Re-run this search with the SEG filter switched on (default)

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0F02728g3.494ON28228214700.0
KLTH0F14872g3.494ON28028213220.0
Smik_6.2283.494ON28728312601e-176
Suva_7.4203.494ON28728312581e-176
Kwal_55.212403.494ON28326612571e-176
TPHA0D032903.494ON28528312541e-176
CAGL0I10472g3.494ON28828712471e-174
TDEL0D056203.494ON27928012361e-173
Kpol_1017.53.494ON28328412311e-172
YGR132C (PHB1)3.494ON28728312261e-171
NCAS0E007903.494ON32728112271e-171
Skud_7.4433.494ON28728311941e-166
NDAI0G009203.494ON29628411921e-166
TBLA0D029503.494ON28228011891e-166
ZYRO0D09900g3.494ON28328111801e-164
KAFR0C019803.494ON28327511711e-163
Ecym_12353.494ON28328311701e-163
KNAG0B007903.494ON28428411611e-161
AFR313C3.494ON28328511411e-158
KLLA0D16302g3.494ON2262149911e-136
TBLA0H022205.98ON3072317534e-99
KAFR0B042505.98ON3102387491e-98
SAKL0G15510g5.98ON3082317472e-98
ADL141W5.98ON3072347431e-97
Kwal_27.127475.98ON3072357403e-97
CAGL0L06490g5.98ON3132317379e-97
YGR231C (PHB2)5.98ON3102317371e-96
Smik_16.755.98ON3102317361e-96
TPHA0A050905.98ON3102317342e-96
KLTH0C01672g5.98ON3072317324e-96
Kpol_1050.615.98ON3102317317e-96
Suva_7.5235.98ON3102357318e-96
Skud_7.5655.98ON3102317309e-96
NCAS0F006005.98ON3132317301e-95
NDAI0D025305.98ON3162347292e-95
ZYRO0B15136g5.98ON3102317264e-95
KNAG0A015805.98ON2882317236e-95
KLLA0E15731g5.98ON3082357213e-94
TDEL0G012105.98ON3092347204e-94
KLTH0F18546g7.518ON277788750.80
KNAG0A074703.410ON18551664.6
ADL346W3.369ON138550668.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0F02728g
         (282 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0F02728g Chr6 (231020..231868) [849 bp, 282 aa] {ON} highly ...   570   0.0  
KLTH0F14872g Chr6 complement(1218390..1219232) [843 bp, 280 aa] ...   513   0.0  
Smik_6.228 Chr6 complement(373467..374330) [864 bp, 287 aa] {ON}...   489   e-176
Suva_7.420 Chr7 complement(725738..726601) [864 bp, 287 aa] {ON}...   489   e-176
Kwal_55.21240 s55 complement(745938..746789) [852 bp, 283 aa] {O...   488   e-176
TPHA0D03290 Chr4 complement(676982..677839) [858 bp, 285 aa] {ON...   487   e-176
CAGL0I10472g Chr9 (1036324..1037190) [867 bp, 288 aa] {ON} highl...   484   e-174
TDEL0D05620 Chr4 complement(1012372..1013211) [840 bp, 279 aa] {...   480   e-173
Kpol_1017.5 s1017 (19813..20664) [852 bp, 283 aa] {ON} (19813..2...   478   e-172
YGR132C Chr7 complement(755589..756452) [864 bp, 287 aa] {ON}  P...   476   e-171
NCAS0E00790 Chr5 (145987..146970) [984 bp, 327 aa] {ON} Anc_3.494     477   e-171
Skud_7.443 Chr7 complement(734799..735662) [864 bp, 287 aa] {ON}...   464   e-166
NDAI0G00920 Chr7 (192573..193463) [891 bp, 296 aa] {ON} Anc_3.494     463   e-166
TBLA0D02950 Chr4 (720856..721704) [849 bp, 282 aa] {ON} Anc_3.49...   462   e-166
ZYRO0D09900g Chr4 (835139..835990) [852 bp, 283 aa] {ON} similar...   459   e-164
KAFR0C01980 Chr3 complement(394370..395221) [852 bp, 283 aa] {ON...   455   e-163
Ecym_1235 Chr1 (483393..484244) [852 bp, 283 aa] {ON} similar to...   455   e-163
KNAG0B00790 Chr2 (146405..147259) [855 bp, 284 aa] {ON} Anc_3.49...   451   e-161
AFR313C Chr6 complement(1005181..1006032) [852 bp, 283 aa] {ON} ...   444   e-158
KLLA0D16302g Chr4 complement(1372447..1373127) [681 bp, 226 aa] ...   386   e-136
TBLA0H02220 Chr8 (537650..538573) [924 bp, 307 aa] {ON} Anc_5.98...   294   4e-99
KAFR0B04250 Chr2 complement(882694..883626) [933 bp, 310 aa] {ON...   293   1e-98
SAKL0G15510g Chr7 complement(1334598..1335524) [927 bp, 308 aa] ...   292   2e-98
ADL141W Chr4 (444592..445515) [924 bp, 307 aa] {ON} Syntenic hom...   290   1e-97
Kwal_27.12747 s27 complement(1358872..1359795) [924 bp, 307 aa] ...   289   3e-97
CAGL0L06490g Chr12 (735080..736021) [942 bp, 313 aa] {ON} highly...   288   9e-97
YGR231C Chr7 complement(952548..953480) [933 bp, 310 aa] {ON}  P...   288   1e-96
Smik_16.75 Chr16 (143216..144148) [933 bp, 310 aa] {ON} YGR231C ...   288   1e-96
TPHA0A05090 Chr1 complement(1146837..1147769) [933 bp, 310 aa] {...   287   2e-96
KLTH0C01672g Chr3 (147893..148816) [924 bp, 307 aa] {ON} highly ...   286   4e-96
Kpol_1050.61 s1050 complement(135758..136690) [933 bp, 310 aa] {...   286   7e-96
Suva_7.523 Chr7 complement(907005..907937) [933 bp, 310 aa] {ON}...   286   8e-96
Skud_7.565 Chr7 complement(927426..928358) [933 bp, 310 aa] {ON}...   285   9e-96
NCAS0F00600 Chr6 (117964..118905) [942 bp, 313 aa] {ON} Anc_5.98...   285   1e-95
NDAI0D02530 Chr4 complement(583429..584379) [951 bp, 316 aa] {ON...   285   2e-95
ZYRO0B15136g Chr2 (1233955..1234887) [933 bp, 310 aa] {ON} simil...   284   4e-95
KNAG0A01580 Chr1 (79208..80074) [867 bp, 288 aa] {ON} Anc_5.98 Y...   283   6e-95
KLLA0E15731g Chr5 (1407793..1408719) [927 bp, 308 aa] {ON} simil...   282   3e-94
TDEL0G01210 Chr7 (248098..249027) [930 bp, 309 aa] {ON} Anc_5.98...   281   4e-94
KLTH0F18546g Chr6 (1498810..1507143) [8334 bp, 2777 aa] {ON} sim...    33   0.80 
KNAG0A07470 Chr1 (1173486..1174043) [558 bp, 185 aa] {ON} Anc_3....    30   4.6  
ADL346W Chr4 (96109..100266) [4158 bp, 1385 aa] {ON} Syntenic ho...    30   8.2  

>SAKL0F02728g Chr6 (231020..231868) [849 bp, 282 aa] {ON} highly
           similar to uniprot|P40961 Saccharomyces cerevisiae
           YGR132C
          Length = 282

 Score =  570 bits (1470), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/282 (100%), Positives = 282/282 (100%)

Query: 1   MSKLADSLARIALPIGIAFSALQYSMYDVKGGTRAVIFDRLSGVQQQVIGEGTHFLVPWL 60
           MSKLADSLARIALPIGIAFSALQYSMYDVKGGTRAVIFDRLSGVQQQVIGEGTHFLVPWL
Sbjct: 1   MSKLADSLARIALPIGIAFSALQYSMYDVKGGTRAVIFDRLSGVQQQVIGEGTHFLVPWL 60

Query: 61  QRAIVYDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPEVLQLPHIYQNLGLDYDERVLPS 120
           QRAIVYDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPEVLQLPHIYQNLGLDYDERVLPS
Sbjct: 61  QRAIVYDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPEVLQLPHIYQNLGLDYDERVLPS 120

Query: 121 IGNEVLKAIVAQFDAAELITQREIVSQRIRKELSLRAAEFNIRLEDVSITHMTFGREFTK 180
           IGNEVLKAIVAQFDAAELITQREIVSQRIRKELSLRAAEFNIRLEDVSITHMTFGREFTK
Sbjct: 121 IGNEVLKAIVAQFDAAELITQREIVSQRIRKELSLRAAEFNIRLEDVSITHMTFGREFTK 180

Query: 181 AVEQKQIAQQDAERAKFLVERAEQERQAAVIRAEGEAESADYISKALSKAGDGLLLIRRL 240
           AVEQKQIAQQDAERAKFLVERAEQERQAAVIRAEGEAESADYISKALSKAGDGLLLIRRL
Sbjct: 181 AVEQKQIAQQDAERAKFLVERAEQERQAAVIRAEGEAESADYISKALSKAGDGLLLIRRL 240

Query: 241 EASKEIAQTLANSSNVTYLPSNGAGGAEQQGSPNSLLLNLGR 282
           EASKEIAQTLANSSNVTYLPSNGAGGAEQQGSPNSLLLNLGR
Sbjct: 241 EASKEIAQTLANSSNVTYLPSNGAGGAEQQGSPNSLLLNLGR 282

>KLTH0F14872g Chr6 complement(1218390..1219232) [843 bp, 280 aa]
           {ON} highly similar to uniprot|P40961 Saccharomyces
           cerevisiae YGR132C
          Length = 280

 Score =  513 bits (1322), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 249/282 (88%), Positives = 274/282 (97%), Gaps = 2/282 (0%)

Query: 1   MSKLADSLARIALPIGIAFSALQYSMYDVKGGTRAVIFDRLSGVQQQVIGEGTHFLVPWL 60
           MS+LADSLA+IALP+G+A SALQYSMYDVKGG+RAVIFDRLSGVQQQV+GEGTHFLVPWL
Sbjct: 1   MSRLADSLAKIALPLGLAASALQYSMYDVKGGSRAVIFDRLSGVQQQVVGEGTHFLVPWL 60

Query: 61  QRAIVYDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPEVLQLPHIYQNLGLDYDERVLPS 120
           Q+A++YDVRTKPKNIATNTGTKDLQMVSLTLRVLHRP+V++LP IYQNLGLDYDERVLPS
Sbjct: 61  QKAVLYDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPDVMKLPTIYQNLGLDYDERVLPS 120

Query: 121 IGNEVLKAIVAQFDAAELITQREIVSQRIRKELSLRAAEFNIRLEDVSITHMTFGREFTK 180
           IGNEVLKAIVAQFDAAELITQRE VSQRIR+ELSLRA+EFNIRLEDVSITHMTFGREFTK
Sbjct: 121 IGNEVLKAIVAQFDAAELITQRETVSQRIRQELSLRASEFNIRLEDVSITHMTFGREFTK 180

Query: 181 AVEQKQIAQQDAERAKFLVERAEQERQAAVIRAEGEAESADYISKALSKAGDGLLLIRRL 240
           AVEQKQIAQQDAERA+++VE AEQERQA+VIRAEGEAESA+YISKAL+KAGDGLLLIRR+
Sbjct: 181 AVEQKQIAQQDAERARYVVELAEQERQASVIRAEGEAESAEYISKALAKAGDGLLLIRRI 240

Query: 241 EASKEIAQTLANSSNVTYLPSNGAGGAEQQGSPNSLLLNLGR 282
           EASKEIA+TLANSSNVTYLPS+ +  A +QGSPNSLLLNLGR
Sbjct: 241 EASKEIAKTLANSSNVTYLPSSHS--ASEQGSPNSLLLNLGR 280

>Smik_6.228 Chr6 complement(373467..374330) [864 bp, 287 aa] {ON}
           YGR132C (REAL)
          Length = 287

 Score =  489 bits (1260), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 236/283 (83%), Positives = 263/283 (92%), Gaps = 2/283 (0%)

Query: 2   SKLADSLARIALPIGIAFSALQYSMYDVKGGTRAVIFDRLSGVQQQVIGEGTHFLVPWLQ 61
           S+L D + ++ALPIGI  S +QYSMYDVKGG+R VIFDR++GV+QQV+GEGTHFLVPWLQ
Sbjct: 5   SRLIDIITKVALPIGIVASGIQYSMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWLQ 64

Query: 62  RAIVYDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPEVLQLPHIYQNLGLDYDERVLPSI 121
           +AI+YDVRTKPK+IATNTGT+DLQMVSLTLRVLHRPEVLQLP IYQNLGLDYDERVLPSI
Sbjct: 65  KAIIYDVRTKPKSIATNTGTRDLQMVSLTLRVLHRPEVLQLPAIYQNLGLDYDERVLPSI 124

Query: 122 GNEVLKAIVAQFDAAELITQREIVSQRIRKELSLRAAEFNIRLEDVSITHMTFGREFTKA 181
           GNEVLK+IVAQFDAAELITQREI+SQ+IRKELS RA EF I+LEDVSITHMTFG EFTKA
Sbjct: 125 GNEVLKSIVAQFDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTKA 184

Query: 182 VEQKQIAQQDAERAKFLVERAEQERQAAVIRAEGEAESADYISKALSKAGDGLLLIRRLE 241
           VEQKQIAQQDAERAKFLVE+AEQERQA+VIRAEGEAESA++ISKAL+K GDGLLLIRRLE
Sbjct: 185 VEQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRLE 244

Query: 242 ASKEIAQTLANSSNVTYLPS--NGAGGAEQQGSPNSLLLNLGR 282
           ASK+IAQTLANSSNV YLPS  +G G +E  GSPNSLLLN+GR
Sbjct: 245 ASKDIAQTLANSSNVVYLPSQHSGNGNSESSGSPNSLLLNIGR 287

>Suva_7.420 Chr7 complement(725738..726601) [864 bp, 287 aa] {ON}
           YGR132C (REAL)
          Length = 287

 Score =  489 bits (1258), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 235/283 (83%), Positives = 262/283 (92%), Gaps = 2/283 (0%)

Query: 2   SKLADSLARIALPIGIAFSALQYSMYDVKGGTRAVIFDRLSGVQQQVIGEGTHFLVPWLQ 61
           S+  D + ++ALPIG+  S LQYSMYDVKGG+R VIFDR++GV+QQV+GEGTHFLVPWLQ
Sbjct: 5   SRFIDIITKVALPIGLVASGLQYSMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWLQ 64

Query: 62  RAIVYDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPEVLQLPHIYQNLGLDYDERVLPSI 121
           +AI+YDVRTKPK+IATNTGT+DLQMVSLTLRVLHRPEVLQLP IYQNLGLDYDERVLPSI
Sbjct: 65  KAIIYDVRTKPKSIATNTGTRDLQMVSLTLRVLHRPEVLQLPSIYQNLGLDYDERVLPSI 124

Query: 122 GNEVLKAIVAQFDAAELITQREIVSQRIRKELSLRAAEFNIRLEDVSITHMTFGREFTKA 181
           GNEVLK+IVAQFDAAELITQREI+SQ+IRKELS RA EF I+LEDVSITHMTFG EFTKA
Sbjct: 125 GNEVLKSIVAQFDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTKA 184

Query: 182 VEQKQIAQQDAERAKFLVERAEQERQAAVIRAEGEAESADYISKALSKAGDGLLLIRRLE 241
           VEQKQIAQQDAERAKF+VE+AEQERQA+VIRAEGEAESA+YISKAL+K GDGLLLIRRLE
Sbjct: 185 VEQKQIAQQDAERAKFIVEKAEQERQASVIRAEGEAESAEYISKALAKVGDGLLLIRRLE 244

Query: 242 ASKEIAQTLANSSNVTYLPSN--GAGGAEQQGSPNSLLLNLGR 282
           ASK+IAQTLANSSNV YLPS   G+G +E  GSPNSLLLN+GR
Sbjct: 245 ASKDIAQTLANSSNVIYLPSQHAGSGNSEYSGSPNSLLLNIGR 287

>Kwal_55.21240 s55 complement(745938..746789) [852 bp, 283 aa] {ON}
           YGR132C (PHB1) - mitochondrial protein, prohibitin
           homolog; similar to S. cerevisiae Phb2p [contig 130]
           FULL
          Length = 283

 Score =  488 bits (1257), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 233/266 (87%), Positives = 258/266 (96%)

Query: 1   MSKLADSLARIALPIGIAFSALQYSMYDVKGGTRAVIFDRLSGVQQQVIGEGTHFLVPWL 60
           MS+ ADSLA+IALP+G+A SALQYSMYDVKGG+RAVIFDRLSGVQQQV+GEGTHFL+PWL
Sbjct: 1   MSRFADSLAKIALPLGLAASALQYSMYDVKGGSRAVIFDRLSGVQQQVVGEGTHFLIPWL 60

Query: 61  QRAIVYDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPEVLQLPHIYQNLGLDYDERVLPS 120
           Q+A+++DVRTKPKNIATNTGTKDLQMVSLTLRVLHRP+V++LP IYQNLGLDYDERVLPS
Sbjct: 61  QKAVLFDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPDVMKLPGIYQNLGLDYDERVLPS 120

Query: 121 IGNEVLKAIVAQFDAAELITQREIVSQRIRKELSLRAAEFNIRLEDVSITHMTFGREFTK 180
           IGNEVLK+IVAQFDAAELITQRE VSQRIR+ELSLRA+EFNIRLEDVSITHMTFGR+FTK
Sbjct: 121 IGNEVLKSIVAQFDAAELITQRETVSQRIRQELSLRASEFNIRLEDVSITHMTFGRDFTK 180

Query: 181 AVEQKQIAQQDAERAKFLVERAEQERQAAVIRAEGEAESADYISKALSKAGDGLLLIRRL 240
           AVEQKQIAQQDAERA+F+VE AEQERQA+VIRAEGEAESA+YISKAL+KAGDGLLLIRR+
Sbjct: 181 AVEQKQIAQQDAERARFVVELAEQERQASVIRAEGEAESAEYISKALAKAGDGLLLIRRI 240

Query: 241 EASKEIAQTLANSSNVTYLPSNGAGG 266
           EASKEIA+TLANSSNVTYLPSN  G 
Sbjct: 241 EASKEIAKTLANSSNVTYLPSNQQGA 266

>TPHA0D03290 Chr4 complement(676982..677839) [858 bp, 285 aa] {ON}
           Anc_3.494 YGR132C
          Length = 285

 Score =  487 bits (1254), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 238/283 (84%), Positives = 263/283 (92%), Gaps = 2/283 (0%)

Query: 2   SKLADSLARIALPIGIAFSALQYSMYDVKGGTRAVIFDRLSGVQQQVIGEGTHFLVPWLQ 61
           +K+ D L +IA+P+GIA S +QY+MYDVKGG+RAVIFDRLSGV+QQVIGEGTHFL PWLQ
Sbjct: 3   TKVLDRLIKIAVPLGIAVSGIQYAMYDVKGGSRAVIFDRLSGVKQQVIGEGTHFLFPWLQ 62

Query: 62  RAIVYDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPEVLQLPHIYQNLGLDYDERVLPSI 121
           +AIV+DVRTKPK+IATNTGTKDLQMVSLTLRVLHRP+V QLP IYQNLGLDYDERVLPSI
Sbjct: 63  KAIVFDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPDVQQLPTIYQNLGLDYDERVLPSI 122

Query: 122 GNEVLKAIVAQFDAAELITQREIVSQRIRKELSLRAAEFNIRLEDVSITHMTFGREFTKA 181
           GNEVLKAIVAQFDAAELITQREIVS +IR+ELS+R+ EF I+LEDVSITHMTFG+EFTKA
Sbjct: 123 GNEVLKAIVAQFDAAELITQREIVSNKIREELSIRSNEFGIKLEDVSITHMTFGQEFTKA 182

Query: 182 VEQKQIAQQDAERAKFLVERAEQERQAAVIRAEGEAESADYISKALSKAGDGLLLIRRLE 241
           VEQKQIAQQDAERAKFLVERAEQERQAAVIRAEGEAESA+YISKAL+KAGDGLLLIRRLE
Sbjct: 183 VEQKQIAQQDAERAKFLVERAEQERQAAVIRAEGEAESAEYISKALAKAGDGLLLIRRLE 242

Query: 242 ASKEIAQTLANSSNVTYLPSNGA--GGAEQQGSPNSLLLNLGR 282
           ASKEIA+TL+ SSNVTYLPS  +  G  E  G+PNSLLLNLGR
Sbjct: 243 ASKEIAKTLSQSSNVTYLPSGSSSNGNNESAGTPNSLLLNLGR 285

>CAGL0I10472g Chr9 (1036324..1037190) [867 bp, 288 aa] {ON} highly
           similar to uniprot|P40961 Saccharomyces cerevisiae
           YGR132c prohibitin antiproliferative protein
          Length = 288

 Score =  484 bits (1247), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 237/287 (82%), Positives = 264/287 (91%), Gaps = 5/287 (1%)

Query: 1   MSKLADSLAR----IALPIGIAFSALQYSMYDVKGGTRAVIFDRLSGVQQQVIGEGTHFL 56
           MS+ A++  R    +A+P+GIA S LQYSMYDV+GG+R VIFDRL GV+  V+GEGTHFL
Sbjct: 1   MSQQANNFVRLITKVAIPVGIAVSGLQYSMYDVQGGSRGVIFDRLQGVKSDVVGEGTHFL 60

Query: 57  VPWLQRAIVYDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPEVLQLPHIYQNLGLDYDER 116
           VPWLQ+AI+YDVRTKPK+IATNTGTKDLQMVSLTLRVLHRP+V+QLP IYQNLGLDYDER
Sbjct: 61  VPWLQKAIIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPDVMQLPLIYQNLGLDYDER 120

Query: 117 VLPSIGNEVLKAIVAQFDAAELITQREIVSQRIRKELSLRAAEFNIRLEDVSITHMTFGR 176
           VLPSIGNEVLK+IVAQFDAAELITQREIVSQ+IR+ELS RA EF IRLEDVSITHMTFG 
Sbjct: 121 VLPSIGNEVLKSIVAQFDAAELITQREIVSQKIRQELSNRANEFGIRLEDVSITHMTFGP 180

Query: 177 EFTKAVEQKQIAQQDAERAKFLVERAEQERQAAVIRAEGEAESADYISKALSKAGDGLLL 236
           EFTKAVEQKQIAQQDAERA+FLVE+AEQERQA+VIRAEGEAESA+YISKALSK GDGLLL
Sbjct: 181 EFTKAVEQKQIAQQDAERARFLVEKAEQERQASVIRAEGEAESAEYISKALSKVGDGLLL 240

Query: 237 IRRLEASKEIAQTLANSSNVTYLPSNGAGG-AEQQGSPNSLLLNLGR 282
           IRRLEASKEIAQTLANS+N+TYLPSN AGG  + +GSPN+LLLNLGR
Sbjct: 241 IRRLEASKEIAQTLANSNNITYLPSNHAGGDKDDKGSPNTLLLNLGR 287

>TDEL0D05620 Chr4 complement(1012372..1013211) [840 bp, 279 aa] {ON}
           Anc_3.494 YGR132C
          Length = 279

 Score =  480 bits (1236), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 234/280 (83%), Positives = 259/280 (92%), Gaps = 2/280 (0%)

Query: 1   MSKLADSLARIALPIGIAFSALQYSMYDVKGGTRAVIFDRLSGVQQQVIGEGTHFLVPWL 60
           MS+L ++LAR+A+P+GI  S +QYSMYDV+GG+RAVIFDRLSGVQ+QV+GEGTHFLVPWL
Sbjct: 1   MSRLVENLARVAIPLGIVVSGVQYSMYDVRGGSRAVIFDRLSGVQKQVVGEGTHFLVPWL 60

Query: 61  QRAIVYDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPEVLQLPHIYQNLGLDYDERVLPS 120
           Q+AIVYD+RTKPK IATNTGTKD+QMVSLTLRVLHRP+VLQLP IYQNLGLDYDERVLPS
Sbjct: 61  QKAIVYDIRTKPKGIATNTGTKDMQMVSLTLRVLHRPDVLQLPRIYQNLGLDYDERVLPS 120

Query: 121 IGNEVLKAIVAQFDAAELITQREIVSQRIRKELSLRAAEFNIRLEDVSITHMTFGREFTK 180
           IGNEVLKAIVAQFDAAELITQRE+VSQRIR ELS RA+EF IRLEDVSITHMTFG EFTK
Sbjct: 121 IGNEVLKAIVAQFDAAELITQRELVSQRIRDELSHRASEFGIRLEDVSITHMTFGPEFTK 180

Query: 181 AVEQKQIAQQDAERAKFLVERAEQERQAAVIRAEGEAESADYISKALSKAGDGLLLIRRL 240
           AVEQKQIAQQDAERAKFLVE+AEQ R+A+VIRAEGEAESA+YISKAL++AGDGLLLIRRL
Sbjct: 181 AVEQKQIAQQDAERAKFLVEKAEQVRKASVIRAEGEAESAEYISKALARAGDGLLLIRRL 240

Query: 241 EASKEIAQTLANSSNVTYLPSNGAGGAEQQGSPNSLLLNL 280
           EASKEIAQTLA SSN+TYLP    G  E  GS NSLLLN+
Sbjct: 241 EASKEIAQTLAASSNITYLPGKAHGNTE--GSQNSLLLNI 278

>Kpol_1017.5 s1017 (19813..20664) [852 bp, 283 aa] {ON}
           (19813..20664) [852 nt, 284 aa]
          Length = 283

 Score =  478 bits (1231), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 234/284 (82%), Positives = 258/284 (90%), Gaps = 3/284 (1%)

Query: 1   MSKLADSLARIALPIGIAFSALQYSMYDVKGGTRAVIFDRLSGVQQQVIGEGTHFLVPWL 60
           MSK+ D++A++ALPIGI  S +Q+SMYDVKGG+RAVIFDR+SGV+Q +IGEGTHFL+PWL
Sbjct: 1   MSKIIDTVAKVALPIGIVVSGIQFSMYDVKGGSRAVIFDRISGVKQNIIGEGTHFLIPWL 60

Query: 61  QRAIVYDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPEVLQLPHIYQNLGLDYDERVLPS 120
           Q+AI+YDVRTKPK+IATNTGTKDLQMVSLTLRVLHRP+V+QLP IYQNLGLDYDERVLPS
Sbjct: 61  QKAIIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPDVVQLPTIYQNLGLDYDERVLPS 120

Query: 121 IGNEVLKAIVAQFDAAELITQREIVSQRIRKELSLRAAEFNIRLEDVSITHMTFGREFTK 180
           I NEVLKAIVAQFDAAELITQRE+VS RIR EL  R+ EF IRLEDVSITHMTFG EFTK
Sbjct: 121 ISNEVLKAIVAQFDAAELITQREVVSDRIRAELGRRSNEFGIRLEDVSITHMTFGNEFTK 180

Query: 181 AVEQKQIAQQDAERAKFLVERAEQERQAAVIRAEGEAESADYISKALSKAGDGLLLIRRL 240
           AVE KQIAQQDAERAKFLVE+AEQERQAAVIRAEGEAESA+YISKAL KAGDGLLLIRRL
Sbjct: 181 AVELKQIAQQDAERAKFLVEKAEQERQAAVIRAEGEAESAEYISKALDKAGDGLLLIRRL 240

Query: 241 EASKEIAQTLANSSNVTYLPSNGAGGAE--QQGSPNSLLLNLGR 282
           EASKEIA TL+ SSNVTYLP NG G A     G+PN+LLLNLGR
Sbjct: 241 EASKEIAATLSQSSNVTYLP-NGHGNARGGSDGTPNTLLLNLGR 283

>YGR132C Chr7 complement(755589..756452) [864 bp, 287 aa] {ON}
           PHB1Subunit of the prohibitin complex (Phb1p-Phb2p), a
           1.2 MDa ring-shaped inner mitochondrial membrane
           chaperone that stabilizes newly synthesized proteins;
           determinant of replicative life span; involved in
           mitochondrial segregation
          Length = 287

 Score =  476 bits (1226), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 237/283 (83%), Positives = 262/283 (92%), Gaps = 2/283 (0%)

Query: 2   SKLADSLARIALPIGIAFSALQYSMYDVKGGTRAVIFDRLSGVQQQVIGEGTHFLVPWLQ 61
           +KL D + ++ALPIGI  S +QYSMYDVKGG+R VIFDR++GV+QQV+GEGTHFLVPWLQ
Sbjct: 5   AKLIDVITKVALPIGIIASGIQYSMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWLQ 64

Query: 62  RAIVYDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPEVLQLPHIYQNLGLDYDERVLPSI 121
           +AI+YDVRTKPK+IATNTGTKDLQMVSLTLRVLHRPEVLQLP IYQNLGLDYDERVLPSI
Sbjct: 65  KAIIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPEVLQLPAIYQNLGLDYDERVLPSI 124

Query: 122 GNEVLKAIVAQFDAAELITQREIVSQRIRKELSLRAAEFNIRLEDVSITHMTFGREFTKA 181
           GNEVLK+IVAQFDAAELITQREI+SQ+IRKELS RA EF I+LEDVSITHMTFG EFTKA
Sbjct: 125 GNEVLKSIVAQFDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTKA 184

Query: 182 VEQKQIAQQDAERAKFLVERAEQERQAAVIRAEGEAESADYISKALSKAGDGLLLIRRLE 241
           VEQKQIAQQDAERAKFLVE+AEQERQA+VIRAEGEAESA++ISKAL+K GDGLLLIRRLE
Sbjct: 185 VEQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRLE 244

Query: 242 ASKEIAQTLANSSNVTYLPSN--GAGGAEQQGSPNSLLLNLGR 282
           ASK+IAQTLANSSNV YLPS   G G +E  GSPNSLLLN+GR
Sbjct: 245 ASKDIAQTLANSSNVVYLPSQHSGGGNSESSGSPNSLLLNIGR 287

>NCAS0E00790 Chr5 (145987..146970) [984 bp, 327 aa] {ON} Anc_3.494
          Length = 327

 Score =  477 bits (1227), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 229/281 (81%), Positives = 255/281 (90%)

Query: 2   SKLADSLARIALPIGIAFSALQYSMYDVKGGTRAVIFDRLSGVQQQVIGEGTHFLVPWLQ 61
           +KL + + R+ALP+GI  + L+YSMYDVKGG+R VIFDRLSGVQ++VIGEGTHFLVPWLQ
Sbjct: 47  TKLLNVITRVALPLGILATGLEYSMYDVKGGSRGVIFDRLSGVQKRVIGEGTHFLVPWLQ 106

Query: 62  RAIVYDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPEVLQLPHIYQNLGLDYDERVLPSI 121
           +A++YDVRTKPK+IATNTGTKDLQMVSLTLRVLHRP + +LP IYQNLGLDYDE+VLPSI
Sbjct: 107 KAVIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPNIRELPKIYQNLGLDYDEKVLPSI 166

Query: 122 GNEVLKAIVAQFDAAELITQREIVSQRIRKELSLRAAEFNIRLEDVSITHMTFGREFTKA 181
           GNEVLK+IVAQFDAAELITQREIVSQRI+ ELS RA EF IRLEDVSITHMTFG EFTKA
Sbjct: 167 GNEVLKSIVAQFDAAELITQREIVSQRIKSELSTRADEFGIRLEDVSITHMTFGPEFTKA 226

Query: 182 VEQKQIAQQDAERAKFLVERAEQERQAAVIRAEGEAESADYISKALSKAGDGLLLIRRLE 241
           VEQKQIAQQDAERAKFLVE+AEQERQA+VIRAEGEAESA+YISKAL+K GDGLLLIRRLE
Sbjct: 227 VEQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEYISKALAKVGDGLLLIRRLE 286

Query: 242 ASKEIAQTLANSSNVTYLPSNGAGGAEQQGSPNSLLLNLGR 282
           ASK+IAQTLANS N+TYLP    G     GSPNSLLLN+GR
Sbjct: 287 ASKDIAQTLANSPNITYLPGQQGGRGNDSGSPNSLLLNIGR 327

>Skud_7.443 Chr7 complement(734799..735662) [864 bp, 287 aa] {ON}
           YGR132C (REAL)
          Length = 287

 Score =  464 bits (1194), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 233/283 (82%), Positives = 261/283 (92%), Gaps = 2/283 (0%)

Query: 2   SKLADSLARIALPIGIAFSALQYSMYDVKGGTRAVIFDRLSGVQQQVIGEGTHFLVPWLQ 61
           S+L D + ++ALPIGI  + +QY+MYDVKGG+R VIFDR++GV+QQV+GEGTHFLVPWLQ
Sbjct: 5   SRLIDVITKVALPIGIIATGIQYTMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWLQ 64

Query: 62  RAIVYDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPEVLQLPHIYQNLGLDYDERVLPSI 121
           +AI+YDVRTKPK+IATNTGT+DLQMVSLTLRVLHRPEVLQLP IYQNLGLDYDERVLPSI
Sbjct: 65  KAIIYDVRTKPKSIATNTGTRDLQMVSLTLRVLHRPEVLQLPSIYQNLGLDYDERVLPSI 124

Query: 122 GNEVLKAIVAQFDAAELITQREIVSQRIRKELSLRAAEFNIRLEDVSITHMTFGREFTKA 181
           GNEVLK+IVAQFDAAELITQREI+SQ+IRKELS RA EF I+LEDVSITHMTFG EFTKA
Sbjct: 125 GNEVLKSIVAQFDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTKA 184

Query: 182 VEQKQIAQQDAERAKFLVERAEQERQAAVIRAEGEAESADYISKALSKAGDGLLLIRRLE 241
           VEQKQIAQQDAERAKFLVE+AEQERQA+VIRAEGEAESA++ISKAL+K GDGLLLIRRLE
Sbjct: 185 VEQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRLE 244

Query: 242 ASKEIAQTLANSSNVTYLPSN--GAGGAEQQGSPNSLLLNLGR 282
           ASK+IAQTLANSSNV YLPS   G G  +  GSPNSLLLN+GR
Sbjct: 245 ASKDIAQTLANSSNVVYLPSQHSGNGSGDSSGSPNSLLLNIGR 287

>NDAI0G00920 Chr7 (192573..193463) [891 bp, 296 aa] {ON} Anc_3.494
          Length = 296

 Score =  463 bits (1192), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 225/284 (79%), Positives = 253/284 (89%), Gaps = 4/284 (1%)

Query: 3   KLADSLARIALPIGIAFSALQYSMYDVKGGTRAVIFDRLSGVQQQVIGEGTHFLVPWLQR 62
           K  + L ++ALPIG+  + + YSMYDVKGG+R VIFDRLSGV+  V+GEGTHFLVPWLQ+
Sbjct: 13  KFFNLLTKVALPIGLLVTGVDYSMYDVKGGSRGVIFDRLSGVKSTVVGEGTHFLVPWLQK 72

Query: 63  AIVYDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPEVLQLPHIYQNLGLDYDERVLPSIG 122
           A++YDVRTKPK+IATNTGTKDLQMVSLTLRVLHRP V +LP IYQNLGLDYDE+VLPSIG
Sbjct: 73  AVIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPNVNELPKIYQNLGLDYDEKVLPSIG 132

Query: 123 NEVLKAIVAQFDAAELITQREIVSQRIRKELSLRAAEFNIRLEDVSITHMTFGREFTKAV 182
           NEVLK+IVAQFDAAELITQREIVSQRI+ ELS+RA EF +RLEDVSITHMTFG EFTKAV
Sbjct: 133 NEVLKSIVAQFDAAELITQREIVSQRIKSELSMRANEFGLRLEDVSITHMTFGPEFTKAV 192

Query: 183 EQKQIAQQDAERAKFLVERAEQERQAAVIRAEGEAESADYISKALSKAGDGLLLIRRLEA 242
           EQKQIAQQDAERAKFLVE+AEQERQA+VIRAEGEAESA++ISKAL+K GDGLLLIRRLEA
Sbjct: 193 EQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRLEA 252

Query: 243 SKEIAQTLANSSNVTYLPS----NGAGGAEQQGSPNSLLLNLGR 282
           SK+IAQTLANS NVTYLP     +G+G      SPNSLLLN+GR
Sbjct: 253 SKDIAQTLANSPNVTYLPGQNRHSGSGTDGGNSSPNSLLLNIGR 296

>TBLA0D02950 Chr4 (720856..721704) [849 bp, 282 aa] {ON} Anc_3.494
           YGR132C
          Length = 282

 Score =  462 bits (1189), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 222/280 (79%), Positives = 253/280 (90%), Gaps = 2/280 (0%)

Query: 3   KLADSLARIALPIGIAFSALQYSMYDVKGGTRAVIFDRLSGVQQQVIGEGTHFLVPWLQR 62
           K+A+ LA+IA+P+G+  S + YSMYDVKGG+RAVIFDR+ GV+Q V+GEGTHFLVPWLQ+
Sbjct: 5   KIAEKLAKIAIPLGVCVSFMDYSMYDVKGGSRAVIFDRIQGVKQAVVGEGTHFLVPWLQK 64

Query: 63  AIVYDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPEVLQLPHIYQNLGLDYDERVLPSIG 122
           ++++D+RTKPKNI TNTGT+DLQMVSLTLR+LHRP+++QLP IYQNLGLDYDERVLPSIG
Sbjct: 65  SVIFDIRTKPKNITTNTGTRDLQMVSLTLRLLHRPDIVQLPMIYQNLGLDYDERVLPSIG 124

Query: 123 NEVLKAIVAQFDAAELITQREIVSQRIRKELSLRAAEFNIRLEDVSITHMTFGREFTKAV 182
           NEVLK+IVAQFDAAELITQREIVSQRIRKEL+ RA EF IRLEDVSITHMTFG EFTKAV
Sbjct: 125 NEVLKSIVAQFDAAELITQREIVSQRIRKELNHRANEFGIRLEDVSITHMTFGPEFTKAV 184

Query: 183 EQKQIAQQDAERAKFLVERAEQERQAAVIRAEGEAESADYISKALSKAGDGLLLIRRLEA 242
           EQKQIAQQDAERAKFLVE+AEQERQA+VIRAEGEAESA+ IS+AL KAGDGLLLIRRLE 
Sbjct: 185 EQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEVISRALQKAGDGLLLIRRLET 244

Query: 243 SKEIAQTLANSSNVTYLPSNGAGGAEQQGSPNSLLLNLGR 282
           SKEIA+TLA S +VTYLP  G G   +  S NSLLLNLGR
Sbjct: 245 SKEIAETLAGSPHVTYLP--GGGNQAEDASKNSLLLNLGR 282

>ZYRO0D09900g Chr4 (835139..835990) [852 bp, 283 aa] {ON} similar to
           uniprot|P40961 Saccharomyces cerevisiae YGR132C
          Length = 283

 Score =  459 bits (1180), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 229/281 (81%), Positives = 263/281 (93%), Gaps = 1/281 (0%)

Query: 2   SKLADSLARIALPIGIAFSALQYSMYDVKGGTRAVIFDRLSGVQQQVIGEGTHFLVPWLQ 61
           S+LA+++A++A+P+GI  S +QYSMYDV+GG+RAVIFDRLSGVQQ+V+GEGTHFLVPWLQ
Sbjct: 3   SRLAETVAKVAIPLGIVASGIQYSMYDVRGGSRAVIFDRLSGVQQEVVGEGTHFLVPWLQ 62

Query: 62  RAIVYDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPEVLQLPHIYQNLGLDYDERVLPSI 121
           +A++YDVRTKPK+IATNTGTKD+QMVSLTLRVLHRP+VLQLPHIYQNLGLDYDERVLPSI
Sbjct: 63  KAVIYDVRTKPKSIATNTGTKDMQMVSLTLRVLHRPQVLQLPHIYQNLGLDYDERVLPSI 122

Query: 122 GNEVLKAIVAQFDAAELITQREIVSQRIRKELSLRAAEFNIRLEDVSITHMTFGREFTKA 181
           GNEVLKAIVA++DAAELITQRE+VS  IR ELS RA+EF+IRLEDVSITHMTFG EFTKA
Sbjct: 123 GNEVLKAIVARYDAAELITQRELVSNTIRDELSNRASEFSIRLEDVSITHMTFGPEFTKA 182

Query: 182 VEQKQIAQQDAERAKFLVERAEQERQAAVIRAEGEAESADYISKALSKAGDGLLLIRRLE 241
           VE KQIAQQDAERAKFLVE+AEQ R+ +VIRAEGEAE+A+ ISKAL+KAGDGLLLIRRLE
Sbjct: 183 VELKQIAQQDAERAKFLVEKAEQIRKVSVIRAEGEAEAAESISKALAKAGDGLLLIRRLE 242

Query: 242 ASKEIAQTLANSSNVTYLPSNGAGGAEQQGSPNSLLLNLGR 282
           ASK+IAQTLANSSNVTYLPS  +GG  Q+G+  SLLLNLGR
Sbjct: 243 ASKDIAQTLANSSNVTYLPSQQSGGG-QEGTSQSLLLNLGR 282

>KAFR0C01980 Chr3 complement(394370..395221) [852 bp, 283 aa] {ON}
           Anc_3.494 YGR132C
          Length = 283

 Score =  455 bits (1171), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 216/275 (78%), Positives = 250/275 (90%)

Query: 8   LARIALPIGIAFSALQYSMYDVKGGTRAVIFDRLSGVQQQVIGEGTHFLVPWLQRAIVYD 67
           + ++A+P G+  +A+ YSMYDVKGG+R VIFDR+SGV++ VIGEGTHFLVPWLQ+AI+YD
Sbjct: 9   VTKLAIPSGLLLTAVDYSMYDVKGGSRGVIFDRISGVKKAVIGEGTHFLVPWLQKAIIYD 68

Query: 68  VRTKPKNIATNTGTKDLQMVSLTLRVLHRPEVLQLPHIYQNLGLDYDERVLPSIGNEVLK 127
           VRTKPK+I+TNTGTKDLQMVSLTLR+LHRP V++LP IYQNLGLDYDERVLPSIGNEVLK
Sbjct: 69  VRTKPKSISTNTGTKDLQMVSLTLRLLHRPNVVELPRIYQNLGLDYDERVLPSIGNEVLK 128

Query: 128 AIVAQFDAAELITQREIVSQRIRKELSLRAAEFNIRLEDVSITHMTFGREFTKAVEQKQI 187
           +IVAQFDAAELITQREIVSQRIRKE+S RA EF I+LEDVSITHMTFG EFTKAVEQKQI
Sbjct: 129 SIVAQFDAAELITQREIVSQRIRKEMSHRANEFGIKLEDVSITHMTFGAEFTKAVEQKQI 188

Query: 188 AQQDAERAKFLVERAEQERQAAVIRAEGEAESADYISKALSKAGDGLLLIRRLEASKEIA 247
           AQQDAERA+FLVE+AEQERQA+VIRAEGEAESA+ ISKALS+ GDGLLLIRRLEASK+IA
Sbjct: 189 AQQDAERARFLVEKAEQERQASVIRAEGEAESAECISKALSRVGDGLLLIRRLEASKDIA 248

Query: 248 QTLANSSNVTYLPSNGAGGAEQQGSPNSLLLNLGR 282
           +TL+ SSN+TYLP       +++  PNSLLLN+GR
Sbjct: 249 RTLSKSSNITYLPGGKGREGDEKTPPNSLLLNIGR 283

>Ecym_1235 Chr1 (483393..484244) [852 bp, 283 aa] {ON} similar to
           Ashbya gossypii AFR313C
          Length = 283

 Score =  455 bits (1170), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 216/283 (76%), Positives = 259/283 (91%), Gaps = 1/283 (0%)

Query: 1   MSKLADSLARIALPIGIAFSALQYSMYDVKGGTRAVIFDRLSGVQQQVIGEGTHFLVPWL 60
           MS+  +++A IA+PIG+A  A Q  +YDV+GGTRAVIFDRLSGVQQ+V+GEGTHFL+PWL
Sbjct: 1   MSRFLENIANIAVPIGVAIFAAQSCIYDVRGGTRAVIFDRLSGVQQKVVGEGTHFLIPWL 60

Query: 61  QRAIVYDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPEVLQLPHIYQNLGLDYDERVLPS 120
           Q+A++YDVRTKPKNIATNTGTKDLQ+V+LTLRVLHRP+V+ LP IYQ LGLDYDERVLPS
Sbjct: 61  QKAVIYDVRTKPKNIATNTGTKDLQIVTLTLRVLHRPDVIALPKIYQELGLDYDERVLPS 120

Query: 121 IGNEVLKAIVAQFDAAELITQREIVSQRIRKELSLRAAEFNIRLEDVSITHMTFGREFTK 180
           IGNEVLKAIVAQFDAAELITQRE+VSQ+IR+EL+ RA  F+I+LEDV+ITHM FG EFTK
Sbjct: 121 IGNEVLKAIVAQFDAAELITQRELVSQKIRQELAKRAHAFHIKLEDVAITHMVFGHEFTK 180

Query: 181 AVEQKQIAQQDAERAKFLVERAEQERQAAVIRAEGEAESADYISKALSKAGDGLLLIRRL 240
           +VE+KQIAQQ++ERAK+LV+ AEQER AAVIRAEG+AE+A+YISKAL+KAGDGLL+IRRL
Sbjct: 181 SVEKKQIAQQESERAKYLVQLAEQERAAAVIRAEGDAEAAEYISKALNKAGDGLLMIRRL 240

Query: 241 EASKEIAQTLANSSNVTYLPSNGAGGA-EQQGSPNSLLLNLGR 282
           EASK+IAQTLA SSN+TYLPS+  GG+ +  G+P+SLLLNLGR
Sbjct: 241 EASKKIAQTLAGSSNITYLPSSSKGGSHDACGTPSSLLLNLGR 283

>KNAG0B00790 Chr2 (146405..147259) [855 bp, 284 aa] {ON} Anc_3.494
           YGR132C
          Length = 284

 Score =  451 bits (1161), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 228/284 (80%), Positives = 258/284 (90%), Gaps = 2/284 (0%)

Query: 1   MSKLADSLARIALPIGIAFSALQYSMYDVKGGTRAVIFDRLSGVQQQVIGEGTHFLVPWL 60
           MSK  + L+++A+P G+   A  Y+MYDVKGG+R VIFDR+SGVQQ+V+GEGTHFLVPWL
Sbjct: 1   MSKAINVLSKMAIPAGLLIMAADYAMYDVKGGSRGVIFDRVSGVQQRVVGEGTHFLVPWL 60

Query: 61  QRAIVYDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPEVLQLPHIYQNLGLDYDERVLPS 120
           Q+AI+YDVR+KPK+IATNTGTKDLQMVSLTLRVLHRPEV++LP IYQ+LGLDYDERVLPS
Sbjct: 61  QKAIIYDVRSKPKSIATNTGTKDLQMVSLTLRVLHRPEVMELPRIYQSLGLDYDERVLPS 120

Query: 121 IGNEVLKAIVAQFDAAELITQREIVSQRIRKELSLRAAEFNIRLEDVSITHMTFGREFTK 180
           IGNEVLK+IVAQFDAAELITQRE+VSQRIR+ELS RA EF IRLEDVSITHMTFG EFTK
Sbjct: 121 IGNEVLKSIVAQFDAAELITQREVVSQRIRRELSTRAGEFGIRLEDVSITHMTFGAEFTK 180

Query: 181 AVEQKQIAQQDAERAKFLVERAEQERQAAVIRAEGEAESADYISKALSKAGDGLLLIRRL 240
           AVEQKQIAQQDAERAKFLVE+AEQ RQA+VIRAEGEAESA+ ISKAL+K GDGLLLIRRL
Sbjct: 181 AVEQKQIAQQDAERAKFLVEKAEQMRQASVIRAEGEAESAEAISKALAKVGDGLLLIRRL 240

Query: 241 EASKEIAQTLANSSNVTYLPSNGAGG--AEQQGSPNSLLLNLGR 282
           EASKEIA+TL+ SSNVTYLPS GAGG    + GS N+LLLN+GR
Sbjct: 241 EASKEIARTLSRSSNVTYLPSAGAGGKHGREDGSGNTLLLNIGR 284

>AFR313C Chr6 complement(1005181..1006032) [852 bp, 283 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR132C
           (PHB1)
          Length = 283

 Score =  444 bits (1141), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 224/285 (78%), Positives = 260/285 (91%), Gaps = 5/285 (1%)

Query: 1   MSKLADSLARIALP---IGIAFSALQYSMYDVKGGTRAVIFDRLSGVQQQVIGEGTHFLV 57
           MS+LADSL R+ LP   I +AFSA+Q+SMYDV+GGTRA+IFDR+SGV+  V+GEGTHFL+
Sbjct: 1   MSRLADSLVRLTLPLTPIALAFSAVQFSMYDVRGGTRAIIFDRISGVKPDVVGEGTHFLI 60

Query: 58  PWLQRAIVYDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPEVLQLPHIYQNLGLDYDERV 117
           PWLQ+AI++DVRTKP+NIATNTGTKDLQMVSLTLRVLHRP+V+ L  IY+ LG DYDERV
Sbjct: 61  PWLQKAIIFDVRTKPRNIATNTGTKDLQMVSLTLRVLHRPDVMALSRIYRELGPDYDERV 120

Query: 118 LPSIGNEVLKAIVAQFDAAELITQREIVSQRIRKELSLRAAEFNIRLEDVSITHMTFGRE 177
           LPSIGNEVLKAIVAQF+A+ELITQRE+VSQ+IR EL+ RA+EFNIRLEDVSITHMTFG+E
Sbjct: 121 LPSIGNEVLKAIVAQFNASELITQRELVSQQIRNELARRASEFNIRLEDVSITHMTFGQE 180

Query: 178 FTKAVEQKQIAQQDAERAKFLVERAEQERQAAVIRAEGEAESADYISKALSKAGDGLLLI 237
           FTKAVEQKQIAQQ+++RAKF+VERAEQER+AAVIRAEGEAE+A++ISKAL KAGDGLL+I
Sbjct: 181 FTKAVEQKQIAQQESDRAKFVVERAEQERRAAVIRAEGEAEAAEHISKALQKAGDGLLMI 240

Query: 238 RRLEASKEIAQTLANSSNVTYLPSNGAGGAEQQGSPNSLLLNLGR 282
           RRLEASK IA+TLANS NVTYLPS G   A   G+PNSLLLNLGR
Sbjct: 241 RRLEASKGIAETLANSPNVTYLPSKGQ--AADSGAPNSLLLNLGR 283

>KLLA0D16302g Chr4 complement(1372447..1373127) [681 bp, 226 aa]
           {ON} similar to uniprot|P40961 Saccharomyces cerevisiae
           YGR132C
          Length = 226

 Score =  386 bits (991), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 183/214 (85%), Positives = 204/214 (95%)

Query: 1   MSKLADSLARIALPIGIAFSALQYSMYDVKGGTRAVIFDRLSGVQQQVIGEGTHFLVPWL 60
           MS++AD +ARIA+P+G+  SA+QYSMYDV+GG RAVIFDRL GVQQ VIGEGTHFLVPWL
Sbjct: 1   MSRVADVMARIAIPVGLTVSAIQYSMYDVRGGHRAVIFDRLQGVQQAVIGEGTHFLVPWL 60

Query: 61  QRAIVYDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPEVLQLPHIYQNLGLDYDERVLPS 120
           Q++I++DVRTKPKNIATNTGTKDLQMVSLTLRVLHRP+V+QLP IYQNLG+DYDERVLPS
Sbjct: 61  QKSILFDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPDVMQLPKIYQNLGIDYDERVLPS 120

Query: 121 IGNEVLKAIVAQFDAAELITQREIVSQRIRKELSLRAAEFNIRLEDVSITHMTFGREFTK 180
           IGNEVLKAIVAQFDAAELITQREIVSQRIR ELS RA EF+I+LEDVSITHMTFG+EFTK
Sbjct: 121 IGNEVLKAIVAQFDAAELITQREIVSQRIRAELSKRADEFHIKLEDVSITHMTFGQEFTK 180

Query: 181 AVEQKQIAQQDAERAKFLVERAEQERQAAVIRAE 214
           AVEQKQIAQQDAERA+FLVE+AEQER+AAVIRAE
Sbjct: 181 AVEQKQIAQQDAERARFLVEKAEQERKAAVIRAE 214

>TBLA0H02220 Chr8 (537650..538573) [924 bp, 307 aa] {ON} Anc_5.98
           YGR231C
          Length = 307

 Score =  294 bits (753), Expect = 4e-99,   Method: Compositional matrix adjust.
 Identities = 142/231 (61%), Positives = 186/231 (80%), Gaps = 1/231 (0%)

Query: 25  SMYDVKGGTRAVIFDRLSGVQQQVIGEGTHFLVPWLQRAIVYDVRTKPKNIATNTGTKDL 84
           S+++V GG RA+++ RLSGV  ++  EGTHF++PWLQ  I+YDVR KP+N+A+ TGTKDL
Sbjct: 55  SLFNVDGGHRAILYSRLSGVSSKIYNEGTHFVIPWLQTPIIYDVRAKPRNVASLTGTKDL 114

Query: 85  QMVSLTLRVLHRPEVLQLPHIYQNLGLDYDERVLPSIGNEVLKAIVAQFDAAELITQREI 144
           QMV++T RVL RP++  LP IY+ LG DYDERVLPSI NEVLKA+VAQF+A++LITQR+ 
Sbjct: 115 QMVNITCRVLSRPDIPSLPLIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQRDK 174

Query: 145 VSQRIRKELSLRAAEFNIRLEDVSITHMTFGREFTKAVEQKQIAQQDAERAKFLVERAEQ 204
           VS+ IR+ L  RA +FNI L+DVSIT MTF  EFT AVE KQIAQQDA+RA FLV+RA Q
Sbjct: 175 VSRLIRENLVRRAGKFNIALDDVSITFMTFSPEFTNAVESKQIAQQDAQRAAFLVDRARQ 234

Query: 205 ERQAAVIRAEGEAESADYISKALSKAGDGLLLIRRLEASKEIAQTLANSSN 255
           E+Q  V++A+GEA+SA+ I +A+ K+ D + L +RL+ SK+IA+ LA SSN
Sbjct: 235 EKQGMVVKAQGEAKSAELIGEAIKKSKDYVEL-KRLDISKDIAKILATSSN 284

>KAFR0B04250 Chr2 complement(882694..883626) [933 bp, 310 aa] {ON}
           Anc_5.98 YGR231C
          Length = 310

 Score =  293 bits (749), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 142/238 (59%), Positives = 191/238 (80%), Gaps = 1/238 (0%)

Query: 22  LQYSMYDVKGGTRAVIFDRLSGVQQQVIGEGTHFLVPWLQRAIVYDVRTKPKNIATNTGT 81
           LQ S+++V GG RA+++ R++GV  ++  EGTHF++PWL+  IVYDVR KP+N+A+ TGT
Sbjct: 53  LQQSLFNVDGGHRAIVYSRINGVSSRIYNEGTHFILPWLETPIVYDVRAKPRNVASLTGT 112

Query: 82  KDLQMVSLTLRVLHRPEVLQLPHIYQNLGLDYDERVLPSIGNEVLKAIVAQFDAAELITQ 141
           KDLQMV++T RVL RP+V  LP IY+ LG DYDERVLPSI NEVLKA+VAQF+A++LITQ
Sbjct: 113 KDLQMVNITCRVLSRPDVRSLPIIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQ 172

Query: 142 REIVSQRIRKELSLRAAEFNIRLEDVSITHMTFGREFTKAVEQKQIAQQDAERAKFLVER 201
           RE VS+ IR+ L  RA++FNI L+DVSIT MTF  EFT+AVE KQIAQQDA+RA F+V++
Sbjct: 173 REKVSKLIRENLVRRASKFNIMLDDVSITFMTFSPEFTQAVEAKQIAQQDAQRAAFIVDK 232

Query: 202 AEQERQAAVIRAEGEAESADYISKALSKAGDGLLLIRRLEASKEIAQTLANSSNVTYL 259
           A QE+Q  V++A+GEA+SA+ I +A+ K+ D + L +RL+ ++EIA+ LANS N   L
Sbjct: 233 ARQEKQGMVVKAQGEAKSAELIGEAIKKSRDYVEL-KRLDTAREIARILANSPNRVVL 289

>SAKL0G15510g Chr7 complement(1334598..1335524) [927 bp, 308 aa]
           {ON} highly similar to uniprot|P50085 Saccharomyces
           cerevisiae YGR231C PHB2 Possible role in aging
           mitochondrial protein prohibitin homolog homolog of
           mammalian BAP37 and S. cerevisiae Phb1p
          Length = 308

 Score =  292 bits (747), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 140/231 (60%), Positives = 188/231 (81%), Gaps = 1/231 (0%)

Query: 25  SMYDVKGGTRAVIFDRLSGVQQQVIGEGTHFLVPWLQRAIVYDVRTKPKNIATNTGTKDL 84
           ++++V GG RA+++ R+ G+QQ++  EGTHF VPWL+  IVYDVR KP+N+A+ TGTKDL
Sbjct: 58  ALFNVDGGHRAILYSRVGGIQQRIYNEGTHFAVPWLETPIVYDVRAKPRNVASLTGTKDL 117

Query: 85  QMVSLTLRVLHRPEVLQLPHIYQNLGLDYDERVLPSIGNEVLKAIVAQFDAAELITQREI 144
           QMV++T RVL RPEV QLP IY+ LG DYDERVLPSI NEVLKA+VAQF+A++LITQRE 
Sbjct: 118 QMVNITCRVLSRPEVSQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQRER 177

Query: 145 VSQRIRKELSLRAAEFNIRLEDVSITHMTFGREFTKAVEQKQIAQQDAERAKFLVERAEQ 204
           VS+ IR+ L  RA++FNI L+DVSIT+MTF  EFT AVE KQIAQQDA+RA F+V++A Q
Sbjct: 178 VSRLIRENLVRRASKFNILLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDKARQ 237

Query: 205 ERQAAVIRAEGEAESADYISKALSKAGDGLLLIRRLEASKEIAQTLANSSN 255
           E+Q  V++A+GEA+SA+ I +A+ K+ D + L +RL+ ++EIA+ L+ S N
Sbjct: 238 EKQGMVVKAQGEAQSAELIGEAIKKSKDYVEL-KRLDTAREIAEILSKSPN 287

>ADL141W Chr4 (444592..445515) [924 bp, 307 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR231C (PHB2)
          Length = 307

 Score =  290 bits (743), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 139/234 (59%), Positives = 187/234 (79%), Gaps = 1/234 (0%)

Query: 22  LQYSMYDVKGGTRAVIFDRLSGVQQQVIGEGTHFLVPWLQRAIVYDVRTKPKNIATNTGT 81
           L  S+++V GG RA+++ RLSGVQQ V GEGTHF++PWL+  ++YDVR+KP+ +++ TGT
Sbjct: 54  LNASLFNVDGGHRAIVYSRLSGVQQSVYGEGTHFVIPWLETPVLYDVRSKPRTVSSLTGT 113

Query: 82  KDLQMVSLTLRVLHRPEVLQLPHIYQNLGLDYDERVLPSIGNEVLKAIVAQFDAAELITQ 141
            DLQMV++T RVL RP+V  LP IY+ LG DYDERVLPSI NEVLKA+VAQF+A++LITQ
Sbjct: 114 NDLQMVNITCRVLSRPDVQHLPLIYRTLGTDYDERVLPSIVNEVLKAVVAQFNASQLITQ 173

Query: 142 REIVSQRIRKELSLRAAEFNIRLEDVSITHMTFGREFTKAVEQKQIAQQDAERAKFLVER 201
           RE VS+ IR  L  RA+ FNI L+DVSIT+MTF  EFT AVE KQ+AQQDA+RA F VE+
Sbjct: 174 RESVSRLIRDNLVRRASRFNIMLDDVSITYMTFSPEFTSAVEAKQVAQQDAQRASFYVEK 233

Query: 202 AEQERQAAVIRAEGEAESADYISKALSKAGDGLLLIRRLEASKEIAQTLANSSN 255
           A+QE+Q+ +++A+GEA+SA+ I +A+ K+ D + L +RL+ ++EIA  LA S N
Sbjct: 234 AKQEKQSMIVKAQGEAKSAELIGEAIKKSKDYVEL-KRLDTAREIAGILAASPN 286

>Kwal_27.12747 s27 complement(1358872..1359795) [924 bp, 307 aa]
           {ON} YGR231C (PHB2) - mitochondrial protein, prohibitin
           homolog; homolog of mammalian BAP37 and S. cerevisiae
           Phb1p [contig 260] FULL
          Length = 307

 Score =  289 bits (740), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 137/235 (58%), Positives = 189/235 (80%), Gaps = 1/235 (0%)

Query: 25  SMYDVKGGTRAVIFDRLSGVQQQVIGEGTHFLVPWLQRAIVYDVRTKPKNIATNTGTKDL 84
           S+++V GG RA+++ RL+GVQ ++  EGTHF +PWL+  IVYDVR KP+N+A+ TGTKDL
Sbjct: 57  SLFNVDGGHRAIVYSRLNGVQSRIFAEGTHFAIPWLETPIVYDVRAKPRNVASLTGTKDL 116

Query: 85  QMVSLTLRVLHRPEVLQLPHIYQNLGLDYDERVLPSIGNEVLKAIVAQFDAAELITQREI 144
           QMV++T RVL RP+V QLP +++ LG DYDERVLPSI NEVLK++VAQF+A++LITQRE 
Sbjct: 117 QMVNITCRVLSRPDVTQLPTVFRTLGQDYDERVLPSIVNEVLKSVVAQFNASQLITQREK 176

Query: 145 VSQRIRKELSLRAAEFNIRLEDVSITHMTFGREFTKAVEQKQIAQQDAERAKFLVERAEQ 204
           VS+ IR+ L  RA++FN+ L+DVSIT+MTF  EFT AVE KQIAQQDA+RA F+V++A Q
Sbjct: 177 VSRLIRENLVRRASKFNVLLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDKARQ 236

Query: 205 ERQAAVIRAEGEAESADYISKALSKAGDGLLLIRRLEASKEIAQTLANSSNVTYL 259
           E+Q  V++A+GEA+SA+ I +A+ K+ D + L +RL+ ++EIA  L++S N   L
Sbjct: 237 EKQGMVVKAQGEAKSAELIGEAIKKSKDYVEL-KRLDTAREIATILSSSPNKVIL 290

>CAGL0L06490g Chr12 (735080..736021) [942 bp, 313 aa] {ON} highly
           similar to uniprot|P50085 Saccharomyces cerevisiae
           YGR231c PHB2 or uniprot|P40961 Saccharomyces cerevisiae
           YGR132c PHB1
          Length = 313

 Score =  288 bits (737), Expect = 9e-97,   Method: Compositional matrix adjust.
 Identities = 138/231 (59%), Positives = 185/231 (80%), Gaps = 1/231 (0%)

Query: 25  SMYDVKGGTRAVIFDRLSGVQQQVIGEGTHFLVPWLQRAIVYDVRTKPKNIATNTGTKDL 84
           ++++V GG RA+++ R+ GV Q++  EGTH ++PW++  IVYDVR KP+N+A+ TGTKDL
Sbjct: 59  ALFNVDGGHRAIVYSRIGGVSQKIFSEGTHIIIPWIETPIVYDVRAKPRNVASLTGTKDL 118

Query: 85  QMVSLTLRVLHRPEVLQLPHIYQNLGLDYDERVLPSIGNEVLKAIVAQFDAAELITQREI 144
           QMV++T RVL RP V QLP IY+ LG DYDERVLPSI NEVLKA+VAQF+A++LITQRE 
Sbjct: 119 QMVNITCRVLSRPNVGQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQREK 178

Query: 145 VSQRIRKELSLRAAEFNIRLEDVSITHMTFGREFTKAVEQKQIAQQDAERAKFLVERAEQ 204
           VS+ IR  L  RA+ FNI L+DVSIT+MTF  EFT+AVE KQIAQQDA+RA F+V++A Q
Sbjct: 179 VSRLIRDNLVRRASGFNILLDDVSITYMTFSPEFTQAVEAKQIAQQDAQRAAFIVDKARQ 238

Query: 205 ERQAAVIRAEGEAESADYISKALSKAGDGLLLIRRLEASKEIAQTLANSSN 255
           E+Q  V++A+GEA+SA+ I  A+ K+ D + L +RL+ +K+IA+ LANS N
Sbjct: 239 EKQGMVVKAQGEAKSAELIGDAIKKSRDYVEL-KRLDTAKDIAKILANSPN 288

>YGR231C Chr7 complement(952548..953480) [933 bp, 310 aa] {ON}
           PHB2Subunit of the prohibitin complex (Phb1p-Phb2p), a
           1.2 MDa ring-shaped inner mitochondrial membrane
           chaperone that stabilizes newly synthesized proteins;
           determinant of replicative life span; involved in
           mitochondrial segregation
          Length = 310

 Score =  288 bits (737), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 137/231 (59%), Positives = 187/231 (80%), Gaps = 1/231 (0%)

Query: 25  SMYDVKGGTRAVIFDRLSGVQQQVIGEGTHFLVPWLQRAIVYDVRTKPKNIATNTGTKDL 84
           ++++V GG RA+++ R+ GV  ++  EGTHF+ PWL   I+YDVR KP+N+A+ TGTKDL
Sbjct: 57  ALFNVDGGHRAIVYSRIHGVSSRIFNEGTHFIFPWLDTPIIYDVRAKPRNVASLTGTKDL 116

Query: 85  QMVSLTLRVLHRPEVLQLPHIYQNLGLDYDERVLPSIGNEVLKAIVAQFDAAELITQREI 144
           QMV++T RVL RP+V+QLP IY+ LG DYDERVLPSI NEVLKA+VAQF+A++LITQRE 
Sbjct: 117 QMVNITCRVLSRPDVVQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQREK 176

Query: 145 VSQRIRKELSLRAAEFNIRLEDVSITHMTFGREFTKAVEQKQIAQQDAERAKFLVERAEQ 204
           VS+ IR+ L  RA++FNI L+DVSIT+MTF  EFT AVE KQIAQQDA+RA F+V++A Q
Sbjct: 177 VSRLIRENLVRRASKFNILLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDKARQ 236

Query: 205 ERQAAVIRAEGEAESADYISKALSKAGDGLLLIRRLEASKEIAQTLANSSN 255
           E+Q  V+RA+GEA+SA+ I +A+ K+ D + L +RL+ +++IA+ LA+S N
Sbjct: 237 EKQGMVVRAQGEAKSAELIGEAIKKSRDYVEL-KRLDTARDIAKILASSPN 286

>Smik_16.75 Chr16 (143216..144148) [933 bp, 310 aa] {ON} YGR231C
           (REAL)
          Length = 310

 Score =  288 bits (736), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 137/231 (59%), Positives = 187/231 (80%), Gaps = 1/231 (0%)

Query: 25  SMYDVKGGTRAVIFDRLSGVQQQVIGEGTHFLVPWLQRAIVYDVRTKPKNIATNTGTKDL 84
           ++++V GG RA+++ R+ GV  ++  EGTHF+ PWL   IVYDVR KP+N+A+ TGTKDL
Sbjct: 57  ALFNVDGGHRAIVYSRIHGVSTKIFNEGTHFIFPWLDTPIVYDVRAKPRNVASLTGTKDL 116

Query: 85  QMVSLTLRVLHRPEVLQLPHIYQNLGLDYDERVLPSIGNEVLKAIVAQFDAAELITQREI 144
           QMV++T RVL RP+V+QLP IY+ LG DYDERVLPSI NEVLKA+VAQF+A++LITQRE 
Sbjct: 117 QMVNITCRVLSRPDVVQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQREK 176

Query: 145 VSQRIRKELSLRAAEFNIRLEDVSITHMTFGREFTKAVEQKQIAQQDAERAKFLVERAEQ 204
           VS+ IR+ L  RA++FNI L+DVSIT+MTF  EFT AVE KQIAQQDA+RA F+V++A Q
Sbjct: 177 VSRLIRENLVRRASKFNILLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDKARQ 236

Query: 205 ERQAAVIRAEGEAESADYISKALSKAGDGLLLIRRLEASKEIAQTLANSSN 255
           E+Q  V++A+GEA+SA+ I +A+ K+ D + L +RL+ +++IA+ LA+S N
Sbjct: 237 EKQGMVVKAQGEAKSAELIGEAIKKSRDYVEL-KRLDTARDIAKILASSPN 286

>TPHA0A05090 Chr1 complement(1146837..1147769) [933 bp, 310 aa] {ON}
           Anc_5.98 YGR231C
          Length = 310

 Score =  287 bits (734), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 135/231 (58%), Positives = 184/231 (79%), Gaps = 1/231 (0%)

Query: 25  SMYDVKGGTRAVIFDRLSGVQQQVIGEGTHFLVPWLQRAIVYDVRTKPKNIATNTGTKDL 84
           ++++V GG RA+++ R+ GV  ++  EGTHF++PW++  ++YDVR KP+N+A+ TGTKDL
Sbjct: 58  ALFNVDGGHRAIVYSRIGGVSNKIYTEGTHFVIPWIETPVIYDVRAKPRNVASLTGTKDL 117

Query: 85  QMVSLTLRVLHRPEVLQLPHIYQNLGLDYDERVLPSIGNEVLKAIVAQFDAAELITQREI 144
           QMV++T RVL RP V QLP IY+ LG DYDERVLPSI NEVLKA+VAQF+A++LITQR+ 
Sbjct: 118 QMVNITCRVLSRPNVTQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQRDK 177

Query: 145 VSQRIRKELSLRAAEFNIRLEDVSITHMTFGREFTKAVEQKQIAQQDAERAKFLVERAEQ 204
           VS+ IR  L LRA +FNI L+DVSIT+MTF  EFT AVE KQIAQQDA+RA F+V++A Q
Sbjct: 178 VSRLIRDNLVLRAQKFNITLDDVSITYMTFSPEFTTAVEAKQIAQQDAQRAAFVVDKARQ 237

Query: 205 ERQAAVIRAEGEAESADYISKALSKAGDGLLLIRRLEASKEIAQTLANSSN 255
           E+Q  V++A+GEA+SA+ I +A+ K+ D + L +RL+ +K+IA  LA S N
Sbjct: 238 EKQGMVVKAQGEAKSAELIGEAIKKSKDYVEL-KRLDTAKDIADILAKSPN 287

>KLTH0C01672g Chr3 (147893..148816) [924 bp, 307 aa] {ON} highly
           similar to uniprot|P50085 Saccharomyces cerevisiae
           YGR231C PHB2 Possible role in aging mitochondrial
           protein prohibitin homolog homolog of mammalian BAP37
           and S. cerevisiae Phb1p
          Length = 307

 Score =  286 bits (732), Expect = 4e-96,   Method: Compositional matrix adjust.
 Identities = 137/231 (59%), Positives = 185/231 (80%), Gaps = 1/231 (0%)

Query: 25  SMYDVKGGTRAVIFDRLSGVQQQVIGEGTHFLVPWLQRAIVYDVRTKPKNIATNTGTKDL 84
           S+++V GG RA+I+ RL+GVQ ++  EGTHF +PW +  IVYDVR KP+N+A+ TGTKDL
Sbjct: 57  SLFNVDGGHRAIIYSRLNGVQSRIFAEGTHFAIPWFETPIVYDVRAKPRNVASLTGTKDL 116

Query: 85  QMVSLTLRVLHRPEVLQLPHIYQNLGLDYDERVLPSIGNEVLKAIVAQFDAAELITQREI 144
           QMV++T RVL RP V QLP +++ LG DYDERVLPSI NEVLK++VAQF+A++LITQRE 
Sbjct: 117 QMVNITCRVLSRPNVSQLPTVFRTLGQDYDERVLPSIVNEVLKSVVAQFNASQLITQREK 176

Query: 145 VSQRIRKELSLRAAEFNIRLEDVSITHMTFGREFTKAVEQKQIAQQDAERAKFLVERAEQ 204
           VS+ IR+ L  RA++FNI L+DVSIT+MTF  EFT AVE KQIAQQDA+RA F+V++A Q
Sbjct: 177 VSRLIRENLVRRASKFNILLDDVSITYMTFSPEFTYAVEAKQIAQQDAQRAAFVVDKARQ 236

Query: 205 ERQAAVIRAEGEAESADYISKALSKAGDGLLLIRRLEASKEIAQTLANSSN 255
           E+Q  V++A+GEA+SA+ I +A+ K+ D + L +RL+ ++EIA  L+ S N
Sbjct: 237 EKQGMVVKAQGEAKSAELIGEAIKKSKDYVEL-KRLDTAREIATILSQSPN 286

>Kpol_1050.61 s1050 complement(135758..136690) [933 bp, 310 aa] {ON}
           complement(135758..136690) [933 nt, 311 aa]
          Length = 310

 Score =  286 bits (731), Expect = 7e-96,   Method: Compositional matrix adjust.
 Identities = 136/231 (58%), Positives = 185/231 (80%), Gaps = 1/231 (0%)

Query: 25  SMYDVKGGTRAVIFDRLSGVQQQVIGEGTHFLVPWLQRAIVYDVRTKPKNIATNTGTKDL 84
           ++++V GG RA+++ R+ GV  ++  EGTHF++PWL+  +VYDVR KP+N+A+ TGTKDL
Sbjct: 60  ALFNVDGGHRAIVYSRIGGVSSKIYNEGTHFVLPWLETPVVYDVRAKPRNVASLTGTKDL 119

Query: 85  QMVSLTLRVLHRPEVLQLPHIYQNLGLDYDERVLPSIGNEVLKAIVAQFDAAELITQREI 144
           QMV++T RVL RP+V QLP IY+ LG DYDERVLPSI NEVLKA+VAQF+A++LITQRE 
Sbjct: 120 QMVNITCRVLSRPDVSQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQREK 179

Query: 145 VSQRIRKELSLRAAEFNIRLEDVSITHMTFGREFTKAVEQKQIAQQDAERAKFLVERAEQ 204
           VS+ IR+ L  RA  FN+ L+DVSIT+MTF  EFT AVE KQIAQQDA+RA F+V++A+Q
Sbjct: 180 VSRLIRENLVNRAGRFNLILDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDKAKQ 239

Query: 205 ERQAAVIRAEGEAESADYISKALSKAGDGLLLIRRLEASKEIAQTLANSSN 255
           E+Q  V++A+GEA+SA+ I +A+ K+ D + L +RL+ ++EIA  LA S N
Sbjct: 240 EKQGMVVKAQGEAKSAELIGEAIKKSKDYVEL-KRLDTAREIADILAKSPN 289

>Suva_7.523 Chr7 complement(907005..907937) [933 bp, 310 aa] {ON}
           YGR231C (REAL)
          Length = 310

 Score =  286 bits (731), Expect = 8e-96,   Method: Compositional matrix adjust.
 Identities = 137/235 (58%), Positives = 187/235 (79%), Gaps = 1/235 (0%)

Query: 25  SMYDVKGGTRAVIFDRLSGVQQQVIGEGTHFLVPWLQRAIVYDVRTKPKNIATNTGTKDL 84
           ++++V GG RA+++ RL+GV  ++  EGTHF+ PW+   I+YDVR KP+N+A+ TGTKDL
Sbjct: 57  ALFNVDGGHRAIVYSRLNGVSARIFNEGTHFIFPWIDTPIIYDVRAKPRNVASLTGTKDL 116

Query: 85  QMVSLTLRVLHRPEVLQLPHIYQNLGLDYDERVLPSIGNEVLKAIVAQFDAAELITQREI 144
           QMV++T RVL RP+V QLP IY+ LG DYDERVLPSI NEVLKA+VAQF+A++LITQRE 
Sbjct: 117 QMVNITCRVLSRPDVGQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQREK 176

Query: 145 VSQRIRKELSLRAAEFNIRLEDVSITHMTFGREFTKAVEQKQIAQQDAERAKFLVERAEQ 204
           VS+ IR+ L  RA+ F+I L+DVSIT+MTF  EFT AVE KQIAQQDA+RA F+V++A Q
Sbjct: 177 VSRLIRENLVRRASRFSILLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDKARQ 236

Query: 205 ERQAAVIRAEGEAESADYISKALSKAGDGLLLIRRLEASKEIAQTLANSSNVTYL 259
           E+Q  V++A+GEA+SA+ I +A+ K+ D + L +RL+ +++IA+ LANS N   L
Sbjct: 237 EKQGMVVKAQGEAKSAELIGEAIKKSKDYVEL-KRLDTARDIAKILANSPNRVVL 290

>Skud_7.565 Chr7 complement(927426..928358) [933 bp, 310 aa] {ON}
           YGR231C (REAL)
          Length = 310

 Score =  285 bits (730), Expect = 9e-96,   Method: Compositional matrix adjust.
 Identities = 136/231 (58%), Positives = 184/231 (79%), Gaps = 1/231 (0%)

Query: 25  SMYDVKGGTRAVIFDRLSGVQQQVIGEGTHFLVPWLQRAIVYDVRTKPKNIATNTGTKDL 84
           ++++V GG RA+++ R+ GV  ++  EGTHF+ PWL   I+YDVR KP+N+A+ TGTKDL
Sbjct: 57  ALFNVDGGHRAIVYSRIHGVSSKIFNEGTHFIFPWLDTPIIYDVRAKPRNVASLTGTKDL 116

Query: 85  QMVSLTLRVLHRPEVLQLPHIYQNLGLDYDERVLPSIGNEVLKAIVAQFDAAELITQREI 144
           QMV++T RVL RP+V QLP IY+ LG DYDERVLPSI NEVLK++VAQF+A++LITQRE 
Sbjct: 117 QMVNITCRVLSRPDVAQLPIIYRTLGQDYDERVLPSIVNEVLKSVVAQFNASQLITQREK 176

Query: 145 VSQRIRKELSLRAAEFNIRLEDVSITHMTFGREFTKAVEQKQIAQQDAERAKFLVERAEQ 204
           VS+ IR+ L  RA  FNI L+DVSIT+MTF  EFT AVE KQIAQQDA+RA F+V++A Q
Sbjct: 177 VSRLIRENLVRRATRFNILLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDKARQ 236

Query: 205 ERQAAVIRAEGEAESADYISKALSKAGDGLLLIRRLEASKEIAQTLANSSN 255
           E+Q  V++A+GEA+SA+ I +A+ K+ D + L +RL+ +++IA+ LANS N
Sbjct: 237 EKQGMVVKAQGEAKSAELIGEAIKKSRDYVEL-KRLDTARDIAKILANSPN 286

>NCAS0F00600 Chr6 (117964..118905) [942 bp, 313 aa] {ON} Anc_5.98
           YGR231C
          Length = 313

 Score =  285 bits (730), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 136/231 (58%), Positives = 184/231 (79%), Gaps = 1/231 (0%)

Query: 25  SMYDVKGGTRAVIFDRLSGVQQQVIGEGTHFLVPWLQRAIVYDVRTKPKNIATNTGTKDL 84
           S+++V GG RA+++ R+SGV  ++  EGTHF++PW++  I+YDVR KP+N+A+ TGTKDL
Sbjct: 59  SLFNVDGGHRAIVYSRISGVSPKIYPEGTHFIIPWIETPIIYDVRAKPRNVASLTGTKDL 118

Query: 85  QMVSLTLRVLHRPEVLQLPHIYQNLGLDYDERVLPSIGNEVLKAIVAQFDAAELITQREI 144
           QMV++T RVL RP V  LP+IY+ LG DYDERVLPSI NEVLK++VAQF+A++LITQRE 
Sbjct: 119 QMVNITCRVLSRPNVENLPNIYRTLGQDYDERVLPSIVNEVLKSVVAQFNASQLITQREK 178

Query: 145 VSQRIRKELSLRAAEFNIRLEDVSITHMTFGREFTKAVEQKQIAQQDAERAKFLVERAEQ 204
           VS+ IR+ L  R++ FNI L+DVSIT MTF  EFT AVE KQIAQQDA+RA F+V++A Q
Sbjct: 179 VSKLIRENLMGRSSRFNILLDDVSITFMTFSPEFTNAVEAKQIAQQDAQRAAFVVDKARQ 238

Query: 205 ERQAAVIRAEGEAESADYISKALSKAGDGLLLIRRLEASKEIAQTLANSSN 255
           E+Q  V+RA+GEA+SA+ I +A+ K+ D + L +RL+ ++EIA  LA S N
Sbjct: 239 EKQGMVVRAQGEAKSAELIGEAIKKSKDYVEL-KRLDTAREIATILAKSPN 288

>NDAI0D02530 Chr4 complement(583429..584379) [951 bp, 316 aa] {ON}
           Anc_5.98
          Length = 316

 Score =  285 bits (729), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 139/234 (59%), Positives = 183/234 (78%), Gaps = 1/234 (0%)

Query: 22  LQYSMYDVKGGTRAVIFDRLSGVQQQVIGEGTHFLVPWLQRAIVYDVRTKPKNIATNTGT 81
           L  ++++V GG RA+++ R+SGV  ++  EGTHF +PW++  I+YDVR KP+N+A+ TGT
Sbjct: 59  LNSALFNVDGGHRAIVYSRISGVSPRIYPEGTHFAIPWIETPIIYDVRAKPRNVASLTGT 118

Query: 82  KDLQMVSLTLRVLHRPEVLQLPHIYQNLGLDYDERVLPSIGNEVLKAIVAQFDAAELITQ 141
           KDLQMV++T RVL RP V QLP IY+ LG DYDERVLPSI NEVLKA+VAQF+A++LITQ
Sbjct: 119 KDLQMVNITCRVLSRPNVGQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQ 178

Query: 142 REIVSQRIRKELSLRAAEFNIRLEDVSITHMTFGREFTKAVEQKQIAQQDAERAKFLVER 201
           RE VS+ IR+ L  RA  FNI L+DVSIT MTF  EFT AVE KQIAQQDA+RA F+V++
Sbjct: 179 REKVSKLIRENLMGRANRFNILLDDVSITFMTFSPEFTNAVEAKQIAQQDAQRAAFVVDK 238

Query: 202 AEQERQAAVIRAEGEAESADYISKALSKAGDGLLLIRRLEASKEIAQTLANSSN 255
           A QE+Q  V+RA+GEA+SA+ I  A+ K+ D + L +RL+ ++EIA+ LA S N
Sbjct: 239 ARQEKQGMVVRAQGEAKSAELIGDAIKKSKDYVEL-KRLDTAREIARILAKSPN 291

>ZYRO0B15136g Chr2 (1233955..1234887) [933 bp, 310 aa] {ON} similar
           to uniprot|P50085 Saccharomyces cerevisiae YGR231C PHB2
           Possible role in aging mitochondrial protein prohibitin
           homolog homolog of mammalian BAP37 and S. cerevisiae
           Phb1p
          Length = 310

 Score =  284 bits (726), Expect = 4e-95,   Method: Compositional matrix adjust.
 Identities = 137/231 (59%), Positives = 185/231 (80%), Gaps = 1/231 (0%)

Query: 25  SMYDVKGGTRAVIFDRLSGVQQQVIGEGTHFLVPWLQRAIVYDVRTKPKNIATNTGTKDL 84
           ++++V GG RA+++ R+ GV  ++  EGTH L+PW +  +VYDVR KP+N+A+ TGTKDL
Sbjct: 60  ALFNVDGGHRAIVYSRIGGVSSRIYPEGTHLLLPWFETPVVYDVRAKPRNVASLTGTKDL 119

Query: 85  QMVSLTLRVLHRPEVLQLPHIYQNLGLDYDERVLPSIGNEVLKAIVAQFDAAELITQREI 144
           QMV++T RVL RP+V QLP IY+ LGLDYDERVLPSI NEVLKA+VAQF+A++LITQRE 
Sbjct: 120 QMVNITCRVLSRPDVGQLPVIYRTLGLDYDERVLPSIVNEVLKAVVAQFNASQLITQREK 179

Query: 145 VSQRIRKELSLRAAEFNIRLEDVSITHMTFGREFTKAVEQKQIAQQDAERAKFLVERAEQ 204
           VS+ IR+ L  RA+ FNI L+DVSIT+MTF  EFT AVE KQIAQQDA+RA F+V+RA Q
Sbjct: 180 VSRLIRENLVRRASRFNILLDDVSITYMTFSPEFTAAVESKQIAQQDAQRAAFVVDRALQ 239

Query: 205 ERQAAVIRAEGEAESADYISKALSKAGDGLLLIRRLEASKEIAQTLANSSN 255
           E+Q  V++A+G+A+SA+ I +A+ K+ D + L +RL+ ++EIAQ L+ S N
Sbjct: 240 EKQGLVVKAQGDAKSAELIGEAIRKSKDYVEL-KRLDTAREIAQILSRSPN 289

>KNAG0A01580 Chr1 (79208..80074) [867 bp, 288 aa] {ON} Anc_5.98
           YGR231C
          Length = 288

 Score =  283 bits (723), Expect = 6e-95,   Method: Compositional matrix adjust.
 Identities = 136/231 (58%), Positives = 184/231 (79%), Gaps = 1/231 (0%)

Query: 25  SMYDVKGGTRAVIFDRLSGVQQQVIGEGTHFLVPWLQRAIVYDVRTKPKNIATNTGTKDL 84
           ++++V GG RA+++ R+ GV  ++  EGTHF++PWL+  IVYDVR KP+N+A+ TGTKDL
Sbjct: 35  ALFNVDGGHRAIVYSRIGGVLPRIYNEGTHFVLPWLETPIVYDVRAKPRNVASLTGTKDL 94

Query: 85  QMVSLTLRVLHRPEVLQLPHIYQNLGLDYDERVLPSIGNEVLKAIVAQFDAAELITQREI 144
           QMV++T RVL RP+V QLP +Y+ LG DYD+RVLPSI NEVLK++VAQF+A++LITQRE 
Sbjct: 95  QMVNITCRVLSRPDVTQLPTLYRTLGQDYDDRVLPSIVNEVLKSVVAQFNASQLITQREK 154

Query: 145 VSQRIRKELSLRAAEFNIRLEDVSITHMTFGREFTKAVEQKQIAQQDAERAKFLVERAEQ 204
           VS+ IR+ L  RA+ FNI L+DVSIT+MTF  EFT AVE KQIAQQDA+RA F+V++A Q
Sbjct: 155 VSRLIRENLVRRASRFNIMLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFIVDKARQ 214

Query: 205 ERQAAVIRAEGEAESADYISKALSKAGDGLLLIRRLEASKEIAQTLANSSN 255
           E+Q  V++A GEA+SA+ I +A+ K+ D + L +RL+ +KEIA  LA S N
Sbjct: 215 EKQGMVVKAVGEAKSAELIGEAIKKSKDYVEL-KRLDTAKEIATILAASPN 264

>KLLA0E15731g Chr5 (1407793..1408719) [927 bp, 308 aa] {ON} similar
           to uniprot|P50085 Saccharomyces cerevisiae YGR231C PHB2
           Possible role in aging mitochondrial protein prohibitin
           homolog homolog of mammalian BAP37 and S. cerevisiae
           Phb1p
          Length = 308

 Score =  282 bits (721), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 132/235 (56%), Positives = 186/235 (79%), Gaps = 1/235 (0%)

Query: 25  SMYDVKGGTRAVIFDRLSGVQQQVIGEGTHFLVPWLQRAIVYDVRTKPKNIATNTGTKDL 84
           ++++V GG RA+++ R++GVQ ++  EGTHF++PW++  +VYDVR KP+N+++ TGTKDL
Sbjct: 58  ALFNVDGGHRAIVYSRINGVQPRIYPEGTHFIIPWVENPVVYDVRAKPRNVSSLTGTKDL 117

Query: 85  QMVSLTLRVLHRPEVLQLPHIYQNLGLDYDERVLPSIGNEVLKAIVAQFDAAELITQREI 144
           QMV++T RVL RP V  LP IY+ LG+DYDERVLPSI NEVLKA+VAQF+A++LITQRE 
Sbjct: 118 QMVNITCRVLSRPNVENLPMIYRTLGVDYDERVLPSIVNEVLKAVVAQFNASQLITQRER 177

Query: 145 VSQRIRKELSLRAAEFNIRLEDVSITHMTFGREFTKAVEQKQIAQQDAERAKFLVERAEQ 204
           VS+ IR+ L  RA  FNI L+DVSIT+MTF  EFT +VE KQIAQQDA++A F+V++A Q
Sbjct: 178 VSRLIRENLVRRAKHFNIMLDDVSITYMTFSPEFTNSVEAKQIAQQDAQKAAFVVDKATQ 237

Query: 205 ERQAAVIRAEGEAESADYISKALSKAGDGLLLIRRLEASKEIAQTLANSSNVTYL 259
           E+Q  +++A+GEA+SA+ I +A+ K+ D + L +RL+ ++EIA  L+ S N   L
Sbjct: 238 EKQGMIVKAQGEAKSAELIGEAIKKSKDYVEL-KRLDTAREIASILSRSPNKVIL 291

>TDEL0G01210 Chr7 (248098..249027) [930 bp, 309 aa] {ON} Anc_5.98
           YGR231C
          Length = 309

 Score =  281 bits (720), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 136/234 (58%), Positives = 184/234 (78%), Gaps = 1/234 (0%)

Query: 22  LQYSMYDVKGGTRAVIFDRLSGVQQQVIGEGTHFLVPWLQRAIVYDVRTKPKNIATNTGT 81
           L  ++++V GG RA+++ R+ GV  ++  EGTH ++PWL+  +VYDVR KP+N+A+ TGT
Sbjct: 56  LNSALFNVDGGHRAIVYSRIGGVSSRIYNEGTHVIIPWLETPVVYDVRAKPRNVASLTGT 115

Query: 82  KDLQMVSLTLRVLHRPEVLQLPHIYQNLGLDYDERVLPSIGNEVLKAIVAQFDAAELITQ 141
           KDLQMV++T RVL RP V QLP IY+ LG DY ERVLPSI NEVLKA+VAQF+A++LITQ
Sbjct: 116 KDLQMVNITCRVLSRPNVEQLPTIYRTLGQDYGERVLPSIVNEVLKAVVAQFNASQLITQ 175

Query: 142 REIVSQRIRKELSLRAAEFNIRLEDVSITHMTFGREFTKAVEQKQIAQQDAERAKFLVER 201
           RE VS+ IR+ L  RA+ F+I L+DVSIT+MTF  EFT AVE KQIAQQDA+RA F+V++
Sbjct: 176 REKVSRLIRENLVRRASNFSILLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDK 235

Query: 202 AEQERQAAVIRAEGEAESADYISKALSKAGDGLLLIRRLEASKEIAQTLANSSN 255
           A QE+Q  V++A+GEA+SA+ I +A+ K+ D + L +RL+ ++EIAQ LA S N
Sbjct: 236 ARQEKQGMVVKAQGEAKSAELIGEAIKKSKDYVEL-KRLDTAREIAQILARSPN 288

>KLTH0F18546g Chr6 (1498810..1507143) [8334 bp, 2777 aa] {ON}
           similar to uniprot|Q06179 Saccharomyces cerevisiae
           YLR454W FMP27 The authentic non-tagged protein was
           localized to the mitochondria
          Length = 2777

 Score = 33.5 bits (75), Expect = 0.80,   Method: Composition-based stats.
 Identities = 24/88 (27%), Positives = 42/88 (47%), Gaps = 5/88 (5%)

Query: 153 LSLRAAEFNIRLEDVSITHMTFGREFTKAVEQKQIAQQDAERAKFLVERAEQERQAAVIR 212
           L L     +I+L DVSI++     + TK++E     Q+ AER++     + ++     ++
Sbjct: 188 LPLEDMSIDIKLRDVSISY----DQLTKSIESA-YQQKAAERSEAPANESHKDHFQTNMQ 242

Query: 213 AEGEAESADYISKALSKAGDGLLLIRRL 240
                ES +YI   L KA D + +  R 
Sbjct: 243 PVTTGESIEYIKSLLLKASDFVTMFDRF 270

>KNAG0A07470 Chr1 (1173486..1174043) [558 bp, 185 aa] {ON} Anc_3.410
           YGR082W
          Length = 185

 Score = 30.0 bits (66), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 35/51 (68%), Gaps = 9/51 (17%)

Query: 180 KAVEQKQIAQQDAERAKFLVERAEQERQAAVIRAEGEAE-SADYISKALSK 229
           KAV+QK++AQQDA RAK       +ER  +V +A  +AE +AD IS A+S+
Sbjct: 43  KAVKQKKLAQQDAARAK-------KERLTSV-QAFLQAELAADPISTAVSE 85

>ADL346W Chr4 (96109..100266) [4158 bp, 1385 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBR115C (LYS2)
          Length = 1385

 Score = 30.0 bits (66), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 30/50 (60%), Gaps = 3/50 (6%)

Query: 1   MSKLADSLARIALPIGIAFSALQYSMYDVKGGT---RAVIFDRLSGVQQQ 47
           M   A+ L ++A+P G+AF  L+ S+ +   GT    AV FD LS ++++
Sbjct: 80  MYSKANRLLKLAVPPGVAFQQLRASVTEAVEGTLALPAVDFDELSALERE 129

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.133    0.357 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 24,600,215
Number of extensions: 915009
Number of successful extensions: 3030
Number of sequences better than 10.0: 55
Number of HSP's gapped: 3088
Number of HSP's successfully gapped: 55
Length of query: 282
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 174
Effective length of database: 41,097,471
Effective search space: 7150959954
Effective search space used: 7150959954
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 65 (29.6 bits)