLAWPLVLFVLDFLNFVFTFTAGTVLAVGIRAHSCNNKRYLERETKIVQGSGTRCRQ 120

Query: 120 AQATVAFLYFSFFIFLTKLVLSVINVXXXXX-XXXXXXXXXXNVGVPTISQV 170
           AQA VAF YFS  IFL K+++S+++V                 VGVP+ISQV
Sbjct: 121 AQALVAFFYFSMAIFLAKMIMSIVSVVSNGAFGAKLRRKHHTEVGVPSISQV 172

>CAGL0L08448g Chr12 complement(928396..928917) [522 bp, 173 aa] {ON}
           highly similar to uniprot|Q12207 Saccharomyces
           cerevisiae YPR149w or uniprot|P53279 Saccharomyces
           cerevisiae YGR131w
          Length = 173

 Score =  181 bits (459), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 88/173 (50%), Positives = 113/173 (65%), Gaps = 3/173 (1%)

Query: 1   MLSILDNSLRLVNFAFLVIILGLTGSLIATQDEHSPRVNFAIFTAAFALVTDSFYAVFAN 60
           ML++ DN LR+VNF F+VI +GL   LIAT+D HS RVN+ +F AA+ + TDS Y VFAN
Sbjct: 1   MLAVTDNLLRIVNFVFMVICIGLISDLIATRDRHSSRVNYCMFAAAYGIATDSLYGVFAN 60

Query: 61  LFSAFAWPILLVTWDFLNFVFTFSAATALAVGIRTHSCTNESYLFSNNITQGSTDRCRKA 120
            F   AWP++L T DFLNF F  +A   LAVGIR HSC N  Y  +N I QGS  RCR++
Sbjct: 61  FFEILAWPLILFTLDFLNFAFMLTAGCVLAVGIRAHSCNNAHYRENNKIIQGSERRCRES 120

Query: 121 QATVAFLYFSFFIFLTKLVLSVINVXXXXXXXXXXXXXXXN---VGVPTISQV 170
           QA VAF +FS  IFL K+++S++N+               N   VGVP++SQV
Sbjct: 121 QAAVAFFFFSMAIFLAKMIMSLLNIFSNGAFGTKFIRRRRNNAEVGVPSVSQV 173

>ZYRO0D09966g Chr4 (841449..841985) [537 bp, 178 aa] {ON} weakly
           similar to uniprot|Q12207 Saccharomyces cerevisiae
           YPR149W NCE102 and to uniprot|P53279 Saccharomyces
           cerevisiae YGR131W
          Length = 178

 Score =  177 bits (449), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 103/178 (57%), Positives = 124/178 (69%), Gaps = 8/178 (4%)

Query: 1   MLSILDNSLRLVNFAFLVIILGLTGSLIATQDE-HSPRVNFAIFTAAFALVTDSFYAVFA 59
           ML++ DN LR VNF F VI+LGL G LI ++   H+ RVNF +F AAF +V DSFY + A
Sbjct: 1   MLALTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILA 60

Query: 60  NLFSAFAWPILLVTWDFLNFVFTFSAATALAVGIRTHSCTNESYLFSNNITQGSTDRCRK 119
           N+F  FA+P++L   DFLNFVFTF+AATALAVGIRTHSCTN  YL SN ITQGST RCR+
Sbjct: 61  NIFVPFAFPVILFILDFLNFVFTFTAATALAVGIRTHSCTNRHYLDSNKITQGSTSRCRE 120

Query: 120 AQATVAFLYFSFFIFLTKLVLSVINVXX-------XXXXXXXXXXXXXNVGVPTISQV 170
           AQA VAF YF+FFIFL K+V+S +++                      NVGVPTISQV
Sbjct: 121 AQAVVAFFYFAFFIFLFKMVMSFLSLLSNGAFGSSSGFSSRRRRTQQANVGVPTISQV 178

>KAFR0C01970 Chr3 (393616..394155) [540 bp, 179 aa] {ON} Anc_3.493
           YPR149W
          Length = 179

 Score =  174 bits (441), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 87/146 (59%), Positives = 106/146 (72%), Gaps = 1/146 (0%)

Query: 1   MLSILDNSLRLVNFAFLVIILGLTGSLIATQD-EHSPRVNFAIFTAAFALVTDSFYAVFA 59
           ML + DN LRL+N  FL+I + LT +LI TQ+  H+ RVN+ +F  AF L  DS Y + A
Sbjct: 1   MLGVADNILRLINAVFLIIAIALTSALINTQNGHHNSRVNYCMFACAFGLFFDSIYGICA 60

Query: 60  NLFSAFAWPILLVTWDFLNFVFTFSAATALAVGIRTHSCTNESYLFSNNITQGSTDRCRK 119
           N F   AWP+LL T DFLNF FTFSAATALAVGIR HSC N+SYL SN I +GS  RCR+
Sbjct: 61  NFFQVLAWPLLLFTLDFLNFAFTFSAATALAVGIRAHSCGNQSYLDSNKIVRGSGQRCRE 120

Query: 120 AQATVAFLYFSFFIFLTKLVLSVINV 145
           AQA VAFLYFS  IF+ K+++S IN+
Sbjct: 121 AQALVAFLYFSTAIFIAKMIMSCINL 146

>NDAI0G00930 Chr7 complement(194039..194569) [531 bp, 176 aa] {ON}
           Anc_3.493 YGR131W
          Length = 176

 Score =  174 bits (441), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 89/176 (50%), Positives = 114/176 (64%), Gaps = 6/176 (3%)

Query: 1   MLSILDNSLRLVNFAFLVIILGLTGSLIATQDEHSPRVNFAIFTAAFALVTDSFYAVFAN 60
           MLS+ DN LRL+N  FLVI +GL  +L+ TQ  H+ R+N+ +FT  + L+TDSF+ + AN
Sbjct: 1   MLSVADNLLRLLNAMFLVICIGLNSALLNTQQGHNSRINYCMFTCVYCLLTDSFFGILAN 60

Query: 61  LFSAFAWPILLVTWDFLNFVFTFSAATALAVGIRTHSCTNESYLFSNNITQGSTDRCRKA 120
            F   ++P +L T DFLNF FTF A T LA GIR+HSC N+SYL  N ITQGS +RCR++
Sbjct: 61  FFEFLSFPFILFTLDFLNFSFTFVAGTVLATGIRSHSCNNQSYLDRNKITQGSGNRCRES 120

Query: 121 QATVAFLYFSFFIFLTKLVLSVINVXXXX------XXXXXXXXXXXNVGVPTISQV 170
           QA VAF YFS FIFL KL +S I++                      VGVP+ISQV
Sbjct: 121 QALVAFFYFSMFIFLIKLAMSTISMIQNGAFSNTFTSRRRRRNGAAEVGVPSISQV 176

>Suva_16.478 Chr16 (826406..826906) [501 bp, 166 aa] {ON} YPR149W
           (REAL)
          Length = 166

 Score =  173 bits (438), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 92/173 (53%), Positives = 116/173 (67%), Gaps = 10/173 (5%)

Query: 1   MLSILDNSLRLVNFAFLVIILGLTGSLIATQDEHSPRVNFAIFTAAFALVTDSFYAVFAN 60
           ML+ +DN LR++NF FLVI +GL  SL+ TQ  +S R+N+ +F  A+A+VTDS Y VFAN
Sbjct: 1   MLAPVDNILRIINFLFLVISIGLISSLLNTQSGNSSRINYCMFAVAYAIVTDSLYGVFAN 60

Query: 61  LFSAFAWPILLVTWDFLNFVFTFSAATALAVGIRTHSCTNESYLFSNNITQGSTDRCRKA 120
            F   AWP++L + DFLNFVFTF+A       IR HSC N++YL SN+ITQGS +RCR+A
Sbjct: 61  FFEPLAWPLILFSLDFLNFVFTFTA-------IRAHSCRNQTYLASNSITQGSGNRCREA 113

Query: 121 QATVAFLYFSFFIFLTKLVLSVINVXXX---XXXXXXXXXXXXNVGVPTISQV 170
           QA VAFLYFS  IFL K ++SV N+                   VGVPTISQV
Sbjct: 114 QAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSGSFSKRRRTGQVGVPTISQV 166

>NDAI0B05880 Chr2 (1422880..1423428) [549 bp, 182 aa] {ON} Anc_3.493
           YGR131W
          Length = 182

 Score =  173 bits (439), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 94/182 (51%), Positives = 117/182 (64%), Gaps = 12/182 (6%)

Query: 1   MLSILDNSLRLVNFAFLVIILGLTGSLIATQDEHSPRVNFAIFTAAFALVTDSFYAVFAN 60
           MLS +DN LR++N  FLV+ +    +L+ TQ  +S R+NF +F AAF L+TDSF+ V  N
Sbjct: 1   MLSKVDNILRVINAIFLVLTMAFISALLNTQRNNSSRINFCMFAAAFGLLTDSFFGVAFN 60

Query: 61  LFSAFA-WPILLVTWDFLNFVFTFSAATALAVGIRTHSCTNESYLFSNNITQGSTDRCRK 119
           +F A A WPILL  +DFLNFVFTF+A T LAV IR HSC NE Y+ SN+ITQGS +RCR 
Sbjct: 61  MFDALASWPILLFIFDFLNFVFTFTAGTVLAVAIRAHSCKNERYVNSNSITQGSENRCRM 120

Query: 120 AQATVAFLYFSFFIFLTKLVLSVINVXX-----------XXXXXXXXXXXXXNVGVPTIS 168
           +QA VAF YFS FIFL K+++S IN+                           VGVPTIS
Sbjct: 121 SQAAVAFFYFSCFIFLAKMIMSGINMASNGLFGSGTWAGSRSKRRTNRSGANEVGVPTIS 180

Query: 169 QV 170
           QV
Sbjct: 181 QV 182

>Suva_7.419 Chr7 (724883..725407) [525 bp, 174 aa] {ON} YGR131W
           (REAL)
          Length = 174

 Score =  172 bits (436), Expect = 7e-55,   Method: Compositional matrix adjust.
 Identities = 85/174 (48%), Positives = 117/174 (67%), Gaps = 4/174 (2%)

Query: 1   MLSILDNSLRLVNFAFLVIILGLTGSLIATQDEHSPRVNFAIFTAAFALVTDSFYAVFAN 60
           MLS+ DN +R++N  FL+I +GL   LI++Q +HS RVNF +F AA+ L+TDSFY   AN
Sbjct: 1   MLSVADNIVRIINAIFLIISIGLVSGLISSQTKHSSRVNFCMFAAAYGLLTDSFYGCLAN 60

Query: 61  LFSAFAWPILLVTWDFLNFVFTFSAATALAVGIRTHSCTNESYLFSNNITQGSTDRCRKA 120
           L+S+  +P+++   DFLNF+FTF A TALAVGIR HSC+N++YL +N ITQGS  RC +A
Sbjct: 61  LWSSLTYPVIMFVLDFLNFLFTFIAGTALAVGIRCHSCSNKTYLDNNKITQGSGSRCHQA 120

Query: 121 QATVAFLYFSFFIFLTKLVLSVINVXX----XXXXXXXXXXXXXNVGVPTISQV 170
           +A V F YFS  +FL K+V+S+  +                    +G+PTISQV
Sbjct: 121 KAAVVFFYFSCILFLIKVVVSIAAMVQNGGFGFGNSFGRRRARRQMGIPTISQV 174

>Kpol_1017.6 s1017 complement(22157..22720) [564 bp, 187 aa] {ON}
           complement(22157..22720) [564 nt, 188 aa]
          Length = 187

 Score =  171 bits (434), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 89/146 (60%), Positives = 114/146 (78%), Gaps = 1/146 (0%)

Query: 1   MLSILDNSLRLVNFAFLVIILGLTGSLIATQDEHSPRVNFAIFTAAFALVTDSFYAVFAN 60
           MLS+ DN +R +NF F VI +GL GSL+AT+  HS RVN+ +F   FA+VTDSFY + AN
Sbjct: 1   MLSLADNIMRAINFCFFVICMGLIGSLLATEKGHSSRVNYCMFVPPFAVVTDSFYGILAN 60

Query: 61  LFS-AFAWPILLVTWDFLNFVFTFSAATALAVGIRTHSCTNESYLFSNNITQGSTDRCRK 119
           +++  FAWPI+L  +DFLNF FTF+A T L+VGIRTHSC N +Y+ +N I QGSTDRCRK
Sbjct: 61  IWTTPFAWPIILFAFDFLNFAFTFTAGTVLSVGIRTHSCKNRNYIDNNKIIQGSTDRCRK 120

Query: 120 AQATVAFLYFSFFIFLTKLVLSVINV 145
           AQA++AF YFSFFIF  K+V+S IN+
Sbjct: 121 AQASIAFFYFSFFIFFVKVVMSAINL 146

>Smik_6.227 Chr6 (372610..373134) [525 bp, 174 aa] {ON} YGR131W
           (REAL)
          Length = 174

 Score =  170 bits (431), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 87/174 (50%), Positives = 112/174 (64%), Gaps = 4/174 (2%)

Query: 1   MLSILDNSLRLVNFAFLVIILGLTGSLIATQDEHSPRVNFAIFTAAFALVTDSFYAVFAN 60
           MLS  DN +R++N  FL+I +GL   LI+TQ +HS RVNF +FTAA+ LVTDS Y   AN
Sbjct: 1   MLSAADNLIRIINAVFLIISIGLISGLISTQAKHSSRVNFCMFTAAYGLVTDSLYGFLAN 60

Query: 61  LFSAFAWPILLVTWDFLNFVFTFSAATALAVGIRTHSCTNESYLFSNNITQGSTDRCRKA 120
            +S+  +P +L+  D LNF+FTF AATALAVGIR HSC N++YL  N ITQ S+ RC ++
Sbjct: 61  FWSSLTYPAILLALDILNFIFTFVAATALAVGIRCHSCKNKTYLEQNKITQASSSRCHQS 120

Query: 121 QATVAFLYFSFFIFLTKLVLSVINVXX----XXXXXXXXXXXXXNVGVPTISQV 170
           QA VAF YFS F+FL K+ ++                        +GVPTISQV
Sbjct: 121 QAAVAFFYFSCFLFLIKVTVTAAGTIQNGGFGFNSGFGRRRARRQLGVPTISQV 174

>YGR131W Chr7 (754726..755250) [525 bp, 174 aa] {ON}  FHN1Protein of
           unknown function; induced by ketoconazole; promoter
           region contains sterol regulatory element motif, which
           has been identified as a Upc2p-binding site;
           overexpression complements function of Nce102p in NCE102
           deletion strain
          Length = 174

 Score =  169 bits (427), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 85/174 (48%), Positives = 112/174 (64%), Gaps = 4/174 (2%)

Query: 1   MLSILDNSLRLVNFAFLVIILGLTGSLIATQDEHSPRVNFAIFTAAFALVTDSFYAVFAN 60
           MLS  DN +R++N  FL+I +GL   LI TQ +HS RVNF +F A + LVTDS Y   AN
Sbjct: 1   MLSAADNLVRIINAVFLIISIGLISGLIGTQTKHSSRVNFCMFAAVYGLVTDSLYGFLAN 60

Query: 61  LFSAFAWPILLVTWDFLNFVFTFSAATALAVGIRTHSCTNESYLFSNNITQGSTDRCRKA 120
            +++  +P +L+  DFLNF+FTF AATALAVGIR HSC N++YL  N I QGS+ RC ++
Sbjct: 61  FWTSLTYPAILLVLDFLNFIFTFVAATALAVGIRCHSCKNKTYLEQNKIIQGSSSRCHQS 120

Query: 121 QATVAFLYFSFFIFLTKLVLSVI----NVXXXXXXXXXXXXXXXNVGVPTISQV 170
           QA VAF YFS F+FL K+ ++ +    N                 +G+PTISQV
Sbjct: 121 QAAVAFFYFSCFLFLIKVTVATMGMMQNGGFGSNTGFSRRRARRQMGIPTISQV 174

>NCAS0E00800 Chr5 complement(147211..147735) [525 bp, 174 aa] {ON}
           Anc_3.493 YGR131W
          Length = 174

 Score =  165 bits (418), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 84/174 (48%), Positives = 108/174 (62%), Gaps = 4/174 (2%)

Query: 1   MLSILDNSLRLVNFAFLVIILGLTGSLIATQDEHSPRVNFAIFTAAFALVTDSFYAVFAN 60
           ML + DN LR++N  FLVI +GL  +L+ T+  ++ R+N+ +FT A+ L TDS Y +FAN
Sbjct: 1   MLGVADNLLRILNAVFLVICIGLNSALLNTKTHNNSRINYCMFTCAYCLTTDSIYGIFAN 60

Query: 61  LFSAFAWPILLVTWDFLNFVFTFSAATALAVGIRTHSCTNESYLFSNNITQGSTDRCRKA 120
            F   A P L    DFLNF FTF A T LA GIR HSC +E Y+ SN ITQG  +RCR++
Sbjct: 61  FFDILALPALCFCLDFLNFAFTFVAGTVLATGIRAHSCKSEHYVNSNKITQGFKNRCRES 120

Query: 121 QATVAFLYFSFFIFLTKLVLSVINVXX----XXXXXXXXXXXXXNVGVPTISQV 170
           QA VAF YFS  IFL KL++S IN+                    +GVP+ISQV
Sbjct: 121 QALVAFFYFSMAIFLAKLIMSTINMIQNGAFTQHIGRRRRRNAAEIGVPSISQV 174

>AFR312W Chr6 (1004068..1004574) [507 bp, 168 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR149W (NCE102) and
           YGR131W
          Length = 168

 Score =  164 bits (416), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 98/170 (57%), Positives = 115/170 (67%), Gaps = 2/170 (1%)

Query: 1   MLSILDNSLRLVNFAFLVIILGLTGSLIATQDEHSPRVNFAIFTAAFALVTDSFYAVFAN 60
           MLSILDNSLR VNF FL+I+LGLTGSLI  Q     RVNF +FTA FALVTDSFY++ AN
Sbjct: 1   MLSILDNSLRAVNFVFLIIVLGLTGSLIHGQRNSHSRVNFGLFTAVFALVTDSFYSIVAN 60

Query: 61  LFSAFAWPILLVTWDFLNFVFTFSAATALAVGIRTHSCTNESYLFSNNITQGSTDRCRKA 120
             SAFAWPI+ +  D LN +FTF+AATAL   I  HSC+N  +L  N I++ STDRCRK 
Sbjct: 61  FISAFAWPIITIALDVLNLIFTFAAATALGQSIGAHSCSNRGFLDGNTISEQSTDRCRKV 120

Query: 121 QATVAFLYFSFFIFLTKLVLSVINVXXXXXXXXXXXXXXXNVGVPTISQV 170
           QA+  FL+FSFFIFL K V S +N+                  VPTISQV
Sbjct: 121 QASSTFLFFSFFIFLAKAVFSGLNIFSSGAFSSGGSKRGGG--VPTISQV 168

>TBLA0D02960 Chr4 complement(721934..722503) [570 bp, 189 aa] {ON}
           Anc_3.493 YPR149W
          Length = 189

 Score =  160 bits (404), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 78/145 (53%), Positives = 103/145 (71%), Gaps = 2/145 (1%)

Query: 1   MLSILDNSLRLVNFAFLVIILGLTGSLIATQD-EHSPRVNFAIFTAAFALVTDSFYAVFA 59
           ML + DN  R+ NF F VI  G+ G+L+ T+   HS RVN+ +F  A+ LV+DSFY + A
Sbjct: 1   MLELYDNVFRIFNFCFFVITAGMIGNLLNTEHGHHSSRVNYCMFPPAWGLVSDSFYGILA 60

Query: 60  NLF-SAFAWPILLVTWDFLNFVFTFSAATALAVGIRTHSCTNESYLFSNNITQGSTDRCR 118
           NL    FA+P +L  +DFLNFVFTF+A T LAVGIRTHSCTN+ Y   N I QGS  RCR
Sbjct: 61  NLVPEPFAFPPILFAFDFLNFVFTFTAGTVLAVGIRTHSCTNKEYRRENYIIQGSERRCR 120

Query: 119 KAQATVAFLYFSFFIFLTKLVLSVI 143
           +AQA +AF YFS F+FL K++++++
Sbjct: 121 EAQACIAFFYFSMFLFLVKVLITLV 145

>Skud_7.442 Chr7 (733950..734474) [525 bp, 174 aa] {ON} YGR131W
           (REAL)
          Length = 174

 Score =  154 bits (390), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 90/174 (51%), Positives = 116/174 (66%), Gaps = 4/174 (2%)

Query: 1   MLSILDNSLRLVNFAFLVIILGLTGSLIATQDEHSPRVNFAIFTAAFALVTDSFYAVFAN 60
           MLS  DN +R+V+  FL+I +GL G L+ TQ   S RVNF +F AA+ L+TDSFY   AN
Sbjct: 1   MLSAADNLIRIVSAVFLIISIGLIGGLMGTQTNGSSRVNFCMFAAAYGLITDSFYGFLAN 60

Query: 61  LFSAFAWPILLVTWDFLNFVFTFSAATALAVGIRTHSCTNESYLFSNNITQGSTDRCRKA 120
            +S+  +P +L+  DFLNF+FTF+AATALAVGIR HSC N++YL  NNITQGS+ RC ++
Sbjct: 61  FWSSLTYPAILLVLDFLNFLFTFAAATALAVGIRCHSCKNKTYLEQNNITQGSSSRCHQS 120

Query: 121 QATVAFLYFSFFIFLTKLVLSVINVXXXXX----XXXXXXXXXXNVGVPTISQV 170
           QA VAF YFS F+FL K+ +SV  +                    +GVPTISQV
Sbjct: 121 QAAVAFFYFSCFLFLIKVTVSVAGMMQNGGFGFNTGYGRRRARRQMGVPTISQV 174

>KNAG0B00800 Chr2 complement(147427..147975) [549 bp, 182 aa] {ON}
           Anc_3.493 YPR149W
          Length = 182

 Score =  154 bits (390), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 75/145 (51%), Positives = 95/145 (65%)

Query: 1   MLSILDNSLRLVNFAFLVIILGLTGSLIATQDEHSPRVNFAIFTAAFALVTDSFYAVFAN 60
           ML + DN LRL+NF FLVI L    +LI TQ  H  RVN+ +F AA+ + TD  Y + AN
Sbjct: 1   MLGVADNLLRLLNFCFLVICLAFISTLINTQKFHISRVNYCMFAAAYGIATDGLYGLLAN 60

Query: 61  LFSAFAWPILLVTWDFLNFVFTFSAATALAVGIRTHSCTNESYLFSNNITQGSTDRCRKA 120
            +   AWP++L T DFLNF FT +A   LAVGIR HSC N  Y   N+I QGS +RCR +
Sbjct: 61  FWEPLAWPLILFTLDFLNFAFTLTAGIVLAVGIRAHSCKNVRYRERNHIIQGSENRCRIS 120

Query: 121 QATVAFLYFSFFIFLTKLVLSVINV 145
           QA  AF +FS  IF+ K+V+S IN+
Sbjct: 121 QAATAFFFFSMGIFIAKMVMSGINL 145

>Ecym_1236 Chr1 complement(485252..485761) [510 bp, 169 aa] {ON}
           similar to Ashbya gossypii AFR312W
          Length = 169

 Score =  152 bits (384), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 96/170 (56%), Positives = 114/170 (67%), Gaps = 1/170 (0%)

Query: 1   MLSILDNSLRLVNFAFLVIILGLTGSLIATQDEHSPRVNFAIFTAAFALVTDSFYAVFAN 60
           MLSILDNSLR  NF FL+I+L LTGSLI  Q+    RVNF +FTA FAL+ DS Y+V AN
Sbjct: 1   MLSILDNSLRAANFLFLIIVLALTGSLINGQNRSHSRVNFGLFTAIFALLFDSLYSVLAN 60

Query: 61  LFSAFAWPILLVTWDFLNFVFTFSAATALAVGIRTHSCTNESYLFSNNITQGSTDRCRKA 120
             SA AWPILL+T D LN +FTF+AATAL   I  HSC+N  +L  N+I++G   RCRK 
Sbjct: 61  FISALAWPILLITTDVLNLIFTFAAATALGAAIGPHSCSNSGFLRGNDISEGREGRCRKV 120

Query: 121 QATVAFLYFSFFIFLTKLVLSVINVXXXXXXXXXXXXXXXNVGVPTISQV 170
           QA+  FL+FSFFIFL K VLS +N+                 GVPTISQV
Sbjct: 121 QASSVFLFFSFFIFLAKAVLSGLNIVSTGAFSSGSGRKTGG-GVPTISQV 169

>KNAG0A07950 Chr1 (1269265..1269813) [549 bp, 182 aa] {ON} Anc_3.493
           YPR149W
          Length = 182

 Score =  152 bits (383), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 80/145 (55%), Positives = 103/145 (71%)

Query: 1   MLSILDNSLRLVNFAFLVIILGLTGSLIATQDEHSPRVNFAIFTAAFALVTDSFYAVFAN 60
           ML++ D  LRLVNF FLVI +GL  +L+ TQ  HS R+N+ +FTAA+ + TDSFY V AN
Sbjct: 1   MLALADIFLRLVNFVFLVICMGLISALLNTQHGHSSRINYCMFTAAYGITTDSFYGVVAN 60

Query: 61  LFSAFAWPILLVTWDFLNFVFTFSAATALAVGIRTHSCTNESYLFSNNITQGSTDRCRKA 120
            +   +WP+LL   DFLNFVFT +A   LAVGIR HSC N +Y   N I QGS +RCR+A
Sbjct: 61  FWEPLSWPLLLGALDFLNFVFTLTAGCVLAVGIRAHSCKNVAYRNKNKIVQGSENRCRQA 120

Query: 121 QATVAFLYFSFFIFLTKLVLSVINV 145
           QA VAF +FS  IFL K ++S++N+
Sbjct: 121 QAAVAFFFFSMAIFLAKFIMSLVNI 145

>KAFR0G03700 Chr7 (763909..764469) [561 bp, 186 aa] {ON} Anc_3.493
           YPR149W
          Length = 186

 Score =  146 bits (369), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 82/145 (56%), Positives = 100/145 (68%), Gaps = 1/145 (0%)

Query: 1   MLSILDNSLRLVNFAFLVIILGLTGSLIATQDEH-SPRVNFAIFTAAFALVTDSFYAVFA 59
           ML+I DNSLRLVNF F+VI +     L+ T+  H S RVN+ +F  AF ++TDS Y +FA
Sbjct: 1   MLAIADNSLRLVNFCFMVITMAFIAQLLNTRQGHNSARVNYCMFAVAFGILTDSIYGLFA 60

Query: 60  NLFSAFAWPILLVTWDFLNFVFTFSAATALAVGIRTHSCTNESYLFSNNITQGSTDRCRK 119
           N F   AWPI+L  +DFLNFVF F+A T LAVGIR H+C NE+Y  SN I +GS  RCR 
Sbjct: 61  NFFEQLAWPIILFVFDFLNFVFFFTAGTVLAVGIRAHNCNNEAYRNSNKIVRGSETRCRV 120

Query: 120 AQATVAFLYFSFFIFLTKLVLSVIN 144
           AQA VAF YFS  IFL K V S++ 
Sbjct: 121 AQAAVAFFYFSMAIFLVKGVFSIMK 145

>NCAS0F03560 Chr6 (710517..711068) [552 bp, 183 aa] {ON} Anc_3.493
           YGR131W
          Length = 183

 Score =  137 bits (346), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 79/146 (54%), Positives = 104/146 (71%), Gaps = 1/146 (0%)

Query: 1   MLSILDNSLRLVNFAFLVIILGLTGSLIATQDEHSPRVNFAIFTAAFALVTDSFYAVFAN 60
           MLS +DN+LR  N  FLV+ +    +L++TQ+  S RVN+ +F AAF L+TDSF+ + AN
Sbjct: 1   MLSKVDNTLRFFNGIFLVLAIAFISTLLSTQNHGSSRVNYCMFAAAFGLLTDSFFGMAAN 60

Query: 61  LFSAFA-WPILLVTWDFLNFVFTFSAATALAVGIRTHSCTNESYLFSNNITQGSTDRCRK 119
           L    + WPI+L  +DFLNFVFTF+A T LAVGIR HSC N  YL SN I QGS  RCR 
Sbjct: 61  LIDFLSSWPIILFVFDFLNFVFTFTAGTVLAVGIRCHSCNNRRYLESNKIIQGSGIRCRV 120

Query: 120 AQATVAFLYFSFFIFLTKLVLSVINV 145
           +QA VAF YF+ F+FL K+++S I++
Sbjct: 121 SQAAVAFFYFAAFVFLAKMIMSAISM 146

>Smik_4.21 Chr4 (44522..45472) [951 bp, 316 aa] {ON} YDL218W (REAL)
          Length = 316

 Score = 34.3 bits (77), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 43/150 (28%), Positives = 65/150 (43%), Gaps = 18/150 (12%)

Query: 9   LRLVNFAFLVIILGLTGSLI-ATQDEHSPRVNFAIFTAAFALVTDSFYAVFANLFSAFAW 67
           LR   FA  V+++ L    I A  D  + + NF + T   ++    FY +   +    A 
Sbjct: 12  LRFSQFASSVLVMSLLAYAIHAYGDRGNKKTNFTLATGVISV----FYLIALGIL-CLAL 66

Query: 68  PILLVTW-----DFLNFVFTFSAATALAVGIRTHSC--TNESYLF----SNNITQGSTDR 116
           P L+        + +  +   +A   LA     HSC  TN + L+    S   T  S  R
Sbjct: 67  PTLIYIGMYFCAELIVCMLWLAAFVVLAKAQGEHSCGSTNANGLYYNPYSGQYTANSHRR 126

Query: 117 -CRKAQATVAFLYFSFFIFLTKLVLSVINV 145
            C  +QA +AF    F +FLT ++L  INV
Sbjct: 127 ACNSSQAAIAFSGLCFLLFLTSVILLGINV 156

>Kwal_23.4650 s23 (802842..803999) [1158 bp, 385 aa] {ON} YDL218W -
           1:1 [contig 5] FULL
          Length = 385

 Score = 34.3 bits (77), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 43/161 (26%), Positives = 67/161 (41%), Gaps = 23/161 (14%)

Query: 8   SLRLVNFAFLVIILGLTGSLIATQD-EHSPRVNFAIFTAAFALVTDSFYAVFANLFSAFA 66
           SLR++ F   VI+LGL   ++   D   S + N+ +  A  ++V     +V   + S F 
Sbjct: 77  SLRMLQFICSVIVLGLLAYVLKGYDYRGSHKTNYGLAVAVISVVYLLLLSVLGAVLSKFL 136

Query: 67  WPILLVTWDFLNFVFTFSAATALA-------VGIRTHSCTNESY--------------LF 105
            P L + ++ + +    SA   LA        G+R  S  N  Y               F
Sbjct: 137 LPGLYLLFEMIMWALWLSAFVVLAKEHGSRSCGLRNTSSYNPKYGSTSSYQSSGGDYDPF 196

Query: 106 SNNITQGSTDR-CRKAQATVAFLYFSFFIFLTKLVLSVINV 145
           +N  T  S  R C   +A +AF   +  +F+   VL  INV
Sbjct: 197 TNRYTTNSYSRPCHSGKAAIAFAGLATLLFMITPVLIGINV 237

>Skud_4.35 Chr4 (62864..63817) [954 bp, 317 aa] {ON} YDL218W (REAL)
          Length = 317

 Score = 32.3 bits (72), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 34/63 (53%), Gaps = 5/63 (7%)

Query: 88  ALAVGIRTHSCTNESYLFSNNIT-QGSTDRCRKA----QATVAFLYFSFFIFLTKLVLSV 142
           A A G R+   TN   L+ N  + + + DR R+A    QA +AF    F +FLT ++L  
Sbjct: 94  AKAQGERSCGNTNAQGLYYNPYSGEYTADRHRRACNASQAAIAFSGLCFVLFLTSVILLG 153

Query: 143 INV 145
           +NV
Sbjct: 154 VNV 156

>Kwal_23.4058 s23 complement(551392..552042) [651 bp, 216 aa] {ON}
           YDL218W - Hypothetical ORF [contig 255] FULL
          Length = 216

 Score = 30.8 bits (68), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 40/157 (25%), Positives = 68/157 (43%), Gaps = 36/157 (22%)

Query: 4   ILDNSLRLVNFAFLVIILGLTGSLIATQDEHSPRVNFAIFTAAFALVT------------ 51
           IL  S+R   F F +I LGLT  ++    +   R + A +  A ++++            
Sbjct: 27  ILLWSVRAGQFIFSIITLGLTSRVV----DFGYRDSAAAYGVAVSVISTLYLILIVAIPL 82

Query: 52  ---DSFYAVFANLFSAFAWPILLVTWDFLNFVFTFSAATALAVGIRTHSCTNESYLFSNN 108
              D   AVF +        ++++ W        F+A  ALA     H   + S   S  
Sbjct: 83  KLNDCVVAVFISEL------VMMILW--------FAAFVALAA---QHGGIDCSTYKSYY 125

Query: 109 ITQGSTDRCRKAQATVAFLYFSFFIFLTKLVLSVINV 145
           IT+  ++ CR A+A +A  +F+F ++    VL  +NV
Sbjct: 126 ITEDWSEPCRAAEAAIAMSFFAFLLYDFSSVLFWLNV 162

>YDL218W Chr4 (66493..67446) [954 bp, 317 aa] {ON} Putative protein
           of unknown function; YDL218W transcription is regulated
           by Azf1p and induced by starvation and aerobic
           conditions; expression also induced in cells treated
           with the mycotoxin patulin
          Length = 317

 Score = 30.8 bits (68), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 31/63 (49%), Gaps = 5/63 (7%)

Query: 88  ALAVGIRTHSCTNESYLF----SNNITQGSTDR-CRKAQATVAFLYFSFFIFLTKLVLSV 142
           A A G R+ S TN   L+    S   T  S  R C  +QA +AF    F +FL  ++L  
Sbjct: 94  AKAQGERSCSNTNADGLYYNPYSGQYTADSHRRACNSSQAAIAFSGLCFVLFLISVILLG 153

Query: 143 INV 145
           INV
Sbjct: 154 INV 156

>Suva_4.27 Chr4 (54848..55816) [969 bp, 322 aa] {ON} YDL218W (REAL)
          Length = 322

 Score = 30.8 bits (68), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 39/150 (26%), Positives = 63/150 (42%), Gaps = 18/150 (12%)

Query: 9   LRLVNFAFLVIILGLTGSLI-ATQDEHSPRVNFAIFTAAFALVTDSFYAVFANLFSAFAW 67
           LR   F   V+++ L    I A  D  + + NF + T   ++    FY +   +    A 
Sbjct: 12  LRFSQFVSSVLVMSLLAYAIHAYSDRGNKKTNFTLATGVISV----FYLIALGIL-CLAL 66

Query: 68  PILLVTW-----DFLNFVFTFSAATALAVGIRTHSC-----TNESY-LFSNNITQGSTDR 116
           P L+        + +  +   +A   LA     HSC     + E Y  +S   T  +  R
Sbjct: 67  PTLIYIGMYFCAELIMCMLWLAAFVVLAKAQGQHSCKSRNSSGEYYDPYSGQYTTTNHRR 126

Query: 117 -CRKAQATVAFLYFSFFIFLTKLVLSVINV 145
            C  +QA +AF    F +FLT +VL  +N+
Sbjct: 127 ACNSSQAAIAFAGLCFLLFLTSVVLLGVNI 156

>TDEL0H00180 Chr8 (19833..20606) [774 bp, 257 aa] {ON} 
          Length = 257

 Score = 29.3 bits (64), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 37/142 (26%), Positives = 63/142 (44%), Gaps = 23/142 (16%)

Query: 9   LRLVNFAFLVIILGLTGSLIATQD--EHSPRVNFAIFTAAFALVTDSFYAVFANLFSAFA 66
           +R++   F ++ L L      T D  E    V +A   + F+LV     A+F  L + F 
Sbjct: 27  IRVLQLLFTIVALALCAR---TSDFYEAPSEVAYATAVSVFSLVY--LLAIF--LGTLFG 79

Query: 67  WPILLV----TWDFLNFVFTFSAATALAVGIRTHSCTNESYLFSNNITQGSTDRCRKAQA 122
            P  +V      + +  +  F+A  A+AV      C+   Y +S+        RCR+A+A
Sbjct: 80  GPYFMVGPLLVSEIIMLIMWFAAFIAMAVFAGGAPCSF--YFYSS--------RCREAKA 129

Query: 123 TVAFLYFSFFIFLTKLVLSVIN 144
            +A   F+  ++   L L V+N
Sbjct: 130 AIAMCAFNMVLYAASLTLLVLN 151

>SAKL0F10076g Chr6 complement(773641..775002) [1362 bp, 453 aa] {ON}
           similar to uniprot|Q12516 Saccharomyces cerevisiae
           YDL133W
          Length = 453

 Score = 28.9 bits (63), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 11/29 (37%), Positives = 19/29 (65%)

Query: 117 CRKAQATVAFLYFSFFIFLTKLVLSVINV 145
           CRK +A  AFL+   F+++T   +S++ V
Sbjct: 415 CRKQRALAAFLFMVLFMWVTTFTISIVRV 443

>ZYRO0B07612g Chr2 (598538..600364) [1827 bp, 608 aa] {ON} highly
           similar to uniprot|P53241 Saccharomyces cerevisiae
           YGR065C VHT1 vitamin H transporter H -biotin symporter
          Length = 608

 Score = 28.9 bits (63), Expect = 8.6,   Method: Composition-based stats.
 Identities = 22/91 (24%), Positives = 39/91 (42%), Gaps = 4/91 (4%)

Query: 51  TDSFYAVFANLFSAFAWPILLVTWDFLNFVFTFSAATALAVGIRTHSCTNESYLFSNNIT 110
           +  +YA     FS  A P L   W F+N    F+        I  +S +  +Y +   + 
Sbjct: 475 STKWYAFLTTYFSVAASPSL---WSFINDFLRFNPQVKAVTWIAIYSISQSTYAWIPKLA 531

Query: 111 QGSTDRCR-KAQATVAFLYFSFFIFLTKLVL 140
             +TD  R K    V+ ++ + ++  T +VL
Sbjct: 532 WPTTDAPRFKRGYVVSIVFGTIYLLWTFVVL 562

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.331    0.139    0.411 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 13,207,123
Number of extensions: 454687
Number of successful extensions: 1443
Number of sequences better than 10.0: 55
Number of HSP's gapped: 1430
Number of HSP's successfully gapped: 56
Length of query: 170
Length of database: 53,481,399
Length adjustment: 102
Effective length of query: 68
Effective length of database: 41,785,467
Effective search space: 2841411756
Effective search space used: 2841411756
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.9 bits)
S2: 61 (28.1 bits)