Re-run this search with the SEG filter switched off

Re-run this search as BLASTP i.e. protein query (default)

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0F02728g3.494ON28228213840.0
KLTH0F14872g3.494ON28028212421e-174
Kwal_55.212403.494ON28328312201e-170
YGR132C (PHB1)3.494ON28728311931e-166
Smik_6.2283.494ON28728311891e-166
Suva_7.4203.494ON28728311881e-165
TPHA0D032903.494ON28528311801e-164
Skud_7.4433.494ON28728311791e-164
CAGL0I10472g3.494ON28827611751e-163
TDEL0D056203.494ON27928011691e-163
Kpol_1017.53.494ON28328411611e-161
NCAS0E007903.494ON32728111631e-161
ZYRO0D09900g3.494ON28328111571e-161
KNAG0B007903.494ON28428411431e-159
TBLA0D029503.494ON28228011261e-156
AFR313C3.494ON28328511241e-156
NDAI0G009203.494ON29628411251e-156
Ecym_12353.494ON28328311071e-153
KAFR0C019803.494ON28327511041e-153
KLLA0D16302g3.494ON2262149331e-127
KAFR0B042505.98ON3102417196e-94
TBLA0H022205.98ON3072317171e-93
SAKL0G15510g5.98ON3082317152e-93
Kwal_27.127475.98ON3072387082e-92
ADL141W5.98ON3072347082e-92
YGR231C (PHB2)5.98ON3102317057e-92
CAGL0L06490g5.98ON3132437041e-91
Smik_16.755.98ON3102317022e-91
KLTH0C01672g5.98ON3072346995e-91
Skud_7.5655.98ON3102316996e-91
Kpol_1050.615.98ON3102316988e-91
TPHA0A050905.98ON3102316988e-91
Suva_7.5235.98ON3102316971e-90
NCAS0F006005.98ON3132346962e-90
KNAG0A015805.98ON2882346932e-90
NDAI0D025305.98ON3162416953e-90
ZYRO0B15136g5.98ON3102316943e-90
KLLA0E15731g5.98ON3082536926e-90
TDEL0G012105.98ON3092416927e-90
Kwal_55.21241singletonOFF72511881e-17
Kwal_55.21243singletonOFF6154850.003
CAGL0D02596g3.4ON24933740.65
Kwal_33.133891.81ON69498740.92
SAKL0H25564g4.27ON297145730.95
CAGL0E03289g4.56ON69670731.2
KNAG0A074703.410ON18551701.6
KLTH0F18546g7.518ON277787721.8
KLTH0F16500g5.414ON838119712.2
KAFR0A086703.4ON21030692.4
Kwal_33.131861.46ON412162702.5
ADL346W3.369ON138550694.0
TBLA0H027402.586ON86093676.8
Kpol_2000.601.88ON103374676.9
KLLA0F02277gsingletonON29890667.0
Kwal_47.18394singletonOFF9884627.8
ZYRO0F03410g8.50ON842137668.9
TBLA0E048304.361ON109769669.2
BLASTX 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= SAKL0F02728g
         (849 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0F02728g Chr6 (231020..231868) [849 bp, 282 aa] {ON} highly ...   537   0.0  
KLTH0F14872g Chr6 complement(1218390..1219232) [843 bp, 280 aa] ...   483   e-174
Kwal_55.21240 s55 complement(745938..746789) [852 bp, 283 aa] {O...   474   e-170
YGR132C Chr7 complement(755589..756452) [864 bp, 287 aa] {ON}  P...   464   e-166
Smik_6.228 Chr6 complement(373467..374330) [864 bp, 287 aa] {ON}...   462   e-166
Suva_7.420 Chr7 complement(725738..726601) [864 bp, 287 aa] {ON}...   462   e-165
TPHA0D03290 Chr4 complement(676982..677839) [858 bp, 285 aa] {ON...   459   e-164
Skud_7.443 Chr7 complement(734799..735662) [864 bp, 287 aa] {ON}...   458   e-164
CAGL0I10472g Chr9 (1036324..1037190) [867 bp, 288 aa] {ON} highl...   457   e-163
TDEL0D05620 Chr4 complement(1012372..1013211) [840 bp, 279 aa] {...   454   e-163
Kpol_1017.5 s1017 (19813..20664) [852 bp, 283 aa] {ON} (19813..2...   451   e-161
NCAS0E00790 Chr5 (145987..146970) [984 bp, 327 aa] {ON} Anc_3.494     452   e-161
ZYRO0D09900g Chr4 (835139..835990) [852 bp, 283 aa] {ON} similar...   450   e-161
KNAG0B00790 Chr2 (146405..147259) [855 bp, 284 aa] {ON} Anc_3.49...   444   e-159
TBLA0D02950 Chr4 (720856..721704) [849 bp, 282 aa] {ON} Anc_3.49...   438   e-156
AFR313C Chr6 complement(1005181..1006032) [852 bp, 283 aa] {ON} ...   437   e-156
NDAI0G00920 Chr7 (192573..193463) [891 bp, 296 aa] {ON} Anc_3.494     437   e-156
Ecym_1235 Chr1 (483393..484244) [852 bp, 283 aa] {ON} similar to...   431   e-153
KAFR0C01980 Chr3 complement(394370..395221) [852 bp, 283 aa] {ON...   429   e-153
KLLA0D16302g Chr4 complement(1372447..1373127) [681 bp, 226 aa] ...   363   e-127
KAFR0B04250 Chr2 complement(882694..883626) [933 bp, 310 aa] {ON...   281   6e-94
TBLA0H02220 Chr8 (537650..538573) [924 bp, 307 aa] {ON} Anc_5.98...   280   1e-93
SAKL0G15510g Chr7 complement(1334598..1335524) [927 bp, 308 aa] ...   280   2e-93
Kwal_27.12747 s27 complement(1358872..1359795) [924 bp, 307 aa] ...   277   2e-92
ADL141W Chr4 (444592..445515) [924 bp, 307 aa] {ON} Syntenic hom...   277   2e-92
YGR231C Chr7 complement(952548..953480) [933 bp, 310 aa] {ON}  P...   276   7e-92
CAGL0L06490g Chr12 (735080..736021) [942 bp, 313 aa] {ON} highly...   275   1e-91
Smik_16.75 Chr16 (143216..144148) [933 bp, 310 aa] {ON} YGR231C ...   275   2e-91
KLTH0C01672g Chr3 (147893..148816) [924 bp, 307 aa] {ON} highly ...   273   5e-91
Skud_7.565 Chr7 complement(927426..928358) [933 bp, 310 aa] {ON}...   273   6e-91
Kpol_1050.61 s1050 complement(135758..136690) [933 bp, 310 aa] {...   273   8e-91
TPHA0A05090 Chr1 complement(1146837..1147769) [933 bp, 310 aa] {...   273   8e-91
Suva_7.523 Chr7 complement(907005..907937) [933 bp, 310 aa] {ON}...   273   1e-90
NCAS0F00600 Chr6 (117964..118905) [942 bp, 313 aa] {ON} Anc_5.98...   272   2e-90
KNAG0A01580 Chr1 (79208..80074) [867 bp, 288 aa] {ON} Anc_5.98 Y...   271   2e-90
NDAI0D02530 Chr4 complement(583429..584379) [951 bp, 316 aa] {ON...   272   3e-90
ZYRO0B15136g Chr2 (1233955..1234887) [933 bp, 310 aa] {ON} simil...   271   3e-90
KLLA0E15731g Chr5 (1407793..1408719) [927 bp, 308 aa] {ON} simil...   271   6e-90
TDEL0G01210 Chr7 (248098..249027) [930 bp, 309 aa] {ON} Anc_5.98...   271   7e-90
Kwal_55.21241 s55 (746122..746340) [219 bp, 72 aa] {OFF} [contig...    77   1e-17
Kwal_55.21243 s55 (746615..746800) [186 bp, 61 aa] {OFF} [contig...    37   0.003
CAGL0D02596g Chr4 complement(266641..267390) [750 bp, 249 aa] {O...    33   0.65 
Kwal_33.13389 s33 complement(197441..199525) [2085 bp, 694 aa] {...    33   0.92 
SAKL0H25564g Chr8 complement(2240089..2240982) [894 bp, 297 aa] ...    33   0.95 
CAGL0E03289g Chr5 (303072..305162) [2091 bp, 696 aa] {ON} some s...    33   1.2  
KNAG0A07470 Chr1 (1173486..1174043) [558 bp, 185 aa] {ON} Anc_3....    32   1.6  
KLTH0F18546g Chr6 (1498810..1507143) [8334 bp, 2777 aa] {ON} sim...    32   1.8  
KLTH0F16500g Chr6 complement(1337865..1340381) [2517 bp, 838 aa]...    32   2.2  
KAFR0A08670 Chr1 complement(1738832..1739464) [633 bp, 210 aa] {...    31   2.4  
Kwal_33.13186 s33 complement(111561..112799) [1239 bp, 412 aa] {...    32   2.5  
ADL346W Chr4 (96109..100266) [4158 bp, 1385 aa] {ON} Syntenic ho...    31   4.0  
TBLA0H02740 Chr8 complement(645864..648446) [2583 bp, 860 aa] {O...    30   6.8  
Kpol_2000.60 s2000 (119866..122967) [3102 bp, 1033 aa] {ON} (119...    30   6.9  
KLLA0F02277g Chr6 (203211..204107) [897 bp, 298 aa] {ON} no simi...    30   7.0  
Kwal_47.18394 s47 (808025..808321) [297 bp, 98 aa] {OFF} [contig...    28   7.8  
ZYRO0F03410g Chr6 (292952..295480) [2529 bp, 842 aa] {ON} some s...    30   8.9  
TBLA0E04830 Chr5 (1240546..1243839) [3294 bp, 1097 aa] {ON} Anc_...    30   9.2  

>SAKL0F02728g Chr6 (231020..231868) [849 bp, 282 aa] {ON} highly
           similar to uniprot|P40961 Saccharomyces cerevisiae
           YGR132C
          Length = 282

 Score =  537 bits (1384), Expect = 0.0
 Identities = 282/282 (100%), Positives = 282/282 (100%)
 Frame = +1

Query: 1   MSKLADSLARIALPIGIAFSALQYSMYDVKGGTRAVIFDRLSGVQQQVIGEGTHFLVPWL 180
           MSKLADSLARIALPIGIAFSALQYSMYDVKGGTRAVIFDRLSGVQQQVIGEGTHFLVPWL
Sbjct: 1   MSKLADSLARIALPIGIAFSALQYSMYDVKGGTRAVIFDRLSGVQQQVIGEGTHFLVPWL 60

Query: 181 QRAIVYDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPEVLQLPHIYQNLGLDYDERVLPS 360
           QRAIVYDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPEVLQLPHIYQNLGLDYDERVLPS
Sbjct: 61  QRAIVYDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPEVLQLPHIYQNLGLDYDERVLPS 120

Query: 361 IGNEVLKAIVAQFDAAELITQREIVSQRIRKELSLRAAEFNIRLEDVSITHMTFGREFTK 540
           IGNEVLKAIVAQFDAAELITQREIVSQRIRKELSLRAAEFNIRLEDVSITHMTFGREFTK
Sbjct: 121 IGNEVLKAIVAQFDAAELITQREIVSQRIRKELSLRAAEFNIRLEDVSITHMTFGREFTK 180

Query: 541 AVEQKQIAQQDAERAKFLVERAEQERQAAVIRAEGEAESADYISKALSKAGDGLLLIRRL 720
           AVEQKQIAQQDAERAKFLVERAEQERQAAVIRAEGEAESADYISKALSKAGDGLLLIRRL
Sbjct: 181 AVEQKQIAQQDAERAKFLVERAEQERQAAVIRAEGEAESADYISKALSKAGDGLLLIRRL 240

Query: 721 EASKEIAQTLANSSNVTYLPSNGAGGAEQQGSPNSLLLNLGR 846
           EASKEIAQTLANSSNVTYLPSNGAGGAEQQGSPNSLLLNLGR
Sbjct: 241 EASKEIAQTLANSSNVTYLPSNGAGGAEQQGSPNSLLLNLGR 282

>KLTH0F14872g Chr6 complement(1218390..1219232) [843 bp, 280 aa]
           {ON} highly similar to uniprot|P40961 Saccharomyces
           cerevisiae YGR132C
          Length = 280

 Score =  483 bits (1242), Expect = e-174
 Identities = 249/282 (88%), Positives = 274/282 (97%)
 Frame = +1

Query: 1   MSKLADSLARIALPIGIAFSALQYSMYDVKGGTRAVIFDRLSGVQQQVIGEGTHFLVPWL 180
           MS+LADSLA+IALP+G+A SALQYSMYDVKGG+RAVIFDRLSGVQQQV+GEGTHFLVPWL
Sbjct: 1   MSRLADSLAKIALPLGLAASALQYSMYDVKGGSRAVIFDRLSGVQQQVVGEGTHFLVPWL 60

Query: 181 QRAIVYDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPEVLQLPHIYQNLGLDYDERVLPS 360
           Q+A++YDVRTKPKNIATNTGTKDLQMVSLTLRVLHRP+V++LP IYQNLGLDYDERVLPS
Sbjct: 61  QKAVLYDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPDVMKLPTIYQNLGLDYDERVLPS 120

Query: 361 IGNEVLKAIVAQFDAAELITQREIVSQRIRKELSLRAAEFNIRLEDVSITHMTFGREFTK 540
           IGNEVLKAIVAQFDAAELITQRE VSQRIR+ELSLRA+EFNIRLEDVSITHMTFGREFTK
Sbjct: 121 IGNEVLKAIVAQFDAAELITQRETVSQRIRQELSLRASEFNIRLEDVSITHMTFGREFTK 180

Query: 541 AVEQKQIAQQDAERAKFLVERAEQERQAAVIRAEGEAESADYISKALSKAGDGLLLIRRL 720
           AVEQKQIAQQDAERA+++VE AEQERQA+VIRAEGEAESA+YISKAL+KAGDGLLLIRR+
Sbjct: 181 AVEQKQIAQQDAERARYVVELAEQERQASVIRAEGEAESAEYISKALAKAGDGLLLIRRI 240

Query: 721 EASKEIAQTLANSSNVTYLPSNGAGGAEQQGSPNSLLLNLGR 846
           EASKEIA+TLANSSNVTYLPS+ +  A +QGSPNSLLLNLGR
Sbjct: 241 EASKEIAKTLANSSNVTYLPSSHS--ASEQGSPNSLLLNLGR 280

>Kwal_55.21240 s55 complement(745938..746789) [852 bp, 283 aa] {ON}
           YGR132C (PHB1) - mitochondrial protein, prohibitin
           homolog; similar to S. cerevisiae Phb2p [contig 130]
           FULL
          Length = 283

 Score =  474 bits (1220), Expect = e-170
 Identities = 244/283 (86%), Positives = 270/283 (95%), Gaps = 1/283 (0%)
 Frame = +1

Query: 1   MSKLADSLARIALPIGIAFSALQYSMYDVKGGTRAVIFDRLSGVQQQVIGEGTHFLVPWL 180
           MS+ ADSLA+IALP+G+A SALQYSMYDVKGG+RAVIFDRLSGVQQQV+GEGTHFL+PWL
Sbjct: 1   MSRFADSLAKIALPLGLAASALQYSMYDVKGGSRAVIFDRLSGVQQQVVGEGTHFLIPWL 60

Query: 181 QRAIVYDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPEVLQLPHIYQNLGLDYDERVLPS 360
           Q+A+++DVRTKPKNIATNTGTKDLQMVSLTLRVLHRP+V++LP IYQNLGLDYDERVLPS
Sbjct: 61  QKAVLFDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPDVMKLPGIYQNLGLDYDERVLPS 120

Query: 361 IGNEVLKAIVAQFDAAELITQREIVSQRIRKELSLRAAEFNIRLEDVSITHMTFGREFTK 540
           IGNEVLK+IVAQFDAAELITQRE VSQRIR+ELSLRA+EFNIRLEDVSITHMTFGR+FTK
Sbjct: 121 IGNEVLKSIVAQFDAAELITQRETVSQRIRQELSLRASEFNIRLEDVSITHMTFGRDFTK 180

Query: 541 AVEQKQIAQQDAERAKFLVERAEQERQAAVIRAEGEAESADYISKALSKAGDGLLLIRRL 720
           AVEQKQIAQQDAERA+F+VE AEQERQA+VIRAEGEAESA+YISKAL+KAGDGLLLIRR+
Sbjct: 181 AVEQKQIAQQDAERARFVVELAEQERQASVIRAEGEAESAEYISKALAKAGDGLLLIRRI 240

Query: 721 EASKEIAQTLANSSNVTYLPSNGAGG-AEQQGSPNSLLLNLGR 846
           EASKEIA+TLANSSNVTYLPSN  G  +   GS NSLLLNLGR
Sbjct: 241 EASKEIAKTLANSSNVTYLPSNQQGAESNSGGSSNSLLLNLGR 283

>YGR132C Chr7 complement(755589..756452) [864 bp, 287 aa] {ON}
           PHB1Subunit of the prohibitin complex (Phb1p-Phb2p), a
           1.2 MDa ring-shaped inner mitochondrial membrane
           chaperone that stabilizes newly synthesized proteins;
           determinant of replicative life span; involved in
           mitochondrial segregation
          Length = 287

 Score =  464 bits (1193), Expect = e-166
 Identities = 237/283 (83%), Positives = 263/283 (92%), Gaps = 2/283 (0%)
 Frame = +1

Query: 4   SKLADSLARIALPIGIAFSALQYSMYDVKGGTRAVIFDRLSGVQQQVIGEGTHFLVPWLQ 183
           +KL D + ++ALPIGI  S +QYSMYDVKGG+R VIFDR++GV+QQV+GEGTHFLVPWLQ
Sbjct: 5   AKLIDVITKVALPIGIIASGIQYSMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWLQ 64

Query: 184 RAIVYDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPEVLQLPHIYQNLGLDYDERVLPSI 363
           +AI+YDVRTKPK+IATNTGTKDLQMVSLTLRVLHRPEVLQLP IYQNLGLDYDERVLPSI
Sbjct: 65  KAIIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPEVLQLPAIYQNLGLDYDERVLPSI 124

Query: 364 GNEVLKAIVAQFDAAELITQREIVSQRIRKELSLRAAEFNIRLEDVSITHMTFGREFTKA 543
           GNEVLK+IVAQFDAAELITQREI+SQ+IRKELS RA EF I+LEDVSITHMTFG EFTKA
Sbjct: 125 GNEVLKSIVAQFDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTKA 184

Query: 544 VEQKQIAQQDAERAKFLVERAEQERQAAVIRAEGEAESADYISKALSKAGDGLLLIRRLE 723
           VEQKQIAQQDAERAKFLVE+AEQERQA+VIRAEGEAESA++ISKAL+K GDGLLLIRRLE
Sbjct: 185 VEQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRLE 244

Query: 724 ASKEIAQTLANSSNVTYLPS--NGAGGAEQQGSPNSLLLNLGR 846
           ASK+IAQTLANSSNV YLPS  +G G +E  GSPNSLLLN+GR
Sbjct: 245 ASKDIAQTLANSSNVVYLPSQHSGGGNSESSGSPNSLLLNIGR 287

>Smik_6.228 Chr6 complement(373467..374330) [864 bp, 287 aa] {ON}
           YGR132C (REAL)
          Length = 287

 Score =  462 bits (1189), Expect = e-166
 Identities = 236/283 (83%), Positives = 263/283 (92%), Gaps = 2/283 (0%)
 Frame = +1

Query: 4   SKLADSLARIALPIGIAFSALQYSMYDVKGGTRAVIFDRLSGVQQQVIGEGTHFLVPWLQ 183
           S+L D + ++ALPIGI  S +QYSMYDVKGG+R VIFDR++GV+QQV+GEGTHFLVPWLQ
Sbjct: 5   SRLIDIITKVALPIGIVASGIQYSMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWLQ 64

Query: 184 RAIVYDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPEVLQLPHIYQNLGLDYDERVLPSI 363
           +AI+YDVRTKPK+IATNTGT+DLQMVSLTLRVLHRPEVLQLP IYQNLGLDYDERVLPSI
Sbjct: 65  KAIIYDVRTKPKSIATNTGTRDLQMVSLTLRVLHRPEVLQLPAIYQNLGLDYDERVLPSI 124

Query: 364 GNEVLKAIVAQFDAAELITQREIVSQRIRKELSLRAAEFNIRLEDVSITHMTFGREFTKA 543
           GNEVLK+IVAQFDAAELITQREI+SQ+IRKELS RA EF I+LEDVSITHMTFG EFTKA
Sbjct: 125 GNEVLKSIVAQFDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTKA 184

Query: 544 VEQKQIAQQDAERAKFLVERAEQERQAAVIRAEGEAESADYISKALSKAGDGLLLIRRLE 723
           VEQKQIAQQDAERAKFLVE+AEQERQA+VIRAEGEAESA++ISKAL+K GDGLLLIRRLE
Sbjct: 185 VEQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRLE 244

Query: 724 ASKEIAQTLANSSNVTYLPS--NGAGGAEQQGSPNSLLLNLGR 846
           ASK+IAQTLANSSNV YLPS  +G G +E  GSPNSLLLN+GR
Sbjct: 245 ASKDIAQTLANSSNVVYLPSQHSGNGNSESSGSPNSLLLNIGR 287

>Suva_7.420 Chr7 complement(725738..726601) [864 bp, 287 aa] {ON}
           YGR132C (REAL)
          Length = 287

 Score =  462 bits (1188), Expect = e-165
 Identities = 235/283 (83%), Positives = 262/283 (92%), Gaps = 2/283 (0%)
 Frame = +1

Query: 4   SKLADSLARIALPIGIAFSALQYSMYDVKGGTRAVIFDRLSGVQQQVIGEGTHFLVPWLQ 183
           S+  D + ++ALPIG+  S LQYSMYDVKGG+R VIFDR++GV+QQV+GEGTHFLVPWLQ
Sbjct: 5   SRFIDIITKVALPIGLVASGLQYSMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWLQ 64

Query: 184 RAIVYDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPEVLQLPHIYQNLGLDYDERVLPSI 363
           +AI+YDVRTKPK+IATNTGT+DLQMVSLTLRVLHRPEVLQLP IYQNLGLDYDERVLPSI
Sbjct: 65  KAIIYDVRTKPKSIATNTGTRDLQMVSLTLRVLHRPEVLQLPSIYQNLGLDYDERVLPSI 124

Query: 364 GNEVLKAIVAQFDAAELITQREIVSQRIRKELSLRAAEFNIRLEDVSITHMTFGREFTKA 543
           GNEVLK+IVAQFDAAELITQREI+SQ+IRKELS RA EF I+LEDVSITHMTFG EFTKA
Sbjct: 125 GNEVLKSIVAQFDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTKA 184

Query: 544 VEQKQIAQQDAERAKFLVERAEQERQAAVIRAEGEAESADYISKALSKAGDGLLLIRRLE 723
           VEQKQIAQQDAERAKF+VE+AEQERQA+VIRAEGEAESA+YISKAL+K GDGLLLIRRLE
Sbjct: 185 VEQKQIAQQDAERAKFIVEKAEQERQASVIRAEGEAESAEYISKALAKVGDGLLLIRRLE 244

Query: 724 ASKEIAQTLANSSNVTYLPSN--GAGGAEQQGSPNSLLLNLGR 846
           ASK+IAQTLANSSNV YLPS   G+G +E  GSPNSLLLN+GR
Sbjct: 245 ASKDIAQTLANSSNVIYLPSQHAGSGNSEYSGSPNSLLLNIGR 287

>TPHA0D03290 Chr4 complement(676982..677839) [858 bp, 285 aa] {ON}
           Anc_3.494 YGR132C
          Length = 285

 Score =  459 bits (1180), Expect = e-164
 Identities = 238/283 (84%), Positives = 263/283 (92%), Gaps = 2/283 (0%)
 Frame = +1

Query: 4   SKLADSLARIALPIGIAFSALQYSMYDVKGGTRAVIFDRLSGVQQQVIGEGTHFLVPWLQ 183
           +K+ D L +IA+P+GIA S +QY+MYDVKGG+RAVIFDRLSGV+QQVIGEGTHFL PWLQ
Sbjct: 3   TKVLDRLIKIAVPLGIAVSGIQYAMYDVKGGSRAVIFDRLSGVKQQVIGEGTHFLFPWLQ 62

Query: 184 RAIVYDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPEVLQLPHIYQNLGLDYDERVLPSI 363
           +AIV+DVRTKPK+IATNTGTKDLQMVSLTLRVLHRP+V QLP IYQNLGLDYDERVLPSI
Sbjct: 63  KAIVFDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPDVQQLPTIYQNLGLDYDERVLPSI 122

Query: 364 GNEVLKAIVAQFDAAELITQREIVSQRIRKELSLRAAEFNIRLEDVSITHMTFGREFTKA 543
           GNEVLKAIVAQFDAAELITQREIVS +IR+ELS+R+ EF I+LEDVSITHMTFG+EFTKA
Sbjct: 123 GNEVLKAIVAQFDAAELITQREIVSNKIREELSIRSNEFGIKLEDVSITHMTFGQEFTKA 182

Query: 544 VEQKQIAQQDAERAKFLVERAEQERQAAVIRAEGEAESADYISKALSKAGDGLLLIRRLE 723
           VEQKQIAQQDAERAKFLVERAEQERQAAVIRAEGEAESA+YISKAL+KAGDGLLLIRRLE
Sbjct: 183 VEQKQIAQQDAERAKFLVERAEQERQAAVIRAEGEAESAEYISKALAKAGDGLLLIRRLE 242

Query: 724 ASKEIAQTLANSSNVTYLPSNGA--GGAEQQGSPNSLLLNLGR 846
           ASKEIA+TL+ SSNVTYLPS  +  G  E  G+PNSLLLNLGR
Sbjct: 243 ASKEIAKTLSQSSNVTYLPSGSSSNGNNESAGTPNSLLLNLGR 285

>Skud_7.443 Chr7 complement(734799..735662) [864 bp, 287 aa] {ON}
           YGR132C (REAL)
          Length = 287

 Score =  458 bits (1179), Expect = e-164
 Identities = 233/283 (82%), Positives = 262/283 (92%), Gaps = 2/283 (0%)
 Frame = +1

Query: 4   SKLADSLARIALPIGIAFSALQYSMYDVKGGTRAVIFDRLSGVQQQVIGEGTHFLVPWLQ 183
           S+L D + ++ALPIGI  + +QY+MYDVKGG+R VIFDR++GV+QQV+GEGTHFLVPWLQ
Sbjct: 5   SRLIDVITKVALPIGIIATGIQYTMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWLQ 64

Query: 184 RAIVYDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPEVLQLPHIYQNLGLDYDERVLPSI 363
           +AI+YDVRTKPK+IATNTGT+DLQMVSLTLRVLHRPEVLQLP IYQNLGLDYDERVLPSI
Sbjct: 65  KAIIYDVRTKPKSIATNTGTRDLQMVSLTLRVLHRPEVLQLPSIYQNLGLDYDERVLPSI 124

Query: 364 GNEVLKAIVAQFDAAELITQREIVSQRIRKELSLRAAEFNIRLEDVSITHMTFGREFTKA 543
           GNEVLK+IVAQFDAAELITQREI+SQ+IRKELS RA EF I+LEDVSITHMTFG EFTKA
Sbjct: 125 GNEVLKSIVAQFDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTKA 184

Query: 544 VEQKQIAQQDAERAKFLVERAEQERQAAVIRAEGEAESADYISKALSKAGDGLLLIRRLE 723
           VEQKQIAQQDAERAKFLVE+AEQERQA+VIRAEGEAESA++ISKAL+K GDGLLLIRRLE
Sbjct: 185 VEQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRLE 244

Query: 724 ASKEIAQTLANSSNVTYLPS--NGAGGAEQQGSPNSLLLNLGR 846
           ASK+IAQTLANSSNV YLPS  +G G  +  GSPNSLLLN+GR
Sbjct: 245 ASKDIAQTLANSSNVVYLPSQHSGNGSGDSSGSPNSLLLNIGR 287

>CAGL0I10472g Chr9 (1036324..1037190) [867 bp, 288 aa] {ON} highly
           similar to uniprot|P40961 Saccharomyces cerevisiae
           YGR132c prohibitin antiproliferative protein
          Length = 288

 Score =  457 bits (1175), Expect = e-163
 Identities = 233/276 (84%), Positives = 259/276 (93%), Gaps = 1/276 (0%)
 Frame = +1

Query: 22  LARIALPIGIAFSALQYSMYDVKGGTRAVIFDRLSGVQQQVIGEGTHFLVPWLQRAIVYD 201
           + ++A+P+GIA S LQYSMYDV+GG+R VIFDRL GV+  V+GEGTHFLVPWLQ+AI+YD
Sbjct: 12  ITKVAIPVGIAVSGLQYSMYDVQGGSRGVIFDRLQGVKSDVVGEGTHFLVPWLQKAIIYD 71

Query: 202 VRTKPKNIATNTGTKDLQMVSLTLRVLHRPEVLQLPHIYQNLGLDYDERVLPSIGNEVLK 381
           VRTKPK+IATNTGTKDLQMVSLTLRVLHRP+V+QLP IYQNLGLDYDERVLPSIGNEVLK
Sbjct: 72  VRTKPKSIATNTGTKDLQMVSLTLRVLHRPDVMQLPLIYQNLGLDYDERVLPSIGNEVLK 131

Query: 382 AIVAQFDAAELITQREIVSQRIRKELSLRAAEFNIRLEDVSITHMTFGREFTKAVEQKQI 561
           +IVAQFDAAELITQREIVSQ+IR+ELS RA EF IRLEDVSITHMTFG EFTKAVEQKQI
Sbjct: 132 SIVAQFDAAELITQREIVSQKIRQELSNRANEFGIRLEDVSITHMTFGPEFTKAVEQKQI 191

Query: 562 AQQDAERAKFLVERAEQERQAAVIRAEGEAESADYISKALSKAGDGLLLIRRLEASKEIA 741
           AQQDAERA+FLVE+AEQERQA+VIRAEGEAESA+YISKALSK GDGLLLIRRLEASKEIA
Sbjct: 192 AQQDAERARFLVEKAEQERQASVIRAEGEAESAEYISKALSKVGDGLLLIRRLEASKEIA 251

Query: 742 QTLANSSNVTYLPSNGAGG-AEQQGSPNSLLLNLGR 846
           QTLANS+N+TYLPSN AGG  + +GSPN+LLLNLGR
Sbjct: 252 QTLANSNNITYLPSNHAGGDKDDKGSPNTLLLNLGR 287

>TDEL0D05620 Chr4 complement(1012372..1013211) [840 bp, 279 aa] {ON}
           Anc_3.494 YGR132C
          Length = 279

 Score =  454 bits (1169), Expect = e-163
 Identities = 234/280 (83%), Positives = 259/280 (92%)
 Frame = +1

Query: 1   MSKLADSLARIALPIGIAFSALQYSMYDVKGGTRAVIFDRLSGVQQQVIGEGTHFLVPWL 180
           MS+L ++LAR+A+P+GI  S +QYSMYDV+GG+RAVIFDRLSGVQ+QV+GEGTHFLVPWL
Sbjct: 1   MSRLVENLARVAIPLGIVVSGVQYSMYDVRGGSRAVIFDRLSGVQKQVVGEGTHFLVPWL 60

Query: 181 QRAIVYDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPEVLQLPHIYQNLGLDYDERVLPS 360
           Q+AIVYD+RTKPK IATNTGTKD+QMVSLTLRVLHRP+VLQLP IYQNLGLDYDERVLPS
Sbjct: 61  QKAIVYDIRTKPKGIATNTGTKDMQMVSLTLRVLHRPDVLQLPRIYQNLGLDYDERVLPS 120

Query: 361 IGNEVLKAIVAQFDAAELITQREIVSQRIRKELSLRAAEFNIRLEDVSITHMTFGREFTK 540
           IGNEVLKAIVAQFDAAELITQRE+VSQRIR ELS RA+EF IRLEDVSITHMTFG EFTK
Sbjct: 121 IGNEVLKAIVAQFDAAELITQRELVSQRIRDELSHRASEFGIRLEDVSITHMTFGPEFTK 180

Query: 541 AVEQKQIAQQDAERAKFLVERAEQERQAAVIRAEGEAESADYISKALSKAGDGLLLIRRL 720
           AVEQKQIAQQDAERAKFLVE+AEQ R+A+VIRAEGEAESA+YISKAL++AGDGLLLIRRL
Sbjct: 181 AVEQKQIAQQDAERAKFLVEKAEQVRKASVIRAEGEAESAEYISKALARAGDGLLLIRRL 240

Query: 721 EASKEIAQTLANSSNVTYLPSNGAGGAEQQGSPNSLLLNL 840
           EASKEIAQTLA SSN+TYLP    G  E  GS NSLLLN+
Sbjct: 241 EASKEIAQTLAASSNITYLPGKAHGNTE--GSQNSLLLNI 278

>Kpol_1017.5 s1017 (19813..20664) [852 bp, 283 aa] {ON}
           (19813..20664) [852 nt, 284 aa]
          Length = 283

 Score =  451 bits (1161), Expect = e-161
 Identities = 234/284 (82%), Positives = 258/284 (90%), Gaps = 2/284 (0%)
 Frame = +1

Query: 1   MSKLADSLARIALPIGIAFSALQYSMYDVKGGTRAVIFDRLSGVQQQVIGEGTHFLVPWL 180
           MSK+ D++A++ALPIGI  S +Q+SMYDVKGG+RAVIFDR+SGV+Q +IGEGTHFL+PWL
Sbjct: 1   MSKIIDTVAKVALPIGIVVSGIQFSMYDVKGGSRAVIFDRISGVKQNIIGEGTHFLIPWL 60

Query: 181 QRAIVYDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPEVLQLPHIYQNLGLDYDERVLPS 360
           Q+AI+YDVRTKPK+IATNTGTKDLQMVSLTLRVLHRP+V+QLP IYQNLGLDYDERVLPS
Sbjct: 61  QKAIIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPDVVQLPTIYQNLGLDYDERVLPS 120

Query: 361 IGNEVLKAIVAQFDAAELITQREIVSQRIRKELSLRAAEFNIRLEDVSITHMTFGREFTK 540
           I NEVLKAIVAQFDAAELITQRE+VS RIR EL  R+ EF IRLEDVSITHMTFG EFTK
Sbjct: 121 ISNEVLKAIVAQFDAAELITQREVVSDRIRAELGRRSNEFGIRLEDVSITHMTFGNEFTK 180

Query: 541 AVEQKQIAQQDAERAKFLVERAEQERQAAVIRAEGEAESADYISKALSKAGDGLLLIRRL 720
           AVE KQIAQQDAERAKFLVE+AEQERQAAVIRAEGEAESA+YISKAL KAGDGLLLIRRL
Sbjct: 181 AVELKQIAQQDAERAKFLVEKAEQERQAAVIRAEGEAESAEYISKALDKAGDGLLLIRRL 240

Query: 721 EASKEIAQTLANSSNVTYLPSNGAGGAE--QQGSPNSLLLNLGR 846
           EASKEIA TL+ SSNVTYLP NG G A     G+PN+LLLNLGR
Sbjct: 241 EASKEIAATLSQSSNVTYLP-NGHGNARGGSDGTPNTLLLNLGR 283

>NCAS0E00790 Chr5 (145987..146970) [984 bp, 327 aa] {ON} Anc_3.494
          Length = 327

 Score =  452 bits (1163), Expect = e-161
 Identities = 229/281 (81%), Positives = 255/281 (90%)
 Frame = +1

Query: 4   SKLADSLARIALPIGIAFSALQYSMYDVKGGTRAVIFDRLSGVQQQVIGEGTHFLVPWLQ 183
           +KL + + R+ALP+GI  + L+YSMYDVKGG+R VIFDRLSGVQ++VIGEGTHFLVPWLQ
Sbjct: 47  TKLLNVITRVALPLGILATGLEYSMYDVKGGSRGVIFDRLSGVQKRVIGEGTHFLVPWLQ 106

Query: 184 RAIVYDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPEVLQLPHIYQNLGLDYDERVLPSI 363
           +A++YDVRTKPK+IATNTGTKDLQMVSLTLRVLHRP + +LP IYQNLGLDYDE+VLPSI
Sbjct: 107 KAVIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPNIRELPKIYQNLGLDYDEKVLPSI 166

Query: 364 GNEVLKAIVAQFDAAELITQREIVSQRIRKELSLRAAEFNIRLEDVSITHMTFGREFTKA 543
           GNEVLK+IVAQFDAAELITQREIVSQRI+ ELS RA EF IRLEDVSITHMTFG EFTKA
Sbjct: 167 GNEVLKSIVAQFDAAELITQREIVSQRIKSELSTRADEFGIRLEDVSITHMTFGPEFTKA 226

Query: 544 VEQKQIAQQDAERAKFLVERAEQERQAAVIRAEGEAESADYISKALSKAGDGLLLIRRLE 723
           VEQKQIAQQDAERAKFLVE+AEQERQA+VIRAEGEAESA+YISKAL+K GDGLLLIRRLE
Sbjct: 227 VEQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEYISKALAKVGDGLLLIRRLE 286

Query: 724 ASKEIAQTLANSSNVTYLPSNGAGGAEQQGSPNSLLLNLGR 846
           ASK+IAQTLANS N+TYLP    G     GSPNSLLLN+GR
Sbjct: 287 ASKDIAQTLANSPNITYLPGQQGGRGNDSGSPNSLLLNIGR 327

>ZYRO0D09900g Chr4 (835139..835990) [852 bp, 283 aa] {ON} similar to
           uniprot|P40961 Saccharomyces cerevisiae YGR132C
          Length = 283

 Score =  450 bits (1157), Expect = e-161
 Identities = 229/281 (81%), Positives = 263/281 (93%)
 Frame = +1

Query: 4   SKLADSLARIALPIGIAFSALQYSMYDVKGGTRAVIFDRLSGVQQQVIGEGTHFLVPWLQ 183
           S+LA+++A++A+P+GI  S +QYSMYDV+GG+RAVIFDRLSGVQQ+V+GEGTHFLVPWLQ
Sbjct: 3   SRLAETVAKVAIPLGIVASGIQYSMYDVRGGSRAVIFDRLSGVQQEVVGEGTHFLVPWLQ 62

Query: 184 RAIVYDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPEVLQLPHIYQNLGLDYDERVLPSI 363
           +A++YDVRTKPK+IATNTGTKD+QMVSLTLRVLHRP+VLQLPHIYQNLGLDYDERVLPSI
Sbjct: 63  KAVIYDVRTKPKSIATNTGTKDMQMVSLTLRVLHRPQVLQLPHIYQNLGLDYDERVLPSI 122

Query: 364 GNEVLKAIVAQFDAAELITQREIVSQRIRKELSLRAAEFNIRLEDVSITHMTFGREFTKA 543
           GNEVLKAIVA++DAAELITQRE+VS  IR ELS RA+EF+IRLEDVSITHMTFG EFTKA
Sbjct: 123 GNEVLKAIVARYDAAELITQRELVSNTIRDELSNRASEFSIRLEDVSITHMTFGPEFTKA 182

Query: 544 VEQKQIAQQDAERAKFLVERAEQERQAAVIRAEGEAESADYISKALSKAGDGLLLIRRLE 723
           VE KQIAQQDAERAKFLVE+AEQ R+ +VIRAEGEAE+A+ ISKAL+KAGDGLLLIRRLE
Sbjct: 183 VELKQIAQQDAERAKFLVEKAEQIRKVSVIRAEGEAEAAESISKALAKAGDGLLLIRRLE 242

Query: 724 ASKEIAQTLANSSNVTYLPSNGAGGAEQQGSPNSLLLNLGR 846
           ASK+IAQTLANSSNVTYLPS  +GG  Q+G+  SLLLNLGR
Sbjct: 243 ASKDIAQTLANSSNVTYLPSQQSGGG-QEGTSQSLLLNLGR 282

>KNAG0B00790 Chr2 (146405..147259) [855 bp, 284 aa] {ON} Anc_3.494
           YGR132C
          Length = 284

 Score =  444 bits (1143), Expect = e-159
 Identities = 228/284 (80%), Positives = 258/284 (90%), Gaps = 2/284 (0%)
 Frame = +1

Query: 1   MSKLADSLARIALPIGIAFSALQYSMYDVKGGTRAVIFDRLSGVQQQVIGEGTHFLVPWL 180
           MSK  + L+++A+P G+   A  Y+MYDVKGG+R VIFDR+SGVQQ+V+GEGTHFLVPWL
Sbjct: 1   MSKAINVLSKMAIPAGLLIMAADYAMYDVKGGSRGVIFDRVSGVQQRVVGEGTHFLVPWL 60

Query: 181 QRAIVYDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPEVLQLPHIYQNLGLDYDERVLPS 360
           Q+AI+YDVR+KPK+IATNTGTKDLQMVSLTLRVLHRPEV++LP IYQ+LGLDYDERVLPS
Sbjct: 61  QKAIIYDVRSKPKSIATNTGTKDLQMVSLTLRVLHRPEVMELPRIYQSLGLDYDERVLPS 120

Query: 361 IGNEVLKAIVAQFDAAELITQREIVSQRIRKELSLRAAEFNIRLEDVSITHMTFGREFTK 540
           IGNEVLK+IVAQFDAAELITQRE+VSQRIR+ELS RA EF IRLEDVSITHMTFG EFTK
Sbjct: 121 IGNEVLKSIVAQFDAAELITQREVVSQRIRRELSTRAGEFGIRLEDVSITHMTFGAEFTK 180

Query: 541 AVEQKQIAQQDAERAKFLVERAEQERQAAVIRAEGEAESADYISKALSKAGDGLLLIRRL 720
           AVEQKQIAQQDAERAKFLVE+AEQ RQA+VIRAEGEAESA+ ISKAL+K GDGLLLIRRL
Sbjct: 181 AVEQKQIAQQDAERAKFLVEKAEQMRQASVIRAEGEAESAEAISKALAKVGDGLLLIRRL 240

Query: 721 EASKEIAQTLANSSNVTYLPSNGAGG--AEQQGSPNSLLLNLGR 846
           EASKEIA+TL+ SSNVTYLPS GAGG    + GS N+LLLN+GR
Sbjct: 241 EASKEIARTLSRSSNVTYLPSAGAGGKHGREDGSGNTLLLNIGR 284

>TBLA0D02950 Chr4 (720856..721704) [849 bp, 282 aa] {ON} Anc_3.494
           YGR132C
          Length = 282

 Score =  438 bits (1126), Expect = e-156
 Identities = 222/280 (79%), Positives = 253/280 (90%)
 Frame = +1

Query: 7   KLADSLARIALPIGIAFSALQYSMYDVKGGTRAVIFDRLSGVQQQVIGEGTHFLVPWLQR 186
           K+A+ LA+IA+P+G+  S + YSMYDVKGG+RAVIFDR+ GV+Q V+GEGTHFLVPWLQ+
Sbjct: 5   KIAEKLAKIAIPLGVCVSFMDYSMYDVKGGSRAVIFDRIQGVKQAVVGEGTHFLVPWLQK 64

Query: 187 AIVYDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPEVLQLPHIYQNLGLDYDERVLPSIG 366
           ++++D+RTKPKNI TNTGT+DLQMVSLTLR+LHRP+++QLP IYQNLGLDYDERVLPSIG
Sbjct: 65  SVIFDIRTKPKNITTNTGTRDLQMVSLTLRLLHRPDIVQLPMIYQNLGLDYDERVLPSIG 124

Query: 367 NEVLKAIVAQFDAAELITQREIVSQRIRKELSLRAAEFNIRLEDVSITHMTFGREFTKAV 546
           NEVLK+IVAQFDAAELITQREIVSQRIRKEL+ RA EF IRLEDVSITHMTFG EFTKAV
Sbjct: 125 NEVLKSIVAQFDAAELITQREIVSQRIRKELNHRANEFGIRLEDVSITHMTFGPEFTKAV 184

Query: 547 EQKQIAQQDAERAKFLVERAEQERQAAVIRAEGEAESADYISKALSKAGDGLLLIRRLEA 726
           EQKQIAQQDAERAKFLVE+AEQERQA+VIRAEGEAESA+ IS+AL KAGDGLLLIRRLE 
Sbjct: 185 EQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEVISRALQKAGDGLLLIRRLET 244

Query: 727 SKEIAQTLANSSNVTYLPSNGAGGAEQQGSPNSLLLNLGR 846
           SKEIA+TLA S +VTYLP  G G   +  S NSLLLNLGR
Sbjct: 245 SKEIAETLAGSPHVTYLP--GGGNQAEDASKNSLLLNLGR 282

>AFR313C Chr6 complement(1005181..1006032) [852 bp, 283 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR132C
           (PHB1)
          Length = 283

 Score =  437 bits (1124), Expect = e-156
 Identities = 224/285 (78%), Positives = 260/285 (91%), Gaps = 3/285 (1%)
 Frame = +1

Query: 1   MSKLADSLARIALP---IGIAFSALQYSMYDVKGGTRAVIFDRLSGVQQQVIGEGTHFLV 171
           MS+LADSL R+ LP   I +AFSA+Q+SMYDV+GGTRA+IFDR+SGV+  V+GEGTHFL+
Sbjct: 1   MSRLADSLVRLTLPLTPIALAFSAVQFSMYDVRGGTRAIIFDRISGVKPDVVGEGTHFLI 60

Query: 172 PWLQRAIVYDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPEVLQLPHIYQNLGLDYDERV 351
           PWLQ+AI++DVRTKP+NIATNTGTKDLQMVSLTLRVLHRP+V+ L  IY+ LG DYDERV
Sbjct: 61  PWLQKAIIFDVRTKPRNIATNTGTKDLQMVSLTLRVLHRPDVMALSRIYRELGPDYDERV 120

Query: 352 LPSIGNEVLKAIVAQFDAAELITQREIVSQRIRKELSLRAAEFNIRLEDVSITHMTFGRE 531
           LPSIGNEVLKAIVAQF+A+ELITQRE+VSQ+IR EL+ RA+EFNIRLEDVSITHMTFG+E
Sbjct: 121 LPSIGNEVLKAIVAQFNASELITQRELVSQQIRNELARRASEFNIRLEDVSITHMTFGQE 180

Query: 532 FTKAVEQKQIAQQDAERAKFLVERAEQERQAAVIRAEGEAESADYISKALSKAGDGLLLI 711
           FTKAVEQKQIAQQ+++RAKF+VERAEQER+AAVIRAEGEAE+A++ISKAL KAGDGLL+I
Sbjct: 181 FTKAVEQKQIAQQESDRAKFVVERAEQERRAAVIRAEGEAEAAEHISKALQKAGDGLLMI 240

Query: 712 RRLEASKEIAQTLANSSNVTYLPSNGAGGAEQQGSPNSLLLNLGR 846
           RRLEASK IA+TLANS NVTYLPS G   A   G+PNSLLLNLGR
Sbjct: 241 RRLEASKGIAETLANSPNVTYLPSKGQ--AADSGAPNSLLLNLGR 283

>NDAI0G00920 Chr7 (192573..193463) [891 bp, 296 aa] {ON} Anc_3.494
          Length = 296

 Score =  437 bits (1125), Expect = e-156
 Identities = 225/284 (79%), Positives = 253/284 (89%), Gaps = 4/284 (1%)
 Frame = +1

Query: 7   KLADSLARIALPIGIAFSALQYSMYDVKGGTRAVIFDRLSGVQQQVIGEGTHFLVPWLQR 186
           K  + L ++ALPIG+  + + YSMYDVKGG+R VIFDRLSGV+  V+GEGTHFLVPWLQ+
Sbjct: 13  KFFNLLTKVALPIGLLVTGVDYSMYDVKGGSRGVIFDRLSGVKSTVVGEGTHFLVPWLQK 72

Query: 187 AIVYDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPEVLQLPHIYQNLGLDYDERVLPSIG 366
           A++YDVRTKPK+IATNTGTKDLQMVSLTLRVLHRP V +LP IYQNLGLDYDE+VLPSIG
Sbjct: 73  AVIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPNVNELPKIYQNLGLDYDEKVLPSIG 132

Query: 367 NEVLKAIVAQFDAAELITQREIVSQRIRKELSLRAAEFNIRLEDVSITHMTFGREFTKAV 546
           NEVLK+IVAQFDAAELITQREIVSQRI+ ELS+RA EF +RLEDVSITHMTFG EFTKAV
Sbjct: 133 NEVLKSIVAQFDAAELITQREIVSQRIKSELSMRANEFGLRLEDVSITHMTFGPEFTKAV 192

Query: 547 EQKQIAQQDAERAKFLVERAEQERQAAVIRAEGEAESADYISKALSKAGDGLLLIRRLEA 726
           EQKQIAQQDAERAKFLVE+AEQERQA+VIRAEGEAESA++ISKAL+K GDGLLLIRRLEA
Sbjct: 193 EQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRLEA 252

Query: 727 SKEIAQTLANSSNVTYLPS----NGAGGAEQQGSPNSLLLNLGR 846
           SK+IAQTLANS NVTYLP     +G+G      SPNSLLLN+GR
Sbjct: 253 SKDIAQTLANSPNVTYLPGQNRHSGSGTDGGNSSPNSLLLNIGR 296

>Ecym_1235 Chr1 (483393..484244) [852 bp, 283 aa] {ON} similar to
           Ashbya gossypii AFR313C
          Length = 283

 Score =  431 bits (1107), Expect = e-153
 Identities = 216/283 (76%), Positives = 258/283 (91%), Gaps = 1/283 (0%)
 Frame = +1

Query: 1   MSKLADSLARIALPIGIAFSALQYSMYDVKGGTRAVIFDRLSGVQQQVIGEGTHFLVPWL 180
           MS+  +++A IA+PIG+A  A Q  +YDV+GGTRAVIFDRLSGVQQ+V+GEGTHFL+PWL
Sbjct: 1   MSRFLENIANIAVPIGVAIFAAQSCIYDVRGGTRAVIFDRLSGVQQKVVGEGTHFLIPWL 60

Query: 181 QRAIVYDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPEVLQLPHIYQNLGLDYDERVLPS 360
           Q+A++YDVRTKPKNIATNTGTKDLQ+V+LTLRVLHRP+V+ LP IYQ LGLDYDERVLPS
Sbjct: 61  QKAVIYDVRTKPKNIATNTGTKDLQIVTLTLRVLHRPDVIALPKIYQELGLDYDERVLPS 120

Query: 361 IGNEVLKAIVAQFDAAELITQREIVSQRIRKELSLRAAEFNIRLEDVSITHMTFGREFTK 540
           IGNEVLKAIVAQFDAAELITQRE+VSQ+IR+EL+ RA  F+I+LEDV+ITHM FG EFTK
Sbjct: 121 IGNEVLKAIVAQFDAAELITQRELVSQKIRQELAKRAHAFHIKLEDVAITHMVFGHEFTK 180

Query: 541 AVEQKQIAQQDAERAKFLVERAEQERQAAVIRAEGEAESADYISKALSKAGDGLLLIRRL 720
           +VE+KQIAQQ++ERAK+LV+ AEQER AAVIRAEG+AE+A+YISKAL+KAGDGLL+IRRL
Sbjct: 181 SVEKKQIAQQESERAKYLVQLAEQERAAAVIRAEGDAEAAEYISKALNKAGDGLLMIRRL 240

Query: 721 EASKEIAQTLANSSNVTYLPSNGAGGAEQQ-GSPNSLLLNLGR 846
           EASK+IAQTLA SSN+TYLPS+  GG+    G+P+SLLLNLGR
Sbjct: 241 EASKKIAQTLAGSSNITYLPSSSKGGSHDACGTPSSLLLNLGR 283

>KAFR0C01980 Chr3 complement(394370..395221) [852 bp, 283 aa] {ON}
           Anc_3.494 YGR132C
          Length = 283

 Score =  429 bits (1104), Expect = e-153
 Identities = 216/275 (78%), Positives = 250/275 (90%)
 Frame = +1

Query: 22  LARIALPIGIAFSALQYSMYDVKGGTRAVIFDRLSGVQQQVIGEGTHFLVPWLQRAIVYD 201
           + ++A+P G+  +A+ YSMYDVKGG+R VIFDR+SGV++ VIGEGTHFLVPWLQ+AI+YD
Sbjct: 9   VTKLAIPSGLLLTAVDYSMYDVKGGSRGVIFDRISGVKKAVIGEGTHFLVPWLQKAIIYD 68

Query: 202 VRTKPKNIATNTGTKDLQMVSLTLRVLHRPEVLQLPHIYQNLGLDYDERVLPSIGNEVLK 381
           VRTKPK+I+TNTGTKDLQMVSLTLR+LHRP V++LP IYQNLGLDYDERVLPSIGNEVLK
Sbjct: 69  VRTKPKSISTNTGTKDLQMVSLTLRLLHRPNVVELPRIYQNLGLDYDERVLPSIGNEVLK 128

Query: 382 AIVAQFDAAELITQREIVSQRIRKELSLRAAEFNIRLEDVSITHMTFGREFTKAVEQKQI 561
           +IVAQFDAAELITQREIVSQRIRKE+S RA EF I+LEDVSITHMTFG EFTKAVEQKQI
Sbjct: 129 SIVAQFDAAELITQREIVSQRIRKEMSHRANEFGIKLEDVSITHMTFGAEFTKAVEQKQI 188

Query: 562 AQQDAERAKFLVERAEQERQAAVIRAEGEAESADYISKALSKAGDGLLLIRRLEASKEIA 741
           AQQDAERA+FLVE+AEQERQA+VIRAEGEAESA+ ISKALS+ GDGLLLIRRLEASK+IA
Sbjct: 189 AQQDAERARFLVEKAEQERQASVIRAEGEAESAECISKALSRVGDGLLLIRRLEASKDIA 248

Query: 742 QTLANSSNVTYLPSNGAGGAEQQGSPNSLLLNLGR 846
           +TL+ SSN+TYLP       +++  PNSLLLN+GR
Sbjct: 249 RTLSKSSNITYLPGGKGREGDEKTPPNSLLLNIGR 283

>KLLA0D16302g Chr4 complement(1372447..1373127) [681 bp, 226 aa]
           {ON} similar to uniprot|P40961 Saccharomyces cerevisiae
           YGR132C
          Length = 226

 Score =  363 bits (933), Expect = e-127
 Identities = 183/214 (85%), Positives = 204/214 (95%)
 Frame = +1

Query: 1   MSKLADSLARIALPIGIAFSALQYSMYDVKGGTRAVIFDRLSGVQQQVIGEGTHFLVPWL 180
           MS++AD +ARIA+P+G+  SA+QYSMYDV+GG RAVIFDRL GVQQ VIGEGTHFLVPWL
Sbjct: 1   MSRVADVMARIAIPVGLTVSAIQYSMYDVRGGHRAVIFDRLQGVQQAVIGEGTHFLVPWL 60

Query: 181 QRAIVYDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPEVLQLPHIYQNLGLDYDERVLPS 360
           Q++I++DVRTKPKNIATNTGTKDLQMVSLTLRVLHRP+V+QLP IYQNLG+DYDERVLPS
Sbjct: 61  QKSILFDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPDVMQLPKIYQNLGIDYDERVLPS 120

Query: 361 IGNEVLKAIVAQFDAAELITQREIVSQRIRKELSLRAAEFNIRLEDVSITHMTFGREFTK 540
           IGNEVLKAIVAQFDAAELITQREIVSQRIR ELS RA EF+I+LEDVSITHMTFG+EFTK
Sbjct: 121 IGNEVLKAIVAQFDAAELITQREIVSQRIRAELSKRADEFHIKLEDVSITHMTFGQEFTK 180

Query: 541 AVEQKQIAQQDAERAKFLVERAEQERQAAVIRAE 642
           AVEQKQIAQQDAERA+FLVE+AEQER+AAVIRAE
Sbjct: 181 AVEQKQIAQQDAERARFLVEKAEQERKAAVIRAE 214

>KAFR0B04250 Chr2 complement(882694..883626) [933 bp, 310 aa] {ON}
           Anc_5.98 YGR231C
          Length = 310

 Score =  281 bits (719), Expect = 6e-94
 Identities = 141/241 (58%), Positives = 192/241 (79%)
 Frame = +1

Query: 43  IGIAFSALQYSMYDVKGGTRAVIFDRLSGVQQQVIGEGTHFLVPWLQRAIVYDVRTKPKN 222
           +G     LQ S+++V GG RA+++ R++GV  ++  EGTHF++PWL+  IVYDVR KP+N
Sbjct: 46  LGSGAFLLQQSLFNVDGGHRAIVYSRINGVSSRIYNEGTHFILPWLETPIVYDVRAKPRN 105

Query: 223 IATNTGTKDLQMVSLTLRVLHRPEVLQLPHIYQNLGLDYDERVLPSIGNEVLKAIVAQFD 402
           +A+ TGTKDLQMV++T RVL RP+V  LP IY+ LG DYDERVLPSI NEVLKA+VAQF+
Sbjct: 106 VASLTGTKDLQMVNITCRVLSRPDVRSLPIIYRTLGQDYDERVLPSIVNEVLKAVVAQFN 165

Query: 403 AAELITQREIVSQRIRKELSLRAAEFNIRLEDVSITHMTFGREFTKAVEQKQIAQQDAER 582
           A++LITQRE VS+ IR+ L  RA++FNI L+DVSIT MTF  EFT+AVE KQIAQQDA+R
Sbjct: 166 ASQLITQREKVSKLIRENLVRRASKFNIMLDDVSITFMTFSPEFTQAVEAKQIAQQDAQR 225

Query: 583 AKFLVERAEQERQAAVIRAEGEAESADYISKALSKAGDGLLLIRRLEASKEIAQTLANSS 762
           A F+V++A QE+Q  V++A+GEA+SA+ I +A+ K+ D  + ++RL+ ++EIA+ LANS 
Sbjct: 226 AAFIVDKARQEKQGMVVKAQGEAKSAELIGEAIKKSRD-YVELKRLDTAREIARILANSP 284

Query: 763 N 765
           N
Sbjct: 285 N 285

>TBLA0H02220 Chr8 (537650..538573) [924 bp, 307 aa] {ON} Anc_5.98
           YGR231C
          Length = 307

 Score =  280 bits (717), Expect = 1e-93
 Identities = 141/231 (61%), Positives = 186/231 (80%)
 Frame = +1

Query: 73  SMYDVKGGTRAVIFDRLSGVQQQVIGEGTHFLVPWLQRAIVYDVRTKPKNIATNTGTKDL 252
           S+++V GG RA+++ RLSGV  ++  EGTHF++PWLQ  I+YDVR KP+N+A+ TGTKDL
Sbjct: 55  SLFNVDGGHRAILYSRLSGVSSKIYNEGTHFVIPWLQTPIIYDVRAKPRNVASLTGTKDL 114

Query: 253 QMVSLTLRVLHRPEVLQLPHIYQNLGLDYDERVLPSIGNEVLKAIVAQFDAAELITQREI 432
           QMV++T RVL RP++  LP IY+ LG DYDERVLPSI NEVLKA+VAQF+A++LITQR+ 
Sbjct: 115 QMVNITCRVLSRPDIPSLPLIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQRDK 174

Query: 433 VSQRIRKELSLRAAEFNIRLEDVSITHMTFGREFTKAVEQKQIAQQDAERAKFLVERAEQ 612
           VS+ IR+ L  RA +FNI L+DVSIT MTF  EFT AVE KQIAQQDA+RA FLV+RA Q
Sbjct: 175 VSRLIRENLVRRAGKFNIALDDVSITFMTFSPEFTNAVESKQIAQQDAQRAAFLVDRARQ 234

Query: 613 ERQAAVIRAEGEAESADYISKALSKAGDGLLLIRRLEASKEIAQTLANSSN 765
           E+Q  V++A+GEA+SA+ I +A+ K+ D  + ++RL+ SK+IA+ LA SSN
Sbjct: 235 EKQGMVVKAQGEAKSAELIGEAIKKSKD-YVELKRLDISKDIAKILATSSN 284

>SAKL0G15510g Chr7 complement(1334598..1335524) [927 bp, 308 aa]
           {ON} highly similar to uniprot|P50085 Saccharomyces
           cerevisiae YGR231C PHB2 Possible role in aging
           mitochondrial protein prohibitin homolog homolog of
           mammalian BAP37 and S. cerevisiae Phb1p
          Length = 308

 Score =  280 bits (715), Expect = 2e-93
 Identities = 139/231 (60%), Positives = 188/231 (81%)
 Frame = +1

Query: 73  SMYDVKGGTRAVIFDRLSGVQQQVIGEGTHFLVPWLQRAIVYDVRTKPKNIATNTGTKDL 252
           ++++V GG RA+++ R+ G+QQ++  EGTHF VPWL+  IVYDVR KP+N+A+ TGTKDL
Sbjct: 58  ALFNVDGGHRAILYSRVGGIQQRIYNEGTHFAVPWLETPIVYDVRAKPRNVASLTGTKDL 117

Query: 253 QMVSLTLRVLHRPEVLQLPHIYQNLGLDYDERVLPSIGNEVLKAIVAQFDAAELITQREI 432
           QMV++T RVL RPEV QLP IY+ LG DYDERVLPSI NEVLKA+VAQF+A++LITQRE 
Sbjct: 118 QMVNITCRVLSRPEVSQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQRER 177

Query: 433 VSQRIRKELSLRAAEFNIRLEDVSITHMTFGREFTKAVEQKQIAQQDAERAKFLVERAEQ 612
           VS+ IR+ L  RA++FNI L+DVSIT+MTF  EFT AVE KQIAQQDA+RA F+V++A Q
Sbjct: 178 VSRLIRENLVRRASKFNILLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDKARQ 237

Query: 613 ERQAAVIRAEGEAESADYISKALSKAGDGLLLIRRLEASKEIAQTLANSSN 765
           E+Q  V++A+GEA+SA+ I +A+ K+ D  + ++RL+ ++EIA+ L+ S N
Sbjct: 238 EKQGMVVKAQGEAQSAELIGEAIKKSKD-YVELKRLDTAREIAEILSKSPN 287

>Kwal_27.12747 s27 complement(1358872..1359795) [924 bp, 307 aa]
           {ON} YGR231C (PHB2) - mitochondrial protein, prohibitin
           homolog; homolog of mammalian BAP37 and S. cerevisiae
           Phb1p [contig 260] FULL
          Length = 307

 Score =  277 bits (708), Expect = 2e-92
 Identities = 137/238 (57%), Positives = 190/238 (79%)
 Frame = +1

Query: 64  LQYSMYDVKGGTRAVIFDRLSGVQQQVIGEGTHFLVPWLQRAIVYDVRTKPKNIATNTGT 243
           L  S+++V GG RA+++ RL+GVQ ++  EGTHF +PWL+  IVYDVR KP+N+A+ TGT
Sbjct: 54  LNASLFNVDGGHRAIVYSRLNGVQSRIFAEGTHFAIPWLETPIVYDVRAKPRNVASLTGT 113

Query: 244 KDLQMVSLTLRVLHRPEVLQLPHIYQNLGLDYDERVLPSIGNEVLKAIVAQFDAAELITQ 423
           KDLQMV++T RVL RP+V QLP +++ LG DYDERVLPSI NEVLK++VAQF+A++LITQ
Sbjct: 114 KDLQMVNITCRVLSRPDVTQLPTVFRTLGQDYDERVLPSIVNEVLKSVVAQFNASQLITQ 173

Query: 424 REIVSQRIRKELSLRAAEFNIRLEDVSITHMTFGREFTKAVEQKQIAQQDAERAKFLVER 603
           RE VS+ IR+ L  RA++FN+ L+DVSIT+MTF  EFT AVE KQIAQQDA+RA F+V++
Sbjct: 174 REKVSRLIRENLVRRASKFNVLLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDK 233

Query: 604 AEQERQAAVIRAEGEAESADYISKALSKAGDGLLLIRRLEASKEIAQTLANSSNVTYL 777
           A QE+Q  V++A+GEA+SA+ I +A+ K+ D  + ++RL+ ++EIA  L++S N   L
Sbjct: 234 ARQEKQGMVVKAQGEAKSAELIGEAIKKSKD-YVELKRLDTAREIATILSSSPNKVIL 290

>ADL141W Chr4 (444592..445515) [924 bp, 307 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR231C (PHB2)
          Length = 307

 Score =  277 bits (708), Expect = 2e-92
 Identities = 138/234 (58%), Positives = 187/234 (79%)
 Frame = +1

Query: 64  LQYSMYDVKGGTRAVIFDRLSGVQQQVIGEGTHFLVPWLQRAIVYDVRTKPKNIATNTGT 243
           L  S+++V GG RA+++ RLSGVQQ V GEGTHF++PWL+  ++YDVR+KP+ +++ TGT
Sbjct: 54  LNASLFNVDGGHRAIVYSRLSGVQQSVYGEGTHFVIPWLETPVLYDVRSKPRTVSSLTGT 113

Query: 244 KDLQMVSLTLRVLHRPEVLQLPHIYQNLGLDYDERVLPSIGNEVLKAIVAQFDAAELITQ 423
            DLQMV++T RVL RP+V  LP IY+ LG DYDERVLPSI NEVLKA+VAQF+A++LITQ
Sbjct: 114 NDLQMVNITCRVLSRPDVQHLPLIYRTLGTDYDERVLPSIVNEVLKAVVAQFNASQLITQ 173

Query: 424 REIVSQRIRKELSLRAAEFNIRLEDVSITHMTFGREFTKAVEQKQIAQQDAERAKFLVER 603
           RE VS+ IR  L  RA+ FNI L+DVSIT+MTF  EFT AVE KQ+AQQDA+RA F VE+
Sbjct: 174 RESVSRLIRDNLVRRASRFNIMLDDVSITYMTFSPEFTSAVEAKQVAQQDAQRASFYVEK 233

Query: 604 AEQERQAAVIRAEGEAESADYISKALSKAGDGLLLIRRLEASKEIAQTLANSSN 765
           A+QE+Q+ +++A+GEA+SA+ I +A+ K+ D  + ++RL+ ++EIA  LA S N
Sbjct: 234 AKQEKQSMIVKAQGEAKSAELIGEAIKKSKD-YVELKRLDTAREIAGILAASPN 286

>YGR231C Chr7 complement(952548..953480) [933 bp, 310 aa] {ON}
           PHB2Subunit of the prohibitin complex (Phb1p-Phb2p), a
           1.2 MDa ring-shaped inner mitochondrial membrane
           chaperone that stabilizes newly synthesized proteins;
           determinant of replicative life span; involved in
           mitochondrial segregation
          Length = 310

 Score =  276 bits (705), Expect = 7e-92
 Identities = 136/231 (58%), Positives = 187/231 (80%)
 Frame = +1

Query: 73  SMYDVKGGTRAVIFDRLSGVQQQVIGEGTHFLVPWLQRAIVYDVRTKPKNIATNTGTKDL 252
           ++++V GG RA+++ R+ GV  ++  EGTHF+ PWL   I+YDVR KP+N+A+ TGTKDL
Sbjct: 57  ALFNVDGGHRAIVYSRIHGVSSRIFNEGTHFIFPWLDTPIIYDVRAKPRNVASLTGTKDL 116

Query: 253 QMVSLTLRVLHRPEVLQLPHIYQNLGLDYDERVLPSIGNEVLKAIVAQFDAAELITQREI 432
           QMV++T RVL RP+V+QLP IY+ LG DYDERVLPSI NEVLKA+VAQF+A++LITQRE 
Sbjct: 117 QMVNITCRVLSRPDVVQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQREK 176

Query: 433 VSQRIRKELSLRAAEFNIRLEDVSITHMTFGREFTKAVEQKQIAQQDAERAKFLVERAEQ 612
           VS+ IR+ L  RA++FNI L+DVSIT+MTF  EFT AVE KQIAQQDA+RA F+V++A Q
Sbjct: 177 VSRLIRENLVRRASKFNILLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDKARQ 236

Query: 613 ERQAAVIRAEGEAESADYISKALSKAGDGLLLIRRLEASKEIAQTLANSSN 765
           E+Q  V+RA+GEA+SA+ I +A+ K+ D  + ++RL+ +++IA+ LA+S N
Sbjct: 237 EKQGMVVRAQGEAKSAELIGEAIKKSRD-YVELKRLDTARDIAKILASSPN 286

>CAGL0L06490g Chr12 (735080..736021) [942 bp, 313 aa] {ON} highly
           similar to uniprot|P50085 Saccharomyces cerevisiae
           YGR231c PHB2 or uniprot|P40961 Saccharomyces cerevisiae
           YGR132c PHB1
          Length = 313

 Score =  275 bits (704), Expect = 1e-91
 Identities = 139/243 (57%), Positives = 188/243 (77%)
 Frame = +1

Query: 37  LPIGIAFSALQYSMYDVKGGTRAVIFDRLSGVQQQVIGEGTHFLVPWLQRAIVYDVRTKP 216
           L +G        ++++V GG RA+++ R+ GV Q++  EGTH ++PW++  IVYDVR KP
Sbjct: 47  LVLGAGALFFNNALFNVDGGHRAIVYSRIGGVSQKIFSEGTHIIIPWIETPIVYDVRAKP 106

Query: 217 KNIATNTGTKDLQMVSLTLRVLHRPEVLQLPHIYQNLGLDYDERVLPSIGNEVLKAIVAQ 396
           +N+A+ TGTKDLQMV++T RVL RP V QLP IY+ LG DYDERVLPSI NEVLKA+VAQ
Sbjct: 107 RNVASLTGTKDLQMVNITCRVLSRPNVGQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQ 166

Query: 397 FDAAELITQREIVSQRIRKELSLRAAEFNIRLEDVSITHMTFGREFTKAVEQKQIAQQDA 576
           F+A++LITQRE VS+ IR  L  RA+ FNI L+DVSIT+MTF  EFT+AVE KQIAQQDA
Sbjct: 167 FNASQLITQREKVSRLIRDNLVRRASGFNILLDDVSITYMTFSPEFTQAVEAKQIAQQDA 226

Query: 577 ERAKFLVERAEQERQAAVIRAEGEAESADYISKALSKAGDGLLLIRRLEASKEIAQTLAN 756
           +RA F+V++A QE+Q  V++A+GEA+SA+ I  A+ K+ D  + ++RL+ +K+IA+ LAN
Sbjct: 227 QRAAFIVDKARQEKQGMVVKAQGEAKSAELIGDAIKKSRD-YVELKRLDTAKDIAKILAN 285

Query: 757 SSN 765
           S N
Sbjct: 286 SPN 288

>Smik_16.75 Chr16 (143216..144148) [933 bp, 310 aa] {ON} YGR231C
           (REAL)
          Length = 310

 Score =  275 bits (702), Expect = 2e-91
 Identities = 136/231 (58%), Positives = 187/231 (80%)
 Frame = +1

Query: 73  SMYDVKGGTRAVIFDRLSGVQQQVIGEGTHFLVPWLQRAIVYDVRTKPKNIATNTGTKDL 252
           ++++V GG RA+++ R+ GV  ++  EGTHF+ PWL   IVYDVR KP+N+A+ TGTKDL
Sbjct: 57  ALFNVDGGHRAIVYSRIHGVSTKIFNEGTHFIFPWLDTPIVYDVRAKPRNVASLTGTKDL 116

Query: 253 QMVSLTLRVLHRPEVLQLPHIYQNLGLDYDERVLPSIGNEVLKAIVAQFDAAELITQREI 432
           QMV++T RVL RP+V+QLP IY+ LG DYDERVLPSI NEVLKA+VAQF+A++LITQRE 
Sbjct: 117 QMVNITCRVLSRPDVVQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQREK 176

Query: 433 VSQRIRKELSLRAAEFNIRLEDVSITHMTFGREFTKAVEQKQIAQQDAERAKFLVERAEQ 612
           VS+ IR+ L  RA++FNI L+DVSIT+MTF  EFT AVE KQIAQQDA+RA F+V++A Q
Sbjct: 177 VSRLIRENLVRRASKFNILLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDKARQ 236

Query: 613 ERQAAVIRAEGEAESADYISKALSKAGDGLLLIRRLEASKEIAQTLANSSN 765
           E+Q  V++A+GEA+SA+ I +A+ K+ D  + ++RL+ +++IA+ LA+S N
Sbjct: 237 EKQGMVVKAQGEAKSAELIGEAIKKSRD-YVELKRLDTARDIAKILASSPN 286

>KLTH0C01672g Chr3 (147893..148816) [924 bp, 307 aa] {ON} highly
           similar to uniprot|P50085 Saccharomyces cerevisiae
           YGR231C PHB2 Possible role in aging mitochondrial
           protein prohibitin homolog homolog of mammalian BAP37
           and S. cerevisiae Phb1p
          Length = 307

 Score =  273 bits (699), Expect = 5e-91
 Identities = 137/234 (58%), Positives = 186/234 (79%)
 Frame = +1

Query: 64  LQYSMYDVKGGTRAVIFDRLSGVQQQVIGEGTHFLVPWLQRAIVYDVRTKPKNIATNTGT 243
           L  S+++V GG RA+I+ RL+GVQ ++  EGTHF +PW +  IVYDVR KP+N+A+ TGT
Sbjct: 54  LNSSLFNVDGGHRAIIYSRLNGVQSRIFAEGTHFAIPWFETPIVYDVRAKPRNVASLTGT 113

Query: 244 KDLQMVSLTLRVLHRPEVLQLPHIYQNLGLDYDERVLPSIGNEVLKAIVAQFDAAELITQ 423
           KDLQMV++T RVL RP V QLP +++ LG DYDERVLPSI NEVLK++VAQF+A++LITQ
Sbjct: 114 KDLQMVNITCRVLSRPNVSQLPTVFRTLGQDYDERVLPSIVNEVLKSVVAQFNASQLITQ 173

Query: 424 REIVSQRIRKELSLRAAEFNIRLEDVSITHMTFGREFTKAVEQKQIAQQDAERAKFLVER 603
           RE VS+ IR+ L  RA++FNI L+DVSIT+MTF  EFT AVE KQIAQQDA+RA F+V++
Sbjct: 174 REKVSRLIRENLVRRASKFNILLDDVSITYMTFSPEFTYAVEAKQIAQQDAQRAAFVVDK 233

Query: 604 AEQERQAAVIRAEGEAESADYISKALSKAGDGLLLIRRLEASKEIAQTLANSSN 765
           A QE+Q  V++A+GEA+SA+ I +A+ K+ D  + ++RL+ ++EIA  L+ S N
Sbjct: 234 ARQEKQGMVVKAQGEAKSAELIGEAIKKSKD-YVELKRLDTAREIATILSQSPN 286

>Skud_7.565 Chr7 complement(927426..928358) [933 bp, 310 aa] {ON}
           YGR231C (REAL)
          Length = 310

 Score =  273 bits (699), Expect = 6e-91
 Identities = 135/231 (58%), Positives = 184/231 (79%)
 Frame = +1

Query: 73  SMYDVKGGTRAVIFDRLSGVQQQVIGEGTHFLVPWLQRAIVYDVRTKPKNIATNTGTKDL 252
           ++++V GG RA+++ R+ GV  ++  EGTHF+ PWL   I+YDVR KP+N+A+ TGTKDL
Sbjct: 57  ALFNVDGGHRAIVYSRIHGVSSKIFNEGTHFIFPWLDTPIIYDVRAKPRNVASLTGTKDL 116

Query: 253 QMVSLTLRVLHRPEVLQLPHIYQNLGLDYDERVLPSIGNEVLKAIVAQFDAAELITQREI 432
           QMV++T RVL RP+V QLP IY+ LG DYDERVLPSI NEVLK++VAQF+A++LITQRE 
Sbjct: 117 QMVNITCRVLSRPDVAQLPIIYRTLGQDYDERVLPSIVNEVLKSVVAQFNASQLITQREK 176

Query: 433 VSQRIRKELSLRAAEFNIRLEDVSITHMTFGREFTKAVEQKQIAQQDAERAKFLVERAEQ 612
           VS+ IR+ L  RA  FNI L+DVSIT+MTF  EFT AVE KQIAQQDA+RA F+V++A Q
Sbjct: 177 VSRLIRENLVRRATRFNILLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDKARQ 236

Query: 613 ERQAAVIRAEGEAESADYISKALSKAGDGLLLIRRLEASKEIAQTLANSSN 765
           E+Q  V++A+GEA+SA+ I +A+ K+ D  + ++RL+ +++IA+ LANS N
Sbjct: 237 EKQGMVVKAQGEAKSAELIGEAIKKSRD-YVELKRLDTARDIAKILANSPN 286

>Kpol_1050.61 s1050 complement(135758..136690) [933 bp, 310 aa] {ON}
           complement(135758..136690) [933 nt, 311 aa]
          Length = 310

 Score =  273 bits (698), Expect = 8e-91
 Identities = 135/231 (58%), Positives = 185/231 (80%)
 Frame = +1

Query: 73  SMYDVKGGTRAVIFDRLSGVQQQVIGEGTHFLVPWLQRAIVYDVRTKPKNIATNTGTKDL 252
           ++++V GG RA+++ R+ GV  ++  EGTHF++PWL+  +VYDVR KP+N+A+ TGTKDL
Sbjct: 60  ALFNVDGGHRAIVYSRIGGVSSKIYNEGTHFVLPWLETPVVYDVRAKPRNVASLTGTKDL 119

Query: 253 QMVSLTLRVLHRPEVLQLPHIYQNLGLDYDERVLPSIGNEVLKAIVAQFDAAELITQREI 432
           QMV++T RVL RP+V QLP IY+ LG DYDERVLPSI NEVLKA+VAQF+A++LITQRE 
Sbjct: 120 QMVNITCRVLSRPDVSQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQREK 179

Query: 433 VSQRIRKELSLRAAEFNIRLEDVSITHMTFGREFTKAVEQKQIAQQDAERAKFLVERAEQ 612
           VS+ IR+ L  RA  FN+ L+DVSIT+MTF  EFT AVE KQIAQQDA+RA F+V++A+Q
Sbjct: 180 VSRLIRENLVNRAGRFNLILDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDKAKQ 239

Query: 613 ERQAAVIRAEGEAESADYISKALSKAGDGLLLIRRLEASKEIAQTLANSSN 765
           E+Q  V++A+GEA+SA+ I +A+ K+ D  + ++RL+ ++EIA  LA S N
Sbjct: 240 EKQGMVVKAQGEAKSAELIGEAIKKSKD-YVELKRLDTAREIADILAKSPN 289

>TPHA0A05090 Chr1 complement(1146837..1147769) [933 bp, 310 aa] {ON}
           Anc_5.98 YGR231C
          Length = 310

 Score =  273 bits (698), Expect = 8e-91
 Identities = 134/231 (58%), Positives = 184/231 (79%)
 Frame = +1

Query: 73  SMYDVKGGTRAVIFDRLSGVQQQVIGEGTHFLVPWLQRAIVYDVRTKPKNIATNTGTKDL 252
           ++++V GG RA+++ R+ GV  ++  EGTHF++PW++  ++YDVR KP+N+A+ TGTKDL
Sbjct: 58  ALFNVDGGHRAIVYSRIGGVSNKIYTEGTHFVIPWIETPVIYDVRAKPRNVASLTGTKDL 117

Query: 253 QMVSLTLRVLHRPEVLQLPHIYQNLGLDYDERVLPSIGNEVLKAIVAQFDAAELITQREI 432
           QMV++T RVL RP V QLP IY+ LG DYDERVLPSI NEVLKA+VAQF+A++LITQR+ 
Sbjct: 118 QMVNITCRVLSRPNVTQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQRDK 177

Query: 433 VSQRIRKELSLRAAEFNIRLEDVSITHMTFGREFTKAVEQKQIAQQDAERAKFLVERAEQ 612
           VS+ IR  L LRA +FNI L+DVSIT+MTF  EFT AVE KQIAQQDA+RA F+V++A Q
Sbjct: 178 VSRLIRDNLVLRAQKFNITLDDVSITYMTFSPEFTTAVEAKQIAQQDAQRAAFVVDKARQ 237

Query: 613 ERQAAVIRAEGEAESADYISKALSKAGDGLLLIRRLEASKEIAQTLANSSN 765
           E+Q  V++A+GEA+SA+ I +A+ K+ D  + ++RL+ +K+IA  LA S N
Sbjct: 238 EKQGMVVKAQGEAKSAELIGEAIKKSKD-YVELKRLDTAKDIADILAKSPN 287

>Suva_7.523 Chr7 complement(907005..907937) [933 bp, 310 aa] {ON}
           YGR231C (REAL)
          Length = 310

 Score =  273 bits (697), Expect = 1e-90
 Identities = 135/231 (58%), Positives = 186/231 (80%)
 Frame = +1

Query: 73  SMYDVKGGTRAVIFDRLSGVQQQVIGEGTHFLVPWLQRAIVYDVRTKPKNIATNTGTKDL 252
           ++++V GG RA+++ RL+GV  ++  EGTHF+ PW+   I+YDVR KP+N+A+ TGTKDL
Sbjct: 57  ALFNVDGGHRAIVYSRLNGVSARIFNEGTHFIFPWIDTPIIYDVRAKPRNVASLTGTKDL 116

Query: 253 QMVSLTLRVLHRPEVLQLPHIYQNLGLDYDERVLPSIGNEVLKAIVAQFDAAELITQREI 432
           QMV++T RVL RP+V QLP IY+ LG DYDERVLPSI NEVLKA+VAQF+A++LITQRE 
Sbjct: 117 QMVNITCRVLSRPDVGQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQREK 176

Query: 433 VSQRIRKELSLRAAEFNIRLEDVSITHMTFGREFTKAVEQKQIAQQDAERAKFLVERAEQ 612
           VS+ IR+ L  RA+ F+I L+DVSIT+MTF  EFT AVE KQIAQQDA+RA F+V++A Q
Sbjct: 177 VSRLIRENLVRRASRFSILLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDKARQ 236

Query: 613 ERQAAVIRAEGEAESADYISKALSKAGDGLLLIRRLEASKEIAQTLANSSN 765
           E+Q  V++A+GEA+SA+ I +A+ K+ D  + ++RL+ +++IA+ LANS N
Sbjct: 237 EKQGMVVKAQGEAKSAELIGEAIKKSKD-YVELKRLDTARDIAKILANSPN 286

>NCAS0F00600 Chr6 (117964..118905) [942 bp, 313 aa] {ON} Anc_5.98
           YGR231C
          Length = 313

 Score =  272 bits (696), Expect = 2e-90
 Identities = 136/234 (58%), Positives = 185/234 (79%)
 Frame = +1

Query: 64  LQYSMYDVKGGTRAVIFDRLSGVQQQVIGEGTHFLVPWLQRAIVYDVRTKPKNIATNTGT 243
           L  S+++V GG RA+++ R+SGV  ++  EGTHF++PW++  I+YDVR KP+N+A+ TGT
Sbjct: 56  LNSSLFNVDGGHRAIVYSRISGVSPKIYPEGTHFIIPWIETPIIYDVRAKPRNVASLTGT 115

Query: 244 KDLQMVSLTLRVLHRPEVLQLPHIYQNLGLDYDERVLPSIGNEVLKAIVAQFDAAELITQ 423
           KDLQMV++T RVL RP V  LP+IY+ LG DYDERVLPSI NEVLK++VAQF+A++LITQ
Sbjct: 116 KDLQMVNITCRVLSRPNVENLPNIYRTLGQDYDERVLPSIVNEVLKSVVAQFNASQLITQ 175

Query: 424 REIVSQRIRKELSLRAAEFNIRLEDVSITHMTFGREFTKAVEQKQIAQQDAERAKFLVER 603
           RE VS+ IR+ L  R++ FNI L+DVSIT MTF  EFT AVE KQIAQQDA+RA F+V++
Sbjct: 176 REKVSKLIRENLMGRSSRFNILLDDVSITFMTFSPEFTNAVEAKQIAQQDAQRAAFVVDK 235

Query: 604 AEQERQAAVIRAEGEAESADYISKALSKAGDGLLLIRRLEASKEIAQTLANSSN 765
           A QE+Q  V+RA+GEA+SA+ I +A+ K+ D  + ++RL+ ++EIA  LA S N
Sbjct: 236 ARQEKQGMVVRAQGEAKSAELIGEAIKKSKD-YVELKRLDTAREIATILAKSPN 288

>KNAG0A01580 Chr1 (79208..80074) [867 bp, 288 aa] {ON} Anc_5.98
           YGR231C
          Length = 288

 Score =  271 bits (693), Expect = 2e-90
 Identities = 136/234 (58%), Positives = 185/234 (79%)
 Frame = +1

Query: 64  LQYSMYDVKGGTRAVIFDRLSGVQQQVIGEGTHFLVPWLQRAIVYDVRTKPKNIATNTGT 243
           L  ++++V GG RA+++ R+ GV  ++  EGTHF++PWL+  IVYDVR KP+N+A+ TGT
Sbjct: 32  LNSALFNVDGGHRAIVYSRIGGVLPRIYNEGTHFVLPWLETPIVYDVRAKPRNVASLTGT 91

Query: 244 KDLQMVSLTLRVLHRPEVLQLPHIYQNLGLDYDERVLPSIGNEVLKAIVAQFDAAELITQ 423
           KDLQMV++T RVL RP+V QLP +Y+ LG DYD+RVLPSI NEVLK++VAQF+A++LITQ
Sbjct: 92  KDLQMVNITCRVLSRPDVTQLPTLYRTLGQDYDDRVLPSIVNEVLKSVVAQFNASQLITQ 151

Query: 424 REIVSQRIRKELSLRAAEFNIRLEDVSITHMTFGREFTKAVEQKQIAQQDAERAKFLVER 603
           RE VS+ IR+ L  RA+ FNI L+DVSIT+MTF  EFT AVE KQIAQQDA+RA F+V++
Sbjct: 152 REKVSRLIRENLVRRASRFNIMLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFIVDK 211

Query: 604 AEQERQAAVIRAEGEAESADYISKALSKAGDGLLLIRRLEASKEIAQTLANSSN 765
           A QE+Q  V++A GEA+SA+ I +A+ K+ D  + ++RL+ +KEIA  LA S N
Sbjct: 212 ARQEKQGMVVKAVGEAKSAELIGEAIKKSKD-YVELKRLDTAKEIATILAASPN 264

>NDAI0D02530 Chr4 complement(583429..584379) [951 bp, 316 aa] {ON}
           Anc_5.98
          Length = 316

 Score =  272 bits (695), Expect = 3e-90
 Identities = 139/241 (57%), Positives = 186/241 (77%)
 Frame = +1

Query: 43  IGIAFSALQYSMYDVKGGTRAVIFDRLSGVQQQVIGEGTHFLVPWLQRAIVYDVRTKPKN 222
           +G +   L  ++++V GG RA+++ R+SGV  ++  EGTHF +PW++  I+YDVR KP+N
Sbjct: 52  LGGSAMLLNSALFNVDGGHRAIVYSRISGVSPRIYPEGTHFAIPWIETPIIYDVRAKPRN 111

Query: 223 IATNTGTKDLQMVSLTLRVLHRPEVLQLPHIYQNLGLDYDERVLPSIGNEVLKAIVAQFD 402
           +A+ TGTKDLQMV++T RVL RP V QLP IY+ LG DYDERVLPSI NEVLKA+VAQF+
Sbjct: 112 VASLTGTKDLQMVNITCRVLSRPNVGQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFN 171

Query: 403 AAELITQREIVSQRIRKELSLRAAEFNIRLEDVSITHMTFGREFTKAVEQKQIAQQDAER 582
           A++LITQRE VS+ IR+ L  RA  FNI L+DVSIT MTF  EFT AVE KQIAQQDA+R
Sbjct: 172 ASQLITQREKVSKLIRENLMGRANRFNILLDDVSITFMTFSPEFTNAVEAKQIAQQDAQR 231

Query: 583 AKFLVERAEQERQAAVIRAEGEAESADYISKALSKAGDGLLLIRRLEASKEIAQTLANSS 762
           A F+V++A QE+Q  V+RA+GEA+SA+ I  A+ K+ D  + ++RL+ ++EIA+ LA S 
Sbjct: 232 AAFVVDKARQEKQGMVVRAQGEAKSAELIGDAIKKSKD-YVELKRLDTAREIARILAKSP 290

Query: 763 N 765
           N
Sbjct: 291 N 291

>ZYRO0B15136g Chr2 (1233955..1234887) [933 bp, 310 aa] {ON} similar
           to uniprot|P50085 Saccharomyces cerevisiae YGR231C PHB2
           Possible role in aging mitochondrial protein prohibitin
           homolog homolog of mammalian BAP37 and S. cerevisiae
           Phb1p
          Length = 310

 Score =  271 bits (694), Expect = 3e-90
 Identities = 136/231 (58%), Positives = 185/231 (80%)
 Frame = +1

Query: 73  SMYDVKGGTRAVIFDRLSGVQQQVIGEGTHFLVPWLQRAIVYDVRTKPKNIATNTGTKDL 252
           ++++V GG RA+++ R+ GV  ++  EGTH L+PW +  +VYDVR KP+N+A+ TGTKDL
Sbjct: 60  ALFNVDGGHRAIVYSRIGGVSSRIYPEGTHLLLPWFETPVVYDVRAKPRNVASLTGTKDL 119

Query: 253 QMVSLTLRVLHRPEVLQLPHIYQNLGLDYDERVLPSIGNEVLKAIVAQFDAAELITQREI 432
           QMV++T RVL RP+V QLP IY+ LGLDYDERVLPSI NEVLKA+VAQF+A++LITQRE 
Sbjct: 120 QMVNITCRVLSRPDVGQLPVIYRTLGLDYDERVLPSIVNEVLKAVVAQFNASQLITQREK 179

Query: 433 VSQRIRKELSLRAAEFNIRLEDVSITHMTFGREFTKAVEQKQIAQQDAERAKFLVERAEQ 612
           VS+ IR+ L  RA+ FNI L+DVSIT+MTF  EFT AVE KQIAQQDA+RA F+V+RA Q
Sbjct: 180 VSRLIRENLVRRASRFNILLDDVSITYMTFSPEFTAAVESKQIAQQDAQRAAFVVDRALQ 239

Query: 613 ERQAAVIRAEGEAESADYISKALSKAGDGLLLIRRLEASKEIAQTLANSSN 765
           E+Q  V++A+G+A+SA+ I +A+ K+ D  + ++RL+ ++EIAQ L+ S N
Sbjct: 240 EKQGLVVKAQGDAKSAELIGEAIRKSKD-YVELKRLDTAREIAQILSRSPN 289

>KLLA0E15731g Chr5 (1407793..1408719) [927 bp, 308 aa] {ON} similar
           to uniprot|P50085 Saccharomyces cerevisiae YGR231C PHB2
           Possible role in aging mitochondrial protein prohibitin
           homolog homolog of mammalian BAP37 and S. cerevisiae
           Phb1p
          Length = 308

 Score =  271 bits (692), Expect = 6e-90
 Identities = 137/253 (54%), Positives = 195/253 (77%)
 Frame = +1

Query: 19  SLARIALPIGIAFSALQYSMYDVKGGTRAVIFDRLSGVQQQVIGEGTHFLVPWLQRAIVY 198
           +L  + L IG  F A + ++++V GG RA+++ R++GVQ ++  EGTHF++PW++  +VY
Sbjct: 41  ALGGLFLLIGGGFLANE-ALFNVDGGHRAIVYSRINGVQPRIYPEGTHFIIPWVENPVVY 99

Query: 199 DVRTKPKNIATNTGTKDLQMVSLTLRVLHRPEVLQLPHIYQNLGLDYDERVLPSIGNEVL 378
           DVR KP+N+++ TGTKDLQMV++T RVL RP V  LP IY+ LG+DYDERVLPSI NEVL
Sbjct: 100 DVRAKPRNVSSLTGTKDLQMVNITCRVLSRPNVENLPMIYRTLGVDYDERVLPSIVNEVL 159

Query: 379 KAIVAQFDAAELITQREIVSQRIRKELSLRAAEFNIRLEDVSITHMTFGREFTKAVEQKQ 558
           KA+VAQF+A++LITQRE VS+ IR+ L  RA  FNI L+DVSIT+MTF  EFT +VE KQ
Sbjct: 160 KAVVAQFNASQLITQRERVSRLIRENLVRRAKHFNIMLDDVSITYMTFSPEFTNSVEAKQ 219

Query: 559 IAQQDAERAKFLVERAEQERQAAVIRAEGEAESADYISKALSKAGDGLLLIRRLEASKEI 738
           IAQQDA++A F+V++A QE+Q  +++A+GEA+SA+ I +A+ K+ D  + ++RL+ ++EI
Sbjct: 220 IAQQDAQKAAFVVDKATQEKQGMIVKAQGEAKSAELIGEAIKKSKD-YVELKRLDTAREI 278

Query: 739 AQTLANSSNVTYL 777
           A  L+ S N   L
Sbjct: 279 ASILSRSPNKVIL 291

>TDEL0G01210 Chr7 (248098..249027) [930 bp, 309 aa] {ON} Anc_5.98
           YGR231C
          Length = 309

 Score =  271 bits (692), Expect = 7e-90
 Identities = 137/241 (56%), Positives = 187/241 (77%)
 Frame = +1

Query: 43  IGIAFSALQYSMYDVKGGTRAVIFDRLSGVQQQVIGEGTHFLVPWLQRAIVYDVRTKPKN 222
           +G A   L  ++++V GG RA+++ R+ GV  ++  EGTH ++PWL+  +VYDVR KP+N
Sbjct: 49  LGGAALFLNSALFNVDGGHRAIVYSRIGGVSSRIYNEGTHVIIPWLETPVVYDVRAKPRN 108

Query: 223 IATNTGTKDLQMVSLTLRVLHRPEVLQLPHIYQNLGLDYDERVLPSIGNEVLKAIVAQFD 402
           +A+ TGTKDLQMV++T RVL RP V QLP IY+ LG DY ERVLPSI NEVLKA+VAQF+
Sbjct: 109 VASLTGTKDLQMVNITCRVLSRPNVEQLPTIYRTLGQDYGERVLPSIVNEVLKAVVAQFN 168

Query: 403 AAELITQREIVSQRIRKELSLRAAEFNIRLEDVSITHMTFGREFTKAVEQKQIAQQDAER 582
           A++LITQRE VS+ IR+ L  RA+ F+I L+DVSIT+MTF  EFT AVE KQIAQQDA+R
Sbjct: 169 ASQLITQREKVSRLIRENLVRRASNFSILLDDVSITYMTFSPEFTNAVEAKQIAQQDAQR 228

Query: 583 AKFLVERAEQERQAAVIRAEGEAESADYISKALSKAGDGLLLIRRLEASKEIAQTLANSS 762
           A F+V++A QE+Q  V++A+GEA+SA+ I +A+ K+ D  + ++RL+ ++EIAQ LA S 
Sbjct: 229 AAFVVDKARQEKQGMVVKAQGEAKSAELIGEAIKKSKD-YVELKRLDTAREIAQILARSP 287

Query: 763 N 765
           N
Sbjct: 288 N 288

>Kwal_55.21241 s55 (746122..746340) [219 bp, 72 aa] {OFF} [contig
           130] FULL
          Length = 72

 Score = 77.0 bits (188), Expect = 1e-17
 Identities = 39/51 (76%), Positives = 40/51 (78%)
 Frame = -2

Query: 620 CLSCSALSTKNFALSASCWAICFCSTALVNSRPNVICVMDTSSNLMLNSAA 468
           CLSCSA ST   A SASC AICFCSTALV SRP V+CVMDTSS  MLNS A
Sbjct: 17  CLSCSASSTTKRARSASCCAICFCSTALVKSRPKVMCVMDTSSRRMLNSDA 67

>Kwal_55.21243 s55 (746615..746800) [186 bp, 61 aa] {OFF} [contig
           130] FULL
          Length = 61

 Score = 37.4 bits (85), Expect = 0.003
 Identities = 22/54 (40%), Positives = 30/54 (55%)
 Frame = -3

Query: 163 NGYPHLSPAVEHRTAYQKSRRESHP*RRTWSIVRQKMQYRLAMRFLLMSLRVWT 2
           N Y H   AVEH +  Q+SR   H   RT +I  QK + + A +  L +LR+WT
Sbjct: 5   NAYLHQLLAVEHHSNGQRSRPLIHLSHRTSNIATQKPRAQGAAQSWLTNLRIWT 58

>CAGL0D02596g Chr4 complement(266641..267390) [750 bp, 249 aa] {ON}
           similar to uniprot|Q12146 Saccharomyces cerevisiae
           YOL146w
          Length = 249

 Score = 33.1 bits (74), Expect = 0.65
 Identities = 13/33 (39%), Positives = 21/33 (63%)
 Frame = -1

Query: 171 DKEMGTLTYHLLLNTGQPIKNHGASPTLDVVHG 73
           DK++G + Y LLL   Q I N+ +S ++D  +G
Sbjct: 126 DKDLGEIVYELLLERAQQINNYASSVSIDTEYG 158

>Kwal_33.13389 s33 complement(197441..199525) [2085 bp, 694 aa] {ON}
           YNL272C (SEC2) - GDP/GTP exchange factor for Sec4p
           [contig 118] FULL
          Length = 694

 Score = 33.1 bits (74), Expect = 0.92
 Identities = 27/98 (27%), Positives = 42/98 (42%), Gaps = 4/98 (4%)
 Frame = +1

Query: 529 EFTKAVEQKQIAQQDAERAKFLV--ERAEQERQAAVIRAEGEAE--SADYISKALSKAGD 696
           +F K     ++   D    K +   E +       VI A  E+E  SAD  SK   + GD
Sbjct: 551 DFEKTTNSSELVDPDVHEEKIMSKSEVSTPTLSPTVIAAPNESETHSADQKSKVEQENGD 610

Query: 697 GLLLIRRLEASKEIAQTLANSSNVTYLPSNGAGGAEQQ 810
            ++L+R+ E       TL +SS     P  G   +E++
Sbjct: 611 AVVLLRQEEPEILNHVTLGSSSEEDQKPDTGHQQSEEK 648

>SAKL0H25564g Chr8 complement(2240089..2240982) [894 bp, 297 aa]
           {ON} weakly similar to uniprot|P18888 Saccharomyces
           cerevisiae YHL025W SNF6 Involved in global regulation of
           transcription subunit of the chromatin remodeling
           Snf/Swi complex
          Length = 297

 Score = 32.7 bits (73), Expect = 0.95
 Identities = 41/145 (28%), Positives = 67/145 (46%), Gaps = 31/145 (21%)
 Frame = +1

Query: 307 PHIYQNLGLDYDERVLPSIGNEVLKAIVAQFDA-------------------AELITQRE 429
           P+IY +  L+  ++ L S  NE L AI A+ D                     +L    E
Sbjct: 79  PNIYNSGTLESVKQRLAS-QNEELAAIRAKHDRFSLEDPSDVKFFKQKYRELCDLQGYGE 137

Query: 430 IVSQRIRKELSLR--AAEFNIRLEDVSIT----HMTFGREFTKAV------EQKQIAQQD 573
           +  Q+ + E  +R  A++FNIRL+D S+       TF R            +++Q+ +Q+
Sbjct: 138 LPQQKEKLESIVRDYASKFNIRLQDDSVVVHRDSFTFLRGDNSEAPADYWEKREQLLRQE 197

Query: 574 AERAKFLVERAEQERQAAVIRAEGE 648
            ER + L++R ++E Q   IR E E
Sbjct: 198 GER-RLLLKRQQEEEQERKIREEEE 221

>CAGL0E03289g Chr5 (303072..305162) [2091 bp, 696 aa] {ON} some
           similarities with uniprot|P39935 Saccharomyces
           cerevisiae YGR162w TIF4631 mRNA cap-binding protein or
           uniprot|P39936 Saccharomyces cerevisiae YGL049c TIF4632
          Length = 696

 Score = 32.7 bits (73), Expect = 1.2
 Identities = 25/70 (35%), Positives = 40/70 (57%), Gaps = 4/70 (5%)
 Frame = +1

Query: 493 EDVSITHMTFGREFTKAVEQ----KQIAQQDAERAKFLVERAEQERQAAVIRAEGEAESA 660
           E V  T +   R    A+EQ    KQ A++DA+RA    E+ +QE   A +RA  EA++A
Sbjct: 7   EQVRKTFIEQVRMRKAALEQAKLAKQKAEEDAKRAAEEEEKKKQEAAEAEVRAAEEAKAA 66

Query: 661 DYISKALSKA 690
           +  ++A ++A
Sbjct: 67  EAKAQAEAEA 76

>KNAG0A07470 Chr1 (1173486..1174043) [558 bp, 185 aa] {ON} Anc_3.410
           YGR082W
          Length = 185

 Score = 31.6 bits (70), Expect = 1.6
 Identities = 25/51 (49%), Positives = 35/51 (68%), Gaps = 1/51 (1%)
 Frame = +1

Query: 538 KAVEQKQIAQQDAERAKFLVERAEQERQAAVIRAEGEAE-SADYISKALSK 687
           KAV+QK++AQQDA RAK       +ER  +V +A  +AE +AD IS A+S+
Sbjct: 43  KAVKQKKLAQQDAARAK-------KERLTSV-QAFLQAELAADPISTAVSE 85

>KLTH0F18546g Chr6 (1498810..1507143) [8334 bp, 2777 aa] {ON}
           similar to uniprot|Q06179 Saccharomyces cerevisiae
           YLR454W FMP27 The authentic non-tagged protein was
           localized to the mitochondria
          Length = 2777

 Score = 32.3 bits (72), Expect = 1.8
 Identities = 24/87 (27%), Positives = 42/87 (48%)
 Frame = +1

Query: 457 LSLRAAEFNIRLEDVSITHMTFGREFTKAVEQKQIAQQDAERAKFLVERAEQERQAAVIR 636
           L L     +I+L DVSI++     + TK++E     Q+ AER++     + ++     ++
Sbjct: 188 LPLEDMSIDIKLRDVSISY----DQLTKSIE-SAYQQKAAERSEAPANESHKDHFQTNMQ 242

Query: 637 AEGEAESADYISKALSKAGDGLLLIRR 717
                ES +YI   L KA D + +  R
Sbjct: 243 PVTTGESIEYIKSLLLKASDFVTMFDR 269

>KLTH0F16500g Chr6 complement(1337865..1340381) [2517 bp, 838 aa]
           {ON} weakly similar to uniprot|P32380 Saccharomyces
           cerevisiae YDR356W SPC110 Inner plaque spindle pole body
           (SPB) component ortholog of human kendrin involved in
           connecting nuclear microtubules to SPB interacts with
           Tub4p-complex and calmodulin phosphorylated by Mps1p in
           cell cycle-dependent manner
          Length = 838

 Score = 32.0 bits (71), Expect = 2.2
 Identities = 29/119 (24%), Positives = 56/119 (47%), Gaps = 8/119 (6%)
 Frame = +1

Query: 367 NEVLKAIVAQFDAAE-LITQREIVSQRIRKELSLRAAEFNIRLEDVSITHMTFGREFTKA 543
           N  LK+ V + +AAE L+ + +   + +R ELS    E + +L+D+S+      R   + 
Sbjct: 313 NNRLKSAVREREAAEHLLKESQNALRSLRAELSTLRQESDRKLDDLSVAKEKSERVLKER 372

Query: 544 VEQK-QIAQQDAERAKFLVERAE------QERQAAVIRAEGEAESADYISKALSKAGDG 699
           +E++   +++  +RA  L + A       Q R   +   E EA     +++ +    DG
Sbjct: 373 LEERTSQSERLQQRANSLEQNAAELSSRLQLRDQRIKALEDEARELQKMNQRIQDLNDG 431

>KAFR0A08670 Chr1 complement(1738832..1739464) [633 bp, 210 aa] {ON}
           Anc_3.4 YOL146W
          Length = 210

 Score = 31.2 bits (69), Expect = 2.4
 Identities = 13/30 (43%), Positives = 18/30 (60%)
 Frame = -1

Query: 171 DKEMGTLTYHLLLNTGQPIKNHGASPTLDV 82
           DKE+  +   L+L   Q I NH +S T+DV
Sbjct: 123 DKELAAIVTELMLQRAQEINNHASSVTIDV 152

>Kwal_33.13186 s33 complement(111561..112799) [1239 bp, 412 aa] {ON}
           YCL029C (BIK1) - Microtubule-binding protein [contig
           121] FULL
          Length = 412

 Score = 31.6 bits (70), Expect = 2.5
 Identities = 32/162 (19%), Positives = 72/162 (44%), Gaps = 11/162 (6%)
 Frame = +1

Query: 319 QNLGLDYDERVLPSIGNEVLKAIVAQFDAAELITQREIVSQR--IRKELSLRAAEFNIRL 492
           QN+ +D +ER  PS  +  L+A V Q  + EL   + +VS++  + +E+     ++ ++L
Sbjct: 131 QNMEVDTEERRTPSTSSRELEARVQQ-QSQELSQYKRVVSEQRVVLEEIQPAIDDYEVKL 189

Query: 493 E----DVSITHMTFGREFTKAVEQKQIAQQDAERAKFLVER-----AEQERQAAVIRAEG 645
           +     V+       +E     +QK+  + + E+   +VE       E E++      +G
Sbjct: 190 QQMESQVTRLEAQLSKERESQRKQKEYFETEHEQLLSVVEELHTEIRENEKRMLEAPQQG 249

Query: 646 EAESADYISKALSKAGDGLLLIRRLEASKEIAQTLANSSNVT 771
           ++ S+  +   +             + + E+ + LA  + +T
Sbjct: 250 QSTSSSELQAEIEAL---------RQENSELKEQLATHATIT 282

>ADL346W Chr4 (96109..100266) [4158 bp, 1385 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBR115C (LYS2)
          Length = 1385

 Score = 31.2 bits (69), Expect = 4.0
 Identities = 18/50 (36%), Positives = 30/50 (60%), Gaps = 3/50 (6%)
 Frame = +1

Query: 1   MSKLADSLARIALPIGIAFSALQYSMYDVKGGT---RAVIFDRLSGVQQQ 141
           M   A+ L ++A+P G+AF  L+ S+ +   GT    AV FD LS ++++
Sbjct: 80  MYSKANRLLKLAVPPGVAFQQLRASVTEAVEGTLALPAVDFDELSALERE 129

>TBLA0H02740 Chr8 complement(645864..648446) [2583 bp, 860 aa] {ON}
           Anc_2.586 YKL054C
          Length = 860

 Score = 30.4 bits (67), Expect = 6.8
 Identities = 24/93 (25%), Positives = 50/93 (53%), Gaps = 4/93 (4%)
 Frame = +1

Query: 544 VEQKQIAQQDAERAKFLVERAE-QERQAAVIRAEGEAES---ADYISKALSKAGDGLLLI 711
           V+Q+Q   +  +   +  ++A+ Q +Q A I+A+ +A++   A   ++A ++      L 
Sbjct: 511 VQQQQAQAKSTQSQYYNQQQAQLQAQQQAQIQAQQQAQAQAQAQAQAQAQAQQAQQQYLA 570

Query: 712 RRLEASKEIAQTLANSSNVTYLPSNGAGGAEQQ 810
           ++   S ++A +  NS+N    P+N A  A+QQ
Sbjct: 571 QQYSQSPQVANSSINSTNS---PANAAAVAQQQ 600

>Kpol_2000.60 s2000 (119866..122967) [3102 bp, 1033 aa] {ON}
           (119866..122967) [3102 nt, 1034 aa]
          Length = 1033

 Score = 30.4 bits (67), Expect = 6.9
 Identities = 24/74 (32%), Positives = 38/74 (51%)
 Frame = +1

Query: 400 DAAELITQREIVSQRIRKELSLRAAEFNIRLEDVSITHMTFGREFTKAVEQKQIAQQDAE 579
           +A EL  +++     I K++S +  E N   EDVS   +     F ++  +K+   QDAE
Sbjct: 562 EAVELRKRQDEEILSIAKQVSQKKDETNKTNEDVSSKPLLEDSMFRQSNFKKKKTPQDAE 621

Query: 580 RAKFLVERAEQERQ 621
           R     ER E+ER+
Sbjct: 622 R-----ERVERERK 630

>KLLA0F02277g Chr6 (203211..204107) [897 bp, 298 aa] {ON} no
           similarity
          Length = 298

 Score = 30.0 bits (66), Expect = 7.0
 Identities = 24/90 (26%), Positives = 40/90 (44%), Gaps = 7/90 (7%)
 Frame = +1

Query: 79  YDVKGGTRAVIFDRLSGVQQQV------IGEGTHFLVPWLQRAIVYDVRTKP-KNIATNT 237
           + V   T ++ FD +  V   +      IG+    L   L ++I +D  T P K I++ T
Sbjct: 23  FPVSSQTHSLSFDTIRRVFNGIDSLLSEIGKNVTILENQLAKSITFDSTTLPEKEISSET 82

Query: 238 GTKDLQMVSLTLRVLHRPEVLQLPHIYQNL 327
              +LQ      +V+    +  LPH YQ +
Sbjct: 83  NFNELQEALCEFQVVLDNCIRFLPHEYQRV 112

>Kwal_47.18394 s47 (808025..808321) [297 bp, 98 aa] {OFF} [contig
           195] FULL
          Length = 98

 Score = 28.5 bits (62), Expect = 7.8
 Identities = 24/84 (28%), Positives = 42/84 (50%), Gaps = 1/84 (1%)
 Frame = -2

Query: 614 SCSA-LSTKNFALSASCWAICFCSTALVNSRPNVICVMDTSSNLMLNSAARKLSSFLIRC 438
           +CS  +STK      SC ++C+ S++ + S    + V  +SS L LNS    + S L+  
Sbjct: 8   TCSPPISTKT---GVSCSSLCWSSSSSLGSSSPSVSVCTSSSFLFLNSVCFLMFSSLLIF 64

Query: 437 DTISL*VINSAASNWATIAFSTSL 366
             +S      A+++   I +S+ L
Sbjct: 65  SALSF-----ASASSLLITYSSEL 83

>ZYRO0F03410g Chr6 (292952..295480) [2529 bp, 842 aa] {ON} some
           similarities with uniprot|Q12202 Saccharomyces
           cerevisiae YLR054C OSW2 Protein of unknown function
           proposed to be involved in the assembly of the spore
           wall
          Length = 842

 Score = 30.0 bits (66), Expect = 8.9
 Identities = 35/137 (25%), Positives = 65/137 (47%), Gaps = 5/137 (3%)
 Frame = +1

Query: 220 NIATNTGTKDLQMVSLTLRVLHRPEVLQLPHIYQNLGLDYDERVLPSIGNEVLKAIVAQF 399
           +I T+T T  L +  LT+    + +  + P   Q + +   E ++P I   +L  I  QF
Sbjct: 196 DIQTDTNTNKL-IKQLTVTKWVKVQSYKNP---QEMAVKIWEMIIPKISLNILSVIYEQF 251

Query: 400 DAAELITQR--EIVSQRIRKEL-SLRAAEFNIRLED-VSITHMTF-GREFTKAVEQKQIA 564
           D   L+  +  EIV + + KEL  +  A+ N ++E  +S T+ +    + T A++  +I 
Sbjct: 252 DYDTLLKNKSNEIVFRDLVKELFDICYAQCNAKVETFMSETNTSISSNKSTGAIDFNKIV 311

Query: 565 QQDAERAKFLVERAEQE 615
                + K L++    E
Sbjct: 312 DHCKSKRKELIKTTVNE 328

>TBLA0E04830 Chr5 (1240546..1243839) [3294 bp, 1097 aa] {ON} Anc_4.361
            YJR132W
          Length = 1097

 Score = 30.0 bits (66), Expect = 9.2
 Identities = 22/69 (31%), Positives = 34/69 (49%), Gaps = 1/69 (1%)
 Frame = +1

Query: 295  VLQLPHIYQNLGL-DYDERVLPSIGNEVLKAIVAQFDAAELITQREIVSQRIRKELSLRA 471
            +L L  +  NL + D     L ++  ++L  I+  F+   L  Q     +R RKE SL  
Sbjct: 920  LLALMSVIVNLSIGDIKTLSLDNVFLQILNVIIKLFENLPLAMQN---LERQRKEFSLDD 976

Query: 472  AEFNIRLED 498
            A+FN R +D
Sbjct: 977  ADFNTRFDD 985

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 78,391,898
Number of extensions: 1721728
Number of successful extensions: 4494
Number of sequences better than 10.0: 57
Number of HSP's gapped: 4471
Number of HSP's successfully gapped: 57
Length of query: 283
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 175
Effective length of database: 41,097,471
Effective search space: 7192057425
Effective search space used: 7192057425
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 33 (17.3 bits)