Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0F02706g3.495ON1611618531e-118
Kwal_55.212463.495ON1601534582e-58
KLTH0F14894g3.495ON1661534173e-52
NCAS0E007803.495ON1711654104e-51
YGR133W (PEX4)3.495ON1831604115e-51
ZYRO0D09878g3.495ON1531564061e-50
CAGL0I10450g3.495ON1621573991e-49
Suva_7.4213.495ON1651603973e-49
NDAI0G009103.495ON1631663932e-48
Smik_6.2293.495ON1651603922e-48
Skud_7.4443.495ON1621603852e-47
TDEL0D056303.495ON1501543791e-46
TPHA0D042603.495ON1581573765e-46
Kpol_480.133.495ON1571573755e-46
Ecym_12343.495ON1611533211e-37
TBLA0C045003.495ON1651553174e-37
AFR314W3.495ON1551563157e-37
KAFR0C019903.495ON1511543061e-35
KNAG0B007803.495ON1531582811e-31
KLLA0E04027g3.495ON1581562419e-26
KAFR0C002703.308ON1471502287e-24
KLTH0E14300g3.308ON1471532288e-24
SAKL0B06512g3.308ON1471532288e-24
AER173C3.308ON1471532288e-24
Ecym_74313.308ON1471532278e-24
TDEL0F021003.308ON1471532243e-23
ZYRO0G12870g3.308ON1471532225e-23
NDAI0A054903.308ON1471532226e-23
TBLA0I021303.308ON1481522201e-22
Kpol_1052.23.308ON1481522192e-22
TPHA0L008508.375ON2161352232e-22
TPHA0A038503.308ON1481522182e-22
Kpol_1030.108.375ON2151352232e-22
CAGL0E04752g3.308ON1471532173e-22
KLLA0E12563g3.308ON1481522164e-22
KNAG0A048108.375ON2141352205e-22
NCAS0A108003.308ON1481522165e-22
KNAG0J023403.308ON1611182158e-22
ZYRO0C03784g8.375ON2181352171e-21
Suva_2.2183.308ON1481182122e-21
Skud_4.3143.308ON1481182122e-21
YDR059C (UBC5)3.308ON1481182122e-21
CAGL0E00671g8.375ON2131352162e-21
Smik_4.2973.308ON1481182113e-21
YOR339C (UBC11)7.54ON1561182113e-21
TBLA0H031308.375ON2141352144e-21
Kwal_27.124013.308ON2361182154e-21
NDAI0A011608.375ON2161352136e-21
TDEL0F049908.375ON2171352137e-21
Kpol_1065.127.54ON1591182089e-21
Suva_4.3263.308ON1481262079e-21
Smik_15.5177.54ON1561252062e-20
Skud_2.2073.308ON1481262052e-20
Smik_2.2193.308ON1481262052e-20
YBR082C (UBC4)3.308ON1481262052e-20
KAFR0B060608.375ON2131352074e-20
NCAS0B031508.375ON2141352074e-20
Suva_8.3897.54ON1561192035e-20
Skud_15.5047.54ON1561192035e-20
Skud_4.4418.375ON2151352057e-20
Suva_2.3438.375ON2151352058e-20
Smik_4.4258.375ON2151352058e-20
YDR177W (UBC1)8.375ON2151352059e-20
TPHA0I024602.569ON1671382011e-19
ADR169C8.375ON2111352041e-19
Kwal_14.18286.109ON1521061992e-19
Ecym_60388.375ON2111352032e-19
TBLA0A012901.436ON2191242032e-19
NCAS0D032206.109ON1711062002e-19
KLTH0H06732g6.109ON1601061982e-19
KLTH0D07986g2.569ON1651681984e-19
TPHA0O009201.436ON2261242015e-19
NDAI0D011401.436ON2451242015e-19
ZYRO0B11682g8.230ON1511341955e-19
ZYRO0C04950g6.109ON1681061967e-19
SAKL0A00396g8.375ON2151351997e-19
YGL058W (RAD6)6.109ON1721061967e-19
AAR156C6.109ON1701061967e-19
TDEL0G036106.109ON1691061968e-19
SAKL0A07260g6.109ON1691061968e-19
Smik_7.2226.109ON1711061968e-19
Ecym_30776.109ON1701061968e-19
CAGL0M07568g2.569ON1651381958e-19
Suva_7.2136.109ON1731061968e-19
TBLA0F024406.109ON1741061951e-18
KNAG0H018701.436ON2101141971e-18
ZYRO0E03806g1.436ON2091241971e-18
KLTH0A07546g8.375ON2151351971e-18
NDAI0I016506.109ON1761061951e-18
Kwal_26.82242.569ON1651681941e-18
KAFR0H029601.436ON1871241951e-18
CAGL0I00352g6.109ON1671061941e-18
Smik_13.1862.569ON1651381932e-18
TPHA0J017506.109ON1691061932e-18
Suva_13.1892.569ON1651381932e-18
Kwal_23.64858.375ON2151351962e-18
TDEL0B056701.436ON2031241952e-18
KNAG0F025706.109ON1511061922e-18
Skud_5.871.436ON2101141952e-18
YMR022W (UBC7)2.569ON1651381922e-18
YEL012W (UBC8)1.436ON2181141962e-18
CAGL0M03399g1.436ON2141241952e-18
Kpol_461.86.109ON1671061922e-18
KLLA0C05632g6.109ON1641061922e-18
Smik_5.981.436ON2151141952e-18
Suva_5.531.436ON2151141953e-18
Skud_13.1762.569ON1651381923e-18
SAKL0H17930g8.230ON1531341913e-18
AGR121C8.230ON1541351913e-18
KLLA0C18656g8.375ON2281341953e-18
KAFR0A047006.109ON1531061904e-18
KLTH0G14366g8.230ON1491021894e-18
Skud_4.3528.230ON1431081885e-18
KAFR0A024208.230ON1471081886e-18
Suva_2.2538.230ON1431081886e-18
Kpol_1030.181.436ON2231241936e-18
Skud_7.2226.109ON1701061897e-18
TDEL0A013408.230ON1571021887e-18
Kpol_1075.1b8.230ON1521081888e-18
YDR092W (UBC13)8.230ON1531341888e-18
Smik_4.3358.230ON1431081878e-18
NDAI0J015408.230ON1541081889e-18
Kwal_34.161741.436ON2131241911e-17
CAGL0G08063g8.230ON1491021861e-17
Ecym_55638.230ON1641021872e-17
SAKL0D10560g1.436ON2071241892e-17
KLLA0A11198g1.436ON2021151892e-17
Kwal_56.234828.230ON1491021852e-17
TDEL0B065702.569ON1651651862e-17
KLLA0C17622g8.230ON1591021862e-17
KAFR0A021602.569ON1651381862e-17
KLTH0H13816g1.436ON2331241892e-17
SAKL0D13552g2.569ON1651441862e-17
NDAI0E038707.54ON1641191852e-17
NCAS0G031301.436ON2311261893e-17
NCAS0A127402.569ON1651381844e-17
KAFR0H012303.308ON1101081804e-17
Ecym_45782.569ON1651441835e-17
ZYRO0E06358g2.569ON1651651835e-17
TPHA0B034108.230ON1521341826e-17
TBLA0H026102.569ON1651441828e-17
KNAG0H029808.230ON1521081818e-17
AEL045W1.436ON2111241849e-17
TBLA0F037908.230ON1511021809e-17
NCAS0B040108.230ON1531021801e-16
KNAG0M021502.569ON1701651801e-16
Ecym_13481.436ON2111241831e-16
NCAS0A059404.49ON1931551785e-16
TDEL0H039707.54ON1561191757e-16
Kpol_1056.52.569ON1651681732e-15
NDAI0B015202.569ON1651381732e-15
ZYRO0D04466g7.54ON1591251722e-15
KLLA0E07745g2.569ON1651621695e-15
TPHA0B007704.249ON1571341671e-14
ABR059W2.569ON1651171661e-14
TBLA0E015704.49ON1941001663e-14
Smik_4.1714.249ON1571341625e-14
Skud_4.1914.249ON1571341601e-13
Smik_12.3894.49ON1871121621e-13
YDL064W (UBC9)4.249ON1571341601e-13
YLR306W (UBC12)4.49ON1881001612e-13
Suva_4.1864.249ON1571341592e-13
NDAI0D043804.249ON1571341564e-13
AER056C4.249ON1571551564e-13
KLLA0E05039g4.249ON1571341555e-13
CAGL0D00814g4.249ON1571341555e-13
Ecym_32704.249ON1571551557e-13
KNAG0D043904.249ON1571341548e-13
SAKL0B10582g7.54ON1611441549e-13
NCAS0A024904.249ON1571341531e-12
Kpol_YGOB_414.24.49ON1931111532e-12
Kpol_414.2singletonOFF1921111532e-12
TDEL0E055604.49ON187971532e-12
KAFR0G032404.249ON1571341512e-12
KLTH0D14344g4.249ON1571341512e-12
SAKL0H03058g4.249ON1571341504e-12
Skud_12.3894.49ON1871131514e-12
KLTH0D01760g7.54ON1611251495e-12
TBLA0I029604.249ON1571341486e-12
Kwal_26.70097.54ON1611441487e-12
Suva_10.4014.49ON1871431497e-12
TPHA0F003904.49ON1931361481e-11
ZYRO0B12386g4.249ON1571341461e-11
KAFR0F030404.49ON169941462e-11
KNAG0I029404.49ON197841435e-11
TDEL0E012204.249ON1571341425e-11
SAKL0H24112g4.49ON1851151428e-11
Ecym_83714.49ON267951449e-11
KLTH0H09504g4.49ON184971411e-10
ZYRO0G19910g4.49ON1791151401e-10
Kpol_483.164.249ON122971361e-10
Kwal_23.42274.249ON122971352e-10
KLLA0C17248g4.49ON184891383e-10
ADL035C4.49ON200951383e-10
CAGL0D06468g4.49ON1871151383e-10
KNAG0H010403.301ON2961471333e-09
NCAS0I014303.301ON2581231324e-09
KAFR0H012703.301ON2871471324e-09
TPHA0M012803.301ON4351631325e-09
TBLA0G032703.301ON3301631317e-09
TDEL0D032603.301ON2891471291e-08
Skud_4.3063.301ON2971661281e-08
Smik_4.2903.301ON2971661281e-08
YDR054C (CDC34)3.301ON2951661282e-08
NDAI0A075703.301ON2391371272e-08
NDAI0A055303.301ON2731631272e-08
KLTH0C04818g3.301ON2751631272e-08
ZYRO0G12650g3.301ON2851471263e-08
CAGL0E04598g3.301ON2951631263e-08
Suva_2.2113.301ON2971661263e-08
KLLA0D09196g3.301ON2921471263e-08
NCAS0A107703.301ON2731631253e-08
Kpol_1065.453.301ON3231631263e-08
AGL203C3.301ON2701631244e-08
Kwal_27.104443.301ON2781471246e-08
SAKL0D02530g3.301ON2721471238e-08
NDAI0D029104.49ON1891231218e-08
Ecym_26693.301ON2681631221e-07
Kpol_1002.656.187ON101611072e-06
KLLA0E20395g7.392ON2511241087e-06
SAKL0F12474g7.392ON2511251061e-05
KNAG0J022803.301ON2171591051e-05
NDAI0E041707.392ON2571271052e-05
Ecym_46837.392ON2431261043e-05
AFL064W6.187ON138941003e-05
TPHA0J022506.187ON137123994e-05
NCAS0E026007.392ON2551221024e-05
TDEL0G015806.187ON138111995e-05
KLTH0H04796g6.187ON138109995e-05
Suva_7.1826.187ON137100986e-05
KNAG0B023607.392ON2511271016e-05
ZYRO0B03344g7.392ON2501241016e-05
SAKL0A05192g6.187ON140126987e-05
CAGL0I05478g7.392ON2461241009e-05
KAFR0C021406.187ON13865971e-04
TPHA0K008207.392ON257124991e-04
KLTH0C06688g7.392ON246127991e-04
AGR372W7.392ON242126991e-04
NCAS0A143907.392ON240129991e-04
ZYRO0G08228g6.187ON138126961e-04
Kpol_1045.397.392ON253124981e-04
Smik_7.1966.187ON10077941e-04
NDAI0A016507.392ON251124972e-04
Skud_5.2257.392ON250124962e-04
KAFR0L017507.392ON251127963e-04
CAGL0H03157g6.187ON139126933e-04
KLLA0E19119g6.187ON139125924e-04
Suva_5.2197.392ON249124945e-04
Kwal_27.108377.392ON246120945e-04
YGL087C (MMS2)6.187ON137100915e-04
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0F02706g
         (161 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0F02706g Chr6 complement(229712..230197) [486 bp, 161 aa] {O...   333   e-118
Kwal_55.21246 s55 (747274..747756) [483 bp, 160 aa] {ON} YGR133W...   181   2e-58
KLTH0F14894g Chr6 (1219767..1220267) [501 bp, 166 aa] {ON} simil...   165   3e-52
NCAS0E00780 Chr5 complement(145435..145950) [516 bp, 171 aa] {ON...   162   4e-51
YGR133W Chr7 (756896..757447) [552 bp, 183 aa] {ON}  PEX4Peroxis...   162   5e-51
ZYRO0D09878g Chr4 complement(834515..834976) [462 bp, 153 aa] {O...   160   1e-50
CAGL0I10450g Chr9 complement(1035489..1035977) [489 bp, 162 aa] ...   158   1e-49
Suva_7.421 Chr7 (727108..727605) [498 bp, 165 aa] {ON} YGR133W (...   157   3e-49
NDAI0G00910 Chr7 complement(191811..192302) [492 bp, 163 aa] {ON...   155   2e-48
Smik_6.229 Chr6 (374835..375332) [498 bp, 165 aa] {ON} YGR133W (...   155   2e-48
Skud_7.444 Chr7 (736148..736633) [486 bp, 162 aa] {ON} YGR133W (...   152   2e-47
TDEL0D05630 Chr4 (1013302..1013754) [453 bp, 150 aa] {ON} Anc_3....   150   1e-46
TPHA0D04260 Chr4 (920720..921196) [477 bp, 158 aa] {ON} Anc_3.49...   149   5e-46
Kpol_480.13 s480 complement(27113..27586) [474 bp, 157 aa] {ON} ...   149   5e-46
Ecym_1234 Chr1 complement(482339..482824) [486 bp, 161 aa] {ON} ...   128   1e-37
TBLA0C04500 Chr3 (1089815..1090312) [498 bp, 165 aa] {ON} Anc_3....   126   4e-37
AFR314W Chr6 (1006415..1006882) [468 bp, 155 aa] {ON} Syntenic h...   125   7e-37
KAFR0C01990 Chr3 (395423..395878) [456 bp, 151 aa] {ON} Anc_3.49...   122   1e-35
KNAG0B00780 Chr2 complement(145805..146266) [462 bp, 153 aa] {ON...   112   1e-31
KLLA0E04027g Chr5 complement(365119..365595) [477 bp, 158 aa] {O...    97   9e-26
KAFR0C00270 Chr3 (47414..47457,47593..47992) [444 bp, 147 aa] {O...    92   7e-24
KLTH0E14300g Chr5 complement(1265287..1265686,1265893..1265936) ...    92   8e-24
SAKL0B06512g Chr2 complement(557855..558254,558581..558624) [444...    92   8e-24
AER173C Chr5 complement(960420..960863) [444 bp, 147 aa] {ON} Sy...    92   8e-24
Ecym_7431 Chr7 complement(883095..883538) [444 bp, 147 aa] {ON} ...    92   8e-24
TDEL0F02100 Chr6 (382357..382400,382469..382868) [444 bp, 147 aa...    91   3e-23
ZYRO0G12870g Chr7 complement(1022897..1023296,1023388..1023431) ...    90   5e-23
NDAI0A05490 Chr1 (1240963..1241006,1241105..1241504) [444 bp, 14...    90   6e-23
TBLA0I02130 Chr9 complement(489054..489453,489732..489778) [447 ...    89   1e-22
Kpol_1052.2 s1052 (6121..6167,6406..6805) [447 bp, 148 aa] {ON} ...    89   2e-22
TPHA0L00850 Chr12 (168648..169298) [651 bp, 216 aa] {ON} Anc_8.3...    91   2e-22
TPHA0A03850 Chr1 (846488..846534,846907..847306) [447 bp, 148 aa...    89   2e-22
Kpol_1030.10 s1030 complement(21147..21794) [648 bp, 215 aa] {ON...    91   2e-22
CAGL0E04752g Chr5 complement(456202..456645) [444 bp, 147 aa] {O...    88   3e-22
KLLA0E12563g Chr5 (1117022..1117068,1117342..1117741) [447 bp, 1...    88   4e-22
KNAG0A04810 Chr1 complement(689230..689874) [645 bp, 214 aa] {ON...    89   5e-22
NCAS0A10800 Chr1 complement(2150862..2151261,2151377..2151423) [...    88   5e-22
KNAG0J02340 Chr10 complement(439355..439840) [486 bp, 161 aa] {O...    87   8e-22
ZYRO0C03784g Chr3 (301102..301758) [657 bp, 218 aa] {ON} highly ...    88   1e-21
Suva_2.218 Chr2 complement(369003..369402,369494..369540) [447 b...    86   2e-21
Skud_4.314 Chr4 complement(545266..545665,545759..545805) [447 b...    86   2e-21
YDR059C Chr4 complement(569234..569633,569724..569770) [447 bp, ...    86   2e-21
CAGL0E00671g Chr5 complement(61697..62338) [642 bp, 213 aa] {ON}...    88   2e-21
Smik_4.297 Chr4 complement(535773..536172,536260..536306) [447 b...    86   3e-21
YOR339C Chr15 complement(958362..958832) [471 bp, 156 aa] {ON}  ...    86   3e-21
TBLA0H03130 Chr8 (763830..764474) [645 bp, 214 aa] {ON} Anc_8.37...    87   4e-21
Kwal_27.12401 s27 complement(1209894..1210604) [711 bp, 236 aa] ...    87   4e-21
NDAI0A01160 Chr1 complement(245057..245707) [651 bp, 216 aa] {ON}      87   6e-21
TDEL0F04990 Chr6 (941804..942457) [654 bp, 217 aa] {ON} Anc_8.37...    87   7e-21
Kpol_1065.12 s1065 (25814..26293) [480 bp, 159 aa] {ON} (25814.....    85   9e-21
Suva_4.326 Chr4 complement(575255..575654,575770..575816) [447 b...    84   9e-21
Smik_15.517 Chr15 complement(907953..908423) [471 bp, 156 aa] {O...    84   2e-20
Skud_2.207 Chr2 complement(374501..374900,375003..375049) [447 b...    84   2e-20
Smik_2.219 Chr2 complement(389737..390136,390239..390285) [447 b...    84   2e-20
YBR082C Chr2 complement(406628..407027,407123..407169) [447 bp, ...    84   2e-20
KAFR0B06060 Chr2 (1251667..1252308) [642 bp, 213 aa] {ON} Anc_8....    84   4e-20
NCAS0B03150 Chr2 complement(544870..545514) [645 bp, 214 aa] {ON}      84   4e-20
Suva_8.389 Chr8 complement(700070..700540) [471 bp, 156 aa] {ON}...    83   5e-20
Skud_15.504 Chr15 complement(898776..899246) [471 bp, 156 aa] {O...    83   5e-20
Skud_4.441 Chr4 (783817..784464) [648 bp, 215 aa] {ON} YDR177W (...    84   7e-20
Suva_2.343 Chr2 (608195..608842) [648 bp, 215 aa] {ON} YDR177W (...    84   8e-20
Smik_4.425 Chr4 (772926..773573) [648 bp, 215 aa] {ON} YDR177W (...    84   8e-20
YDR177W Chr4 (816878..817525) [648 bp, 215 aa] {ON}  UBC1Ubiquit...    84   9e-20
TPHA0I02460 Chr9 (549215..549718) [504 bp, 167 aa] {ON} Anc_2.56...    82   1e-19
ADR169C Chr4 complement(1000734..1001369) [636 bp, 211 aa] {ON} ...    83   1e-19
Kwal_14.1828 s14 (488274..488732) [459 bp, 152 aa] {ON} YGL058W ...    81   2e-19
Ecym_6038 Chr6 (73539..74174) [636 bp, 211 aa] {ON} similar to A...    83   2e-19
TBLA0A01290 Chr1 complement(306004..306658,306780..306784) [660 ...    83   2e-19
NCAS0D03220 Chr4 (604785..605300) [516 bp, 171 aa] {ON} Anc_6.109      82   2e-19
KLTH0H06732g Chr8 (592074..592115,592201..592641) [483 bp, 160 a...    81   2e-19
KLTH0D07986g Chr4 (679875..680372) [498 bp, 165 aa] {ON} highly ...    81   4e-19
TPHA0O00920 Chr15 (170342..171022) [681 bp, 226 aa] {ON} Anc_1.4...    82   5e-19
NDAI0D01140 Chr4 (259072..259076,259218..259950) [738 bp, 245 aa...    82   5e-19
ZYRO0B11682g Chr2 (920866..921321) [456 bp, 151 aa] {ON} highly ...    80   5e-19
ZYRO0C04950g Chr3 (389805..389846,389914..390378) [507 bp, 168 a...    80   7e-19
SAKL0A00396g Chr1 complement(43630..44277) [648 bp, 215 aa] {ON}...    81   7e-19
YGL058W Chr7 (393986..394504) [519 bp, 172 aa] {ON}  RAD6Ubiquit...    80   7e-19
AAR156C Chr1 complement(626372..626884) [513 bp, 170 aa] {ON} Sy...    80   7e-19
TDEL0G03610 Chr7 (667177..667218,667282..667749) [510 bp, 169 aa...    80   8e-19
SAKL0A07260g Chr1 (644551..644592,644678..645145) [510 bp, 169 a...    80   8e-19
Smik_7.222 Chr7 (388521..389036) [516 bp, 171 aa] {ON} YGL058W (...    80   8e-19
Ecym_3077 Chr3 (145205..145717) [513 bp, 170 aa] {ON} similar to...    80   8e-19
CAGL0M07568g Chr13 complement(758110..758607) [498 bp, 165 aa] {...    80   8e-19
Suva_7.213 Chr7 (387129..387650) [522 bp, 173 aa] {ON} YGL058W (...    80   8e-19
TBLA0F02440 Chr6 complement(594780..595304) [525 bp, 174 aa] {ON...    80   1e-18
KNAG0H01870 Chr8 complement(332441..333073) [633 bp, 210 aa] {ON...    80   1e-18
ZYRO0E03806g Chr5 (288494..288498,288563..289187) [630 bp, 209 a...    80   1e-18
KLTH0A07546g Chr1 (635570..636217) [648 bp, 215 aa] {ON} highly ...    80   1e-18
NDAI0I01650 Chr9 complement(388545..389075) [531 bp, 176 aa] {ON}      80   1e-18
Kwal_26.8224 s26 (695345..695842) [498 bp, 165 aa] {ON} YMR022W ...    79   1e-18
KAFR0H02960 Chr8 complement(566019..566582) [564 bp, 187 aa] {ON...    80   1e-18
CAGL0I00352g Chr9 (26900..27403) [504 bp, 167 aa] {ON} highly si...    79   1e-18
Smik_13.186 Chr13 (310465..310962) [498 bp, 165 aa] {ON} YMR022W...    79   2e-18
TPHA0J01750 Chr10 complement(404340..404849) [510 bp, 169 aa] {O...    79   2e-18
Suva_13.189 Chr13 (309254..309751) [498 bp, 165 aa] {ON} YMR022W...    79   2e-18
Kwal_23.6485 s23 (1608161..1608808) [648 bp, 215 aa] {ON} YDR177...    80   2e-18
TDEL0B05670 Chr2 (1001037..1001648) [612 bp, 203 aa] {ON} Anc_1....    80   2e-18
KNAG0F02570 Chr6 (482998..483453) [456 bp, 151 aa] {ON} Anc_6.10...    79   2e-18
Skud_5.87 Chr5 (131751..132380) [630 bp, 210 aa] {ON} YEL012W (R...    80   2e-18
YMR022W Chr13 (318680..319177) [498 bp, 165 aa] {ON}  UBC7Ubiqui...    79   2e-18
YEL012W Chr5 (131772..131776,131900..132551) [657 bp, 218 aa] {O...    80   2e-18
CAGL0M03399g Chr13 complement(389650..390294) [645 bp, 214 aa] {...    80   2e-18
Kpol_461.8 s461 (14306..14809) [504 bp, 167 aa] {ON} (14306..148...    79   2e-18
KLLA0C05632g Chr3 complement(503484..503978) [495 bp, 164 aa] {O...    79   2e-18
Smik_5.98 Chr5 (138141..138145,138263..138905) [648 bp, 215 aa] ...    80   2e-18
Suva_5.53 Chr5 complement(95600..96242,96354..96358) [648 bp, 21...    80   3e-18
Skud_13.176 Chr13 (305317..305814) [498 bp, 165 aa] {ON} YMR022W...    79   3e-18
SAKL0H17930g Chr8 complement(1598218..1598649,1598712..1598741) ...    78   3e-18
AGR121C Chr7 complement(977481..977915,977965..977994) [465 bp, ...    78   3e-18
KLLA0C18656g Chr3 (1654787..1655473) [687 bp, 228 aa] {ON} highl...    80   3e-18
KAFR0A04700 Chr1 (930462..930923) [462 bp, 153 aa] {ON} Anc_6.10...    78   4e-18
KLTH0G14366g Chr7 (1251249..1251278,1251389..1251808) [450 bp, 1...    77   4e-18
Skud_4.352 Chr4 (607037..607465) [429 bp, 143 aa] {ON} YDR092W (...    77   5e-18
KAFR0A02420 Chr1 complement(506887..507330) [444 bp, 147 aa] {ON...    77   6e-18
Suva_2.253 Chr2 (429581..430009) [429 bp, 143 aa] {ON} YDR092W (...    77   6e-18
Kpol_1030.18 s1030 (30890..30894,31122..31788) [672 bp, 223 aa] ...    79   6e-18
Skud_7.222 Chr7 (397309..397821) [513 bp, 170 aa] {ON} YGL058W (...    77   7e-18
TDEL0A01340 Chr1 complement(239400..239843,239923..239952) [474 ...    77   7e-18
Kpol_1075.1b s1075 (1500..1958) [459 bp, 152 aa] {ON} (1500..195...    77   8e-18
YDR092W Chr4 (629876..629905,630174..630605) [462 bp, 153 aa] {O...    77   8e-18
Smik_4.335 Chr4 (596360..596788) [429 bp, 143 aa] {ON} YDR092W (...    77   8e-18
NDAI0J01540 Chr10 complement(362018..362452,362599..362628) [465...    77   9e-18
Kwal_34.16174 s34 (229678..230319) [642 bp, 213 aa] {ON} YEL012W...    78   1e-17
CAGL0G08063g Chr7 (761662..762111) [450 bp, 149 aa] {ON} highly ...    76   1e-17
Ecym_5563 Chr5 (1146448..1146477,1146598..1147062) [495 bp, 164 ...    77   2e-17
SAKL0D10560g Chr4 complement(885746..886369) [624 bp, 207 aa] {O...    77   2e-17
KLLA0A11198g Chr1 complement(973755..974358,974525..974529) [609...    77   2e-17
Kwal_56.23482 s56 complement(559955..560404) [450 bp, 149 aa] {O...    76   2e-17
TDEL0B06570 Chr2 (1164122..1164619) [498 bp, 165 aa] {ON} Anc_2....    76   2e-17
KLLA0C17622g Chr3 (1555873..1555902,1556004..1556453) [480 bp, 1...    76   2e-17
KAFR0A02160 Chr1 (452814..453311) [498 bp, 165 aa] {ON} Anc_2.56...    76   2e-17
KLTH0H13816g Chr8 complement(1208214..1208910,1209008..1209012) ...    77   2e-17
SAKL0D13552g Chr4 (1123716..1124213) [498 bp, 165 aa] {ON} highl...    76   2e-17
NDAI0E03870 Chr5 complement(850773..851267) [495 bp, 164 aa] {ON...    76   2e-17
NCAS0G03130 Chr7 (575808..576503) [696 bp, 231 aa] {ON}                77   3e-17
NCAS0A12740 Chr1 (2515651..2516148) [498 bp, 165 aa] {ON} Anc_2....    75   4e-17
KAFR0H01230 Chr8 (229718..230050) [333 bp, 110 aa] {ON} Anc_3.30...    74   4e-17
Ecym_4578 Chr4 complement(1130475..1130972) [498 bp, 165 aa] {ON...    75   5e-17
ZYRO0E06358g Chr5 (484003..484500) [498 bp, 165 aa] {ON} highly ...    75   5e-17
TPHA0B03410 Chr2 complement(793271..793729) [459 bp, 152 aa] {ON...    75   6e-17
TBLA0H02610 Chr8 complement(617205..617702) [498 bp, 165 aa] {ON...    75   8e-17
KNAG0H02980 Chr8 (551453..551482,551689..552117) [459 bp, 152 aa...    74   8e-17
AEL045W Chr5 (549376..549380,549444..550074) [636 bp, 211 aa] {O...    75   9e-17
TBLA0F03790 Chr6 (936410..936865) [456 bp, 151 aa] {ON} Anc_4.49...    74   9e-17
NCAS0B04010 Chr2 complement(724414..724845,724986..725015) [462 ...    74   1e-16
KNAG0M02150 Chr13 (400133..400645) [513 bp, 170 aa] {ON} Anc_2.5...    74   1e-16
Ecym_1348 Chr1 complement(720137..720767,720872..720876) [636 bp...    75   1e-16
NCAS0A05940 Chr1 (1171599..1172180) [582 bp, 193 aa] {ON} Anc_4.49     73   5e-16
TDEL0H03970 Chr8 complement(677619..678089) [471 bp, 156 aa] {ON...    72   7e-16
Kpol_1056.5 s1056 complement(8947..9444) [498 bp, 165 aa] {ON} c...    71   2e-15
NDAI0B01520 Chr2 complement(356566..357063) [498 bp, 165 aa] {ON...    71   2e-15
ZYRO0D04466g Chr4 complement(370627..371106) [480 bp, 159 aa] {O...    71   2e-15
KLLA0E07745g Chr5 complement(693694..694191) [498 bp, 165 aa] {O...    70   5e-15
TPHA0B00770 Chr2 (173656..174129) [474 bp, 157 aa] {ON} Anc_4.24...    69   1e-14
ABR059W Chr2 (503221..503718) [498 bp, 165 aa] {ON} Syntenic hom...    69   1e-14
TBLA0E01570 Chr5 complement(371348..371929,372031..372033) [585 ...    69   3e-14
Smik_4.171 Chr4 (313921..313958,314069..314504) [474 bp, 157 aa]...    67   5e-14
Skud_4.191 Chr4 (332944..332981,333094..333529) [474 bp, 157 aa]...    66   1e-13
Smik_12.389 Chr12 (682460..683020) [561 bp, 187 aa] {ON} YLR306W...    67   1e-13
YDL064W Chr4 (337487..337524,337635..338070) [474 bp, 157 aa] {O...    66   1e-13
YLR306W Chr12 (744151..744153,744288..744851) [567 bp, 188 aa] {...    67   2e-13
Suva_4.186 Chr4 (327039..327076,327179..327614) [474 bp, 157 aa]...    66   2e-13
NDAI0D04380 Chr4 (1027182..1027219,1027322..1027757) [474 bp, 15...    65   4e-13
AER056C Chr5 complement(741224..741659,741718..741755) [474 bp, ...    65   4e-13
KLLA0E05039g Chr5 (443446..443919) [474 bp, 157 aa] {ON} highly ...    64   5e-13
CAGL0D00814g Chr4 (98589..99062) [474 bp, 157 aa] {ON} highly si...    64   5e-13
Ecym_3270 Chr3 (511488..511525,511617..512052) [474 bp, 157 aa] ...    64   7e-13
KNAG0D04390 Chr4 complement(797747..798220) [474 bp, 157 aa] {ON...    64   8e-13
SAKL0B10582g Chr2 complement(914784..915269) [486 bp, 161 aa] {O...    64   9e-13
NCAS0A02490 Chr1 complement(474534..474969,475041..475078) [474 ...    64   1e-12
Kpol_YGOB_414.2 s414 complement(6958..7536,7733..7735) [582 bp, ...    64   2e-12
Kpol_414.2 s414 complement(6958..7536) [579 bp, 192 aa] {OFF} co...    64   2e-12
TDEL0E05560 Chr5 complement(1024888..1025448,1025504..1025506) [...    64   2e-12
KAFR0G03240 Chr7 complement(673831..674304) [474 bp, 157 aa] {ON...    63   2e-12
KLTH0D14344g Chr4 complement(1178849..1179284,1179376..1179413) ...    63   2e-12
SAKL0H03058g Chr8 (288751..288788,288851..289286) [474 bp, 157 a...    62   4e-12
Skud_12.389 Chr12 (685275..685835) [561 bp, 187 aa] {ON} YLR306W...    63   4e-12
KLTH0D01760g Chr4 (171356..171841) [486 bp, 161 aa] {ON} highly ...    62   5e-12
TBLA0I02960 Chr9 complement(706068..706503,706636..706673) [474 ...    62   6e-12
Kwal_26.7009 s26 (162391..162876) [486 bp, 161 aa] {ON} YOR339C ...    62   7e-12
Suva_10.401 Chr10 (705317..705877) [561 bp, 187 aa] {ON} YLR306W...    62   7e-12
TPHA0F00390 Chr6 complement(90730..91308,91376..91378) [582 bp, ...    62   1e-11
ZYRO0B12386g Chr2 complement(1001376..1001849) [474 bp, 157 aa] ...    61   1e-11
KAFR0F03040 Chr6 complement(599277..599786) [510 bp, 169 aa] {ON...    61   2e-11
KNAG0I02940 Chr9 (581958..582063,582240..582727) [594 bp, 197 aa...    60   5e-11
TDEL0E01220 Chr5 (240860..241333) [474 bp, 157 aa] {ON} Anc_4.24...    59   5e-11
SAKL0H24112g Chr8 (2080968..2080970,2081030..2081584) [558 bp, 1...    59   8e-11
Ecym_8371 Chr8 (747395..748198) [804 bp, 267 aa] {ON} similar to...    60   9e-11
KLTH0H09504g Chr8 complement(817855..818406,818463..818465) [555...    59   1e-10
ZYRO0G19910g Chr7 (1650667..1651206) [540 bp, 179 aa] {ON} simil...    59   1e-10
Kpol_483.16 s483 complement(45694..46062) [369 bp, 122 aa] {ON} ...    57   1e-10
Kwal_23.4227 s23 (626678..627046) [369 bp, 122 aa] {ON} YDL064W ...    57   2e-10
KLLA0C17248g Chr3 complement(1509885..1510439) [555 bp, 184 aa] ...    58   3e-10
ADL035C Chr4 complement(634056..634607,634660..634710) [603 bp, ...    58   3e-10
CAGL0D06468g Chr4 (615364..615927) [564 bp, 187 aa] {ON} similar...    58   3e-10
KNAG0H01040 Chr8 (174417..175307) [891 bp, 296 aa] {ON}                56   3e-09
NCAS0I01430 Chr9 (264456..265232) [777 bp, 258 aa] {ON}                55   4e-09
KAFR0H01270 Chr8 (239005..239868) [864 bp, 287 aa] {ON}                55   4e-09
TPHA0M01280 Chr13 complement(262582..263889) [1308 bp, 435 aa] {...    55   5e-09
TBLA0G03270 Chr7 complement(866771..867763) [993 bp, 330 aa] {ON...    55   7e-09
TDEL0D03260 Chr4 (610053..610922) [870 bp, 289 aa] {ON} Anc_3.30...    54   1e-08
Skud_4.306 Chr4 complement(537399..538292) [894 bp, 297 aa] {ON}...    54   1e-08
Smik_4.290 Chr4 complement(527854..528747) [894 bp, 297 aa] {ON}...    54   1e-08
YDR054C Chr4 complement(561440..562327) [888 bp, 295 aa] {ON}  C...    54   2e-08
NDAI0A07570 Chr1 complement(1734788..1735507) [720 bp, 239 aa] {...    54   2e-08
NDAI0A05530 Chr1 (1251593..1252414) [822 bp, 273 aa] {ON} Anc_3....    54   2e-08
KLTH0C04818g Chr3 (416167..416994) [828 bp, 275 aa] {ON} highly ...    54   2e-08
ZYRO0G12650g Chr7 complement(1002296..1003153) [858 bp, 285 aa] ...    53   3e-08
CAGL0E04598g Chr5 complement(444525..445412) [888 bp, 295 aa] {O...    53   3e-08
Suva_2.211 Chr2 complement(361071..361964) [894 bp, 297 aa] {ON}...    53   3e-08
KLLA0D09196g Chr4 (772795..773673) [879 bp, 292 aa] {ON} similar...    53   3e-08
NCAS0A10770 Chr1 complement(2142376..2143197) [822 bp, 273 aa] {...    53   3e-08
Kpol_1065.45 s1065 (121426..122397) [972 bp, 323 aa] {ON} (12142...    53   3e-08
AGL203C Chr7 complement(317749..318561) [813 bp, 270 aa] {ON} Sy...    52   4e-08
Kwal_27.10444 s27 (347585..348421) [837 bp, 278 aa] {ON} YDR054C...    52   6e-08
SAKL0D02530g Chr4 (200047..200865) [819 bp, 272 aa] {ON} highly ...    52   8e-08
NDAI0D02910 Chr4 (685459..686028) [570 bp, 189 aa] {ON} Anc_4.49       51   8e-08
Ecym_2669 Chr2 (1289437..1290243) [807 bp, 268 aa] {ON} similar ...    52   1e-07
Kpol_1002.65 s1002 (176569..176874) [306 bp, 101 aa] {ON} (17656...    46   2e-06
KLLA0E20395g Chr5 (1814618..1815373) [756 bp, 251 aa] {ON} simil...    46   7e-06
SAKL0F12474g Chr6 (974485..975240) [756 bp, 251 aa] {ON} similar...    45   1e-05
KNAG0J02280 Chr10 complement(424795..425448) [654 bp, 217 aa] {O...    45   1e-05
NDAI0E04170 Chr5 complement(940288..941061) [774 bp, 257 aa] {ON...    45   2e-05
Ecym_4683 Chr4 complement(1330525..1331256) [732 bp, 243 aa] {ON...    45   3e-05
AFL064W Chr6 (314210..314220,314273..314678) [417 bp, 138 aa] {O...    43   3e-05
TPHA0J02250 Chr10 complement(501615..502017,502181..502191) [414...    43   4e-05
NCAS0E02600 Chr5 complement(519792..520559) [768 bp, 255 aa] {ON...    44   4e-05
TDEL0G01580 Chr7 (311978..311988,312055..312460) [417 bp, 138 aa...    43   5e-05
KLTH0H04796g Chr8 (428760..428770,428834..429239) [417 bp, 138 a...    43   5e-05
Suva_7.182 Chr7 complement(339292..339694,339786..339796) [414 b...    42   6e-05
KNAG0B02360 Chr2 complement(462478..463233) [756 bp, 251 aa] {ON...    44   6e-05
ZYRO0B03344g Chr2 (278107..278859) [753 bp, 250 aa] {ON} similar...    44   6e-05
SAKL0A05192g Chr1 (468949..468959,469039..469450) [423 bp, 140 a...    42   7e-05
CAGL0I05478g Chr9 complement(518933..519673) [741 bp, 246 aa] {O...    43   9e-05
KAFR0C02140 Chr3 complement(427907..428312,428412..428422) [417 ...    42   1e-04
TPHA0K00820 Chr11 complement(172380..173153) [774 bp, 257 aa] {O...    43   1e-04
KLTH0C06688g Chr3 complement(581697..582437) [741 bp, 246 aa] {O...    43   1e-04
AGR372W Chr7 (1420314..1421042) [729 bp, 242 aa] {ON} Syntenic h...    43   1e-04
NCAS0A14390 Chr1 (2833944..2834666) [723 bp, 240 aa] {ON} Anc_7....    43   1e-04
ZYRO0G08228g Chr7 complement(670807..671212,671271..671281) [417...    42   1e-04
Kpol_1045.39 s1045 complement(92062..92823) [762 bp, 253 aa] {ON...    42   1e-04
Smik_7.196 Chr7 complement(340809..341111) [303 bp, 100 aa] {ON}...    41   1e-04
NDAI0A01650 Chr1 complement(365515..366270) [756 bp, 251 aa] {ON...    42   2e-04
Skud_5.225 Chr5 (355576..356328) [753 bp, 250 aa] {ON} YER100W (...    42   2e-04
KAFR0L01750 Chr12 (320295..321050) [756 bp, 251 aa] {ON} Anc_7.3...    42   3e-04
CAGL0H03157g Chr8 complement(297272..297680,297881..297891) [420...    40   3e-04
KLLA0E19119g Chr5 complement(1702717..1703125,1703226..1703236) ...    40   4e-04
Suva_5.219 Chr5 (333753..334502) [750 bp, 249 aa] {ON} YER100W (...    41   5e-04
Kwal_27.10837 s27 complement(519750..520490) [741 bp, 246 aa] {O...    41   5e-04
YGL087C Chr7 complement(346406..346808,346894..346904) [414 bp, ...    40   5e-04
Kwal_27.11182 s27 complement(675053..675358) [306 bp, 101 aa] {O...    39   6e-04
Smik_5.246 Chr5 (368531..369283) [753 bp, 250 aa] {ON} YER100W (...    40   7e-04
YER100W Chr5 (359562..360314) [753 bp, 250 aa] {ON}  UBC6Ubiquit...    40   7e-04
KNAG0F02130 Chr6 (405648..406064) [417 bp, 138 aa] {ON} Anc_6.18...    39   9e-04
TBLA0D00600 Chr4 complement(156677..157447) [771 bp, 256 aa] {ON...    40   0.001
Skud_7.195 Chr7 complement(349627..349929) [303 bp, 100 aa] {ON}...    38   0.001
NCAS0D03660 Chr4 complement(683552..683957,684062..684072) [417 ...    37   0.005
TDEL0C01550 Chr3 complement(267010..267756) [747 bp, 248 aa] {ON...    38   0.005
Ecym_2230 Chr2 (447891..447901,447985..448390) [417 bp, 138 aa] ...    35   0.017
NDAI0I01230 Chr9 (296124..296160,296450..296886) [474 bp, 157 aa...    33   0.22 
TBLA0A01900 Chr1 complement(463994..464402,464500..464510) [420 ...    32   0.34 
Kwal_56.23667 s56 (648082..649137) [1056 bp, 351 aa] {ON} YLR105...    30   1.7  
KAFR0K00430 Chr11 complement(91053..93344) [2292 bp, 763 aa] {ON...    30   3.4  
KLTH0G06468g Chr7 complement(513119..518251) [5133 bp, 1710 aa] ...    30   3.8  

>SAKL0F02706g Chr6 complement(229712..230197) [486 bp, 161 aa] {ON}
           similar to uniprot|P29340 Saccharomyces cerevisiae
           YGR133W PEX4 Involved in peroxisome biogenesis Member of
           ubiquitin-conjugating protein family
          Length = 161

 Score =  333 bits (853), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 161/161 (100%), Positives = 161/161 (100%)

Query: 1   MSLQRITKEFKSVRKTLAEDPSYNHILKLEPKDTGNMYHWIADISGPPETPYASAVFALD 60
           MSLQRITKEFKSVRKTLAEDPSYNHILKLEPKDTGNMYHWIADISGPPETPYASAVFALD
Sbjct: 1   MSLQRITKEFKSVRKTLAEDPSYNHILKLEPKDTGNMYHWIADISGPPETPYASAVFALD 60

Query: 61  VELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTREHWSPVWDLVHVIHAIW 120
           VELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTREHWSPVWDLVHVIHAIW
Sbjct: 61  VELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTREHWSPVWDLVHVIHAIW 120

Query: 121 ILLGEPVPESPLNVDIANVLKAGDLEAYEGLIKYYIGMNGV 161
           ILLGEPVPESPLNVDIANVLKAGDLEAYEGLIKYYIGMNGV
Sbjct: 121 ILLGEPVPESPLNVDIANVLKAGDLEAYEGLIKYYIGMNGV 161

>Kwal_55.21246 s55 (747274..747756) [483 bp, 160 aa] {ON} YGR133W
           (PEX4) - Member of ubiquitin-conjugating protein family
           [contig 130] FULL
          Length = 160

 Score =  181 bits (458), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 80/153 (52%), Positives = 113/153 (73%), Gaps = 3/153 (1%)

Query: 4   QRITKEFKSVRKTLAEDPSYNHILKLEPKDTGNMYHWIADISGPPETPYASAVFALDVEL 63
           QR+ KE+K++ KTL EDP+Y+HI KL P    N+Y W ADI+GP +TPY    F+L + +
Sbjct: 3   QRLAKEYKTLLKTLKEDPAYSHIRKLRPVSDDNLYVWEADITGPSDTPYQGHEFSLLITI 62

Query: 64  PIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTREHWSPVWDLVHVIHAIWILL 123
           P  YPLEPP+V+F   +   + HCNVDF++G IC+++L R HWSP WDL+H++HAIW+LL
Sbjct: 63  PSAYPLEPPKVQF---NARCVPHCNVDFESGRICINLLERAHWSPAWDLLHLVHAIWLLL 119

Query: 124 GEPVPESPLNVDIANVLKAGDLEAYEGLIKYYI 156
             P P+SPL+VD+A + +AGD  A+ GL+ YY+
Sbjct: 120 ANPEPDSPLDVDLACLRRAGDYSAHNGLVAYYL 152

>KLTH0F14894g Chr6 (1219767..1220267) [501 bp, 166 aa] {ON} similar
           to uniprot|P29340 Saccharomyces cerevisiae YGR133W PEX4
           Involved in peroxisome biogenesis Member of
           ubiquitin-conjugating protein family
          Length = 166

 Score =  165 bits (417), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 74/153 (48%), Positives = 103/153 (67%), Gaps = 3/153 (1%)

Query: 4   QRITKEFKSVRKTLAEDPSYNHILKLEPKDTGNMYHWIADISGPPETPYASAVFALDVEL 63
           QR+ KE++++ KTL  DP Y +I+ L P    N+  W + I+GPP+TPY    F L +E 
Sbjct: 3   QRLAKEYRALSKTLGRDPEYAYIISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIEA 62

Query: 64  PIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTREHWSPVWDLVHVIHAIWILL 123
              YPLEPP+V+F       + HCNVDF +G ICL +L   HW+P WDL+HV+HAIW+LL
Sbjct: 63  SEAYPLEPPKVQF---QARCMPHCNVDFDSGRICLSVLDAAHWTPAWDLLHVVHAIWLLL 119

Query: 124 GEPVPESPLNVDIANVLKAGDLEAYEGLIKYYI 156
             P P+SPL+VD+A +++AGD  A+  LI YY+
Sbjct: 120 ASPEPDSPLDVDLACLVRAGDRSAHNSLIAYYL 152

>NCAS0E00780 Chr5 complement(145435..145950) [516 bp, 171 aa] {ON}
           Anc_3.495
          Length = 171

 Score =  162 bits (410), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 78/165 (47%), Positives = 108/165 (65%), Gaps = 13/165 (7%)

Query: 3   LQRITKEFKSVRKTLA---------EDPSYNHILK-LEPKDTGNMYHWIADISGPPETPY 52
           + R+ KE+K ++ TL+         +D  +N I+  L P  T ++ HW A I GP  TPY
Sbjct: 1   MSRLLKEYKKIQTTLSPNSTHHNNNDDDEFNQIITYLHPISTSDLTHWQAQIKGPQGTPY 60

Query: 53  ASAVFALDVELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTREHWSPVWDL 112
           A+  F L +E P  YP+EPP + F P S   + HCNV+F+TG ICLDIL ++HW+P W+L
Sbjct: 61  ANHEFQLQIECPPTYPIEPPIIHFQPLS---MPHCNVNFQTGAICLDILEKQHWTPAWNL 117

Query: 113 VHVIHAIWILLGEPVPESPLNVDIANVLKAGDLEAYEGLIKYYIG 157
           +  + AIWILL +PVP+SPLNVDIAN+L+  D  AY GL+ YY+ 
Sbjct: 118 MTTMKAIWILLKDPVPDSPLNVDIANILRVNDQSAYNGLLNYYLS 162

>YGR133W Chr7 (756896..757447) [552 bp, 183 aa] {ON}
           PEX4Peroxisomal ubiquitin conjugating enzyme required
           for peroxisomal matrix protein import and peroxisome
           biogenesis
          Length = 183

 Score =  162 bits (411), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 77/160 (48%), Positives = 108/160 (67%), Gaps = 8/160 (5%)

Query: 3   LQRITKEFKSVRKTLAED-----PSYNHILKLEPKDTGNMYHWIADISGPPETPYASAVF 57
           + RI KE+K + KTLA D     P    I  L P D  ++  W A ISGP +TPY +  F
Sbjct: 19  MSRIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYENHQF 78

Query: 58  ALDVELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTREHWSPVWDLVHVIH 117
            + +E+P  YP+ PP++ F+   +NNI HCNV   TGEICL+IL  E W+PVWDL+H +H
Sbjct: 79  RILIEVPSSYPMNPPKISFM---QNNILHCNVKSATGEICLNILKPEEWTPVWDLLHCVH 135

Query: 118 AIWILLGEPVPESPLNVDIANVLKAGDLEAYEGLIKYYIG 157
           A+W LL EPV +SPL+VDI N+++ GD+ AY+G++KY++ 
Sbjct: 136 AVWRLLREPVCDSPLDVDIGNIIRCGDMSAYQGIVKYFLA 175

>ZYRO0D09878g Chr4 complement(834515..834976) [462 bp, 153 aa] {ON}
           similar to uniprot|P29340 Saccharomyces cerevisiae
           YGR133W PEX4 Involved in peroxisome biogenesis Member of
           ubiquitin-conjugating protein family
          Length = 153

 Score =  160 bits (406), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 84/156 (53%), Positives = 107/156 (68%), Gaps = 7/156 (4%)

Query: 3   LQRITKEFKSVRKTLAE-DPSYNH-ILKLEPKDTGNMYHWIADISGPPETPYASAVFALD 60
           + R  KE+K++ K L E D  Y+  I+ +EPK+  ++  W A I GP  TPY    F L 
Sbjct: 1   MSRAAKEYKTITKVLKEGDEVYSQLIVGMEPKE--DLTRWEALIRGPSGTPYEGCNFRLH 58

Query: 61  VELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTREHWSPVWDLVHVIHAIW 120
           + LP +YP+ PP VKF P +   + H NVDF+TGEICLDILT++HWSP WDL+HV+ AI 
Sbjct: 59  LSLPQEYPMSPPYVKFEPYA---MPHANVDFRTGEICLDILTKQHWSPAWDLLHVVQAIG 115

Query: 121 ILLGEPVPESPLNVDIANVLKAGDLEAYEGLIKYYI 156
            LL EPV  SPLNVDIAN+LKA D+ AY GL+ YYI
Sbjct: 116 QLLDEPVSSSPLNVDIANILKANDMNAYYGLVHYYI 151

>CAGL0I10450g Chr9 complement(1035489..1035977) [489 bp, 162 aa]
           {ON} similar to uniprot|P29340 Saccharomyces cerevisiae
           YGR133w ubiquitin-conjugating enzyme - peroxin
          Length = 162

 Score =  158 bits (399), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 77/157 (49%), Positives = 105/157 (66%), Gaps = 4/157 (2%)

Query: 3   LQRITKEFKSVRKTLAEDPSYNHILKLEPKDTGNMYHWIADISGPPETPYASAVFALDVE 62
           + RI+KE   +RK L    S   ++ L P D  ++  W A I GP ETPY    F L +E
Sbjct: 1   MARISKELLKIRKALEHGDS-EFLVDLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIE 59

Query: 63  LPIQYPLEPPRVKFLPGSRNNIC---HCNVDFKTGEICLDILTREHWSPVWDLVHVIHAI 119
           +P  YP+ PP +KF+  ++  I    HCNVD +TGEICLDIL  E WSP+WD++HV+ AI
Sbjct: 60  VPASYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKPEGWSPIWDILHVVQAI 119

Query: 120 WILLGEPVPESPLNVDIANVLKAGDLEAYEGLIKYYI 156
            ILL EPVP+SPL+VD+AN+LK  D+ AY G+I+Y++
Sbjct: 120 HILLQEPVPDSPLDVDMANILKNNDMSAYNGIIRYFL 156

>Suva_7.421 Chr7 (727108..727605) [498 bp, 165 aa] {ON} YGR133W
           (REAL)
          Length = 165

 Score =  157 bits (397), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 73/160 (45%), Positives = 108/160 (67%), Gaps = 8/160 (5%)

Query: 3   LQRITKEFKSVRKTLA-EDPSYNH----ILKLEPKDTGNMYHWIADISGPPETPYASAVF 57
           + RITKE++ +RKTLA +DP+ N     I  L P D  ++  W A I GP  TPY    F
Sbjct: 1   MSRITKEYRLIRKTLASDDPTVNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERYQF 60

Query: 58  ALDVELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTREHWSPVWDLVHVIH 117
            + +++P  YP+ PP++ F    ++ I HCN++  TGEICLDIL  + W+PVWDL+H +H
Sbjct: 61  RMLIDVPDSYPMAPPKIMF---EKDAILHCNINSSTGEICLDILKLQDWTPVWDLLHCVH 117

Query: 118 AIWILLGEPVPESPLNVDIANVLKAGDLEAYEGLIKYYIG 157
           A+W LL EPV +SPL+VD+ N+++ GD  AY+G++KY++ 
Sbjct: 118 AVWRLLREPVCDSPLDVDMGNIIRCGDKRAYQGIVKYFLA 157

>NDAI0G00910 Chr7 complement(191811..192302) [492 bp, 163 aa] {ON}
           Anc_3.495
          Length = 163

 Score =  155 bits (393), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 80/166 (48%), Positives = 111/166 (66%), Gaps = 10/166 (6%)

Query: 3   LQRITKEFKSVRKTLA-----EDPSYNHIL-KLEPKD-TGNMYHWIADISGPPETPYASA 55
           + RI KE+K+++K L      +D  +N+I+  L P D   ++  W A I GP  TPY   
Sbjct: 1   MSRIIKEYKTIQKQLNNNRNNQDDEFNNIIVSLAPIDPDQDLTKWEAVIKGPQGTPYYGF 60

Query: 56  VFALDVELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTREHWSPVWDLVHV 115
            F L + +P +YP  PP  +F P S   + HCNV++ TGEICLDIL ++HW+PVW+L+  
Sbjct: 61  NFILYITIPQEYPTVPPFFEFQPRS---MPHCNVNYNTGEICLDILKQDHWTPVWNLMST 117

Query: 116 IHAIWILLGEPVPESPLNVDIANVLKAGDLEAYEGLIKYYIGMNGV 161
           + AIW+LL +PVPESPLNVD+AN+L+ GDL AY GLI YY+ +N V
Sbjct: 118 LKAIWLLLKDPVPESPLNVDLANLLRFGDLSAYNGLINYYLNINVV 163

>Smik_6.229 Chr6 (374835..375332) [498 bp, 165 aa] {ON} YGR133W
           (REAL)
          Length = 165

 Score =  155 bits (392), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 74/160 (46%), Positives = 104/160 (65%), Gaps = 8/160 (5%)

Query: 3   LQRITKEFKSVRKTLAED-----PSYNHILKLEPKDTGNMYHWIADISGPPETPYASAVF 57
           + RITKE++ + KTLA D     P    I  L P D  ++  W A I GP  TPY +  F
Sbjct: 1   MSRITKEYRVILKTLASDDPIVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQF 60

Query: 58  ALDVELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTREHWSPVWDLVHVIH 117
            + +++P  YP+ PPR+ F    +N+I HCNV   TGEICLDIL  E W+PVWDL+H +H
Sbjct: 61  HILIDVPSSYPMTPPRINF---EQNDILHCNVKSATGEICLDILKPEDWTPVWDLLHCVH 117

Query: 118 AIWILLGEPVPESPLNVDIANVLKAGDLEAYEGLIKYYIG 157
           A+W LL EPV +SPL+VD+ N+++  D  AY+G++KY++ 
Sbjct: 118 AVWRLLREPVCDSPLDVDMGNIIRCADESAYQGIVKYFLA 157

>Skud_7.444 Chr7 (736148..736633) [486 bp, 162 aa] {ON} YGR133W
           (REAL)
          Length = 162

 Score =  152 bits (385), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 74/160 (46%), Positives = 103/160 (64%), Gaps = 8/160 (5%)

Query: 3   LQRITKEFKSVRKTLAED-----PSYNHILKLEPKDTGNMYHWIADISGPPETPYASAVF 57
           + RI KE+  ++KTLA +     P    I  L P D  ++  W A I GP  TPY    F
Sbjct: 1   MSRIAKEYGDIQKTLASNDPIVNPYQGLIESLNPIDETDLSKWEAIIIGPTHTPYEHYRF 60

Query: 58  ALDVELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTREHWSPVWDLVHVIH 117
            + +++P  YP+ PP ++F    RNNI HCN+   TGEICLDIL  E W+PVWDL+H +H
Sbjct: 61  RILIDVPSSYPMAPPNIRF---DRNNILHCNIKSPTGEICLDILKPEDWTPVWDLLHCVH 117

Query: 118 AIWILLGEPVPESPLNVDIANVLKAGDLEAYEGLIKYYIG 157
           AIW LL EPV +SPL+VD+ N+++ GD  AY+G+I+Y++ 
Sbjct: 118 AIWRLLKEPVYDSPLDVDMGNIIRCGDTGAYQGIIRYFLA 157

>TDEL0D05630 Chr4 (1013302..1013754) [453 bp, 150 aa] {ON} Anc_3.495
           YGR133W
          Length = 150

 Score =  150 bits (379), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 72/154 (46%), Positives = 105/154 (68%), Gaps = 6/154 (3%)

Query: 3   LQRITKEFKSVRKTLAEDPSYNHILKLEPKDTGNMYHWIADISGPPETPYASAVFALDVE 62
           + RI +E+K ++ TL  + S   ++ LEP D G++  W  +I GP  TPY    F+L + 
Sbjct: 1   MARIAREYKHIQATLGSESSL--VVSLEPID-GDLSRWAGEIRGPTGTPYEGHTFSLRLV 57

Query: 63  LPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTREHWSPVWDLVHVIHAIWIL 122
           L  +YP  PP+V F   +R ++ HCNV+++TG ICL+ILT EHWSP WDL+HV+ AI  L
Sbjct: 58  LGDRYPTTPPQVTF---ARRSMPHCNVNYETGSICLNILTPEHWSPAWDLLHVLEAIIQL 114

Query: 123 LGEPVPESPLNVDIANVLKAGDLEAYEGLIKYYI 156
           L +P P+SPL++D+AN+L+A D  AY GL+ YY+
Sbjct: 115 LSDPEPDSPLDIDLANILRAQDRSAYYGLVNYYL 148

>TPHA0D04260 Chr4 (920720..921196) [477 bp, 158 aa] {ON} Anc_3.495
           YGR133W
          Length = 158

 Score =  149 bits (376), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 78/157 (49%), Positives = 106/157 (67%), Gaps = 7/157 (4%)

Query: 1   MSLQRITKEFKSVRKTLAEDPSYNHILKL-EPKDTGNMYHWIADISGPPETPYASAVFAL 59
           MSL+R+ KE + + K L+    Y+  ++L EP    N   W A + GP  TPY    F L
Sbjct: 1   MSLKRLLKEKRLIEKELS---GYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKL 57

Query: 60  DVELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTREHWSPVWDLVHVIHAI 119
            +ELP +YPL PP + F P S   + HCNV+F TG+ICL+IL  EHWSPVW+L++V+ A+
Sbjct: 58  LIELPSEYPLVPPAITFEPYS---MPHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVAL 114

Query: 120 WILLGEPVPESPLNVDIANVLKAGDLEAYEGLIKYYI 156
           + LL EPV +SPLN+D+AN+L+AGD  AY GLI YY+
Sbjct: 115 YQLLQEPVVDSPLNIDLANILRAGDTSAYHGLINYYL 151

>Kpol_480.13 s480 complement(27113..27586) [474 bp, 157 aa] {ON}
           complement(27113..27586) [474 nt, 158 aa]
          Length = 157

 Score =  149 bits (375), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 75/157 (47%), Positives = 106/157 (67%), Gaps = 5/157 (3%)

Query: 1   MSLQRITKEFKSVRKTLAEDPSYNHILKLEPKDTGNMYHWIADISGPPETPYASAVFALD 60
           MS +R+ KE++ V+K L      N I  LEP D+ ++ +W A I GPP TPY    F L 
Sbjct: 1   MSERRLLKEYQVVKKELGNHK--NIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLR 58

Query: 61  VELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTREHWSPVWDLVHVIHAIW 120
           + L  +YPL+PP+V F   S   + HCN++FKTG+ICL+IL   +WSPVW+L+ V+ AI+
Sbjct: 59  IHLTPEYPLKPPQVTF---SAYKMPHCNIEFKTGKICLNILDNANWSPVWNLLTVVLAIY 115

Query: 121 ILLGEPVPESPLNVDIANVLKAGDLEAYEGLIKYYIG 157
            LL +PV +SPLN+D++N+LK  D  AY GLI+YY+ 
Sbjct: 116 QLLSDPVTDSPLNIDLSNILKIKDTSAYYGLIEYYLN 152

>Ecym_1234 Chr1 complement(482339..482824) [486 bp, 161 aa] {ON}
           similar to Ashbya gossypii AFR314W
          Length = 161

 Score =  128 bits (321), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 68/153 (44%), Positives = 96/153 (62%), Gaps = 8/153 (5%)

Query: 5   RITKEFKSVRKTLAEDPSYNHILKLEPK-DTGNMYHWIADISGPPETPYASAVFALDVEL 63
           R+  E+K +R+ L    S+  IL L P  D G++  W A   GP  TPYA   F L +E+
Sbjct: 11  RMLAEYKQIREQLQ---SHESILMLCPAGDGGSLSKWEAQFCGPENTPYADFTFTLSIEI 67

Query: 64  PIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTREHWSPVWDLVHVIHAIWILL 123
           P  YP EPP  +F P   N+ICH N+ + TGE+CLD+L  E WSP+++L+ V+ AI  LL
Sbjct: 68  PEMYPNEPPNCRFPP---NHICHPNIKWSTGEVCLDLLKHETWSPMYNLLQVVEAIRTLL 124

Query: 124 GEPVPESPLNVDIANVLKAGDLEAYEGLIKYYI 156
            EP  +SPL+VD+A  L + D +AY+GL+ Y +
Sbjct: 125 AEPGVDSPLDVDLAK-LYSVDKQAYQGLVTYRL 156

>TBLA0C04500 Chr3 (1089815..1090312) [498 bp, 165 aa] {ON} Anc_3.495
           YGR133W
          Length = 165

 Score =  126 bits (317), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 67/155 (43%), Positives = 98/155 (63%), Gaps = 5/155 (3%)

Query: 3   LQRITKEFKSVRKTLAEDPSYNHILKLEPKDTGNMYHWIADISGPPETPYASAVFALDVE 62
           + RI KE+  +RK L   P     L      T ++ +W + I GP ++PY +  F L++ 
Sbjct: 1   MSRIIKEYNHIRK-LNALPDNMTTLHPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEIH 59

Query: 63  LPIQYPLEPPRVKFLPGSRNNIC-HCNVDFKTGEICLDILTREHWSPVWDLVHVIHAIWI 121
           +P +YP  PP +KF   ++N+I  HCNV+F TGEICL+IL  E+WSPVW+L++ + AI  
Sbjct: 60  IPTEYPSIPPVIKF---NKNSIPPHCNVNFTTGEICLNILKNENWSPVWNLLYSVQAIIQ 116

Query: 122 LLGEPVPESPLNVDIANVLKAGDLEAYEGLIKYYI 156
           LL  P P SPLN+D++ +L   D +AY  LIKYY+
Sbjct: 117 LLAYPDPSSPLNIDLSRLLTLKDSKAYNSLIKYYL 151

>AFR314W Chr6 (1006415..1006882) [468 bp, 155 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR133W (PEX4)
          Length = 155

 Score =  125 bits (315), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 65/156 (41%), Positives = 99/156 (63%), Gaps = 9/156 (5%)

Query: 3   LQRITKEFKSVRKTLAEDPSYNHILKLEP--KDTGNMYHWIADISGPPETPYASAVFALD 60
           ++RI +E+K ++K LA  P+   +L L P  ++ G+++ W A   GP  TPYA   F L 
Sbjct: 1   MRRILREYKQLQKQLALHPA---VLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLR 57

Query: 61  VELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTREHWSPVWDLVHVIHAIW 120
           + +P  YP EPP+  F P   ++ICH N+ + TGE+CLD+L  E WSPV++L+ V+ AI 
Sbjct: 58  INVPETYPNEPPKCSFPP---HHICHPNIKWSTGEVCLDLLKHEAWSPVYNLLQVVEAIS 114

Query: 121 ILLGEPVPESPLNVDIANVLKAGDLEAYEGLIKYYI 156
            LL EP  +SPL+VD++  L   D  AY+G++ Y +
Sbjct: 115 TLLAEPGVDSPLDVDLSR-LYTTDRAAYDGVVNYRL 149

>KAFR0C01990 Chr3 (395423..395878) [456 bp, 151 aa] {ON} Anc_3.495
           YGR133W
          Length = 151

 Score =  122 bits (306), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 66/154 (42%), Positives = 98/154 (63%), Gaps = 9/154 (5%)

Query: 4   QRITKEFKSVRKTLAEDPSYNHILKLEPKDTGNMYHWIADISGPPETPYASAVFALDVEL 63
            RI KE+K  R   ++     +IL L+P  T ++ HW   I GP  +P+A+  F L +++
Sbjct: 3   SRILKEYKDSRSLQSQ-----YILALDPISTDDLTHWECTIKGPLHSPFANHTFKLRIDI 57

Query: 64  PIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTREHWSPVWDLVHVIHAIWILL 123
           P  YPL  P  KF P +   + H NV+F+TGEICLDIL   +WSPV+++ +++ AI  LL
Sbjct: 58  PQTYPLTTPICKFEPFA---MPHPNVNFETGEICLDILDT-NWSPVFNIQYIVEAIVWLL 113

Query: 124 GEPVPESPLNVDIANVLKAGDLEAYEGLIKYYIG 157
            EP  +SPLN+D+AN+L+  DL+AY  LI Y++ 
Sbjct: 114 NEPNFKSPLNLDLANLLRFDDLKAYHDLISYHLN 147

>KNAG0B00780 Chr2 complement(145805..146266) [462 bp, 153 aa] {ON}
           Anc_3.495 YGR133W
          Length = 153

 Score =  112 bits (281), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 62/158 (39%), Positives = 92/158 (58%), Gaps = 8/158 (5%)

Query: 4   QRITKEFKSVRKTLAEDPSYNHILKLEPKDTGNMYHWIADISGPPETPYASAVFALDVEL 63
           QR+ +E+   R+ +A   + N    L P D  ++ HW A + GP  TPY    F L V +
Sbjct: 3   QRVLREY---RRLVAAGGAANES-NLHPTDPADLTHWEATLEGPQGTPYEGHSFPLRVTV 58

Query: 64  PIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTREHWSPVWDLVHVIHAIWILL 123
           P +YP  PP V F    +  + H NV + TGE+CLD L    W+PV DL + + A+  LL
Sbjct: 59  PDKYPTLPPSVCF---PKRTMPHPNVKWDTGEVCLDTLA-GGWTPVMDLQYAVMAVRRLL 114

Query: 124 GEPVPESPLNVDIANVLKAGDLEAYEGLIKYYIGMNGV 161
            EP PESPLN+++A + + GD +AY+G+IKY +  + +
Sbjct: 115 AEPNPESPLNLELAALSRLGDHKAYDGIIKYRLAHSSI 152

>KLLA0E04027g Chr5 complement(365119..365595) [477 bp, 158 aa] {ON}
           similar to uniprot|P29340 Saccharomyces cerevisiae
           YGR133W PEX4 Involved in peroxisome biogenesis Member of
           ubiquitin-conjugating protein family
          Length = 158

 Score = 97.4 bits (241), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 56/156 (35%), Positives = 93/156 (59%), Gaps = 8/156 (5%)

Query: 3   LQRITKEFKSVRKTLAEDPSYNHILKLEPKDTGNMYHWIADISGPPETPYASAVFALDVE 62
           + RI KE+  ++K L + P ++ I  L P D  ++  W+    GP E+P+      L++ 
Sbjct: 1   MSRIVKEYMGLQKRL-QTPEFSWISFLAPVDDDDLSEWVCRFQGPSESPFEGFELGLNIT 59

Query: 63  LPIQ-YPLEP-PRVKFLPGSRNNICHCNVDFKTGEICLDILTREHWSPVWDLVHVIHAIW 120
           + ++ YP+   PRV F P     + H NV + TGEICLD+L ++ W+P++ L+ V+ AI 
Sbjct: 60  IDLEKYPISGGPRVLFEP---RTVAHPNVKWDTGEICLDLL-KDAWTPIYTLLDVVGAIR 115

Query: 121 ILLGEPVPESPLNVDIANVLKAGDLEAYEGLIKYYI 156
            LL +P  +SPL++DIA +  A D EAY  +++Y +
Sbjct: 116 DLLADPGLDSPLDLDIAQIYDA-DYEAYVQIVRYRL 150

>KAFR0C00270 Chr3 (47414..47457,47593..47992) [444 bp, 147 aa] {ON} 
          Length = 147

 Score = 92.4 bits (228), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 58/150 (38%), Positives = 81/150 (54%), Gaps = 16/150 (10%)

Query: 1   MSLQRITKEFKSVRKTLAEDPSYNHILKLEPKDTGN-MYHWIADISGPPETPYASAVFAL 59
           MS +RI+KE   +RK    DP    I        G+ ++HW A I GPP++PYA  VF L
Sbjct: 1   MSSKRISKELNDLRK----DP----ITSFSAGPVGDDLFHWQASIMGPPDSPYAGGVFFL 52

Query: 60  DVELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTREHWSPVWDLVHVIHAI 119
            +  P  YP +PP++ F       I H N++   G ICLDIL ++ WSP   L  V+ +I
Sbjct: 53  SIHFPTDYPFKPPKISF----TTKIYHPNIN-ANGNICLDIL-KDQWSPALTLSKVLLSI 106

Query: 120 WILLGEPVPESPLNVDIANVLKAGDLEAYE 149
             LL +  P+ PL  +IA++ K  D   YE
Sbjct: 107 CSLLTDANPDDPLVPEIAHIYKT-DRSKYE 135

>KLTH0E14300g Chr5 complement(1265287..1265686,1265893..1265936)
           [444 bp, 147 aa] {ON} highly similar to uniprot|P15731
           Saccharomyces cerevisiae YBR082C UBC4
           Ubiquitin-conjugating enzyme that mediates degradation
           of short-lived and abnormal proteins interacts with
           E3-CaM in ubiquitinating calmodulin interacts with many
           SCF ubiquitin protein ligases component of the cellular
           stress response
          Length = 147

 Score = 92.4 bits (228), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 56/153 (36%), Positives = 80/153 (52%), Gaps = 14/153 (9%)

Query: 1   MSLQRITKEFKSVRKTLAEDPSYNHILKLEPKDTGNMYHWIADISGPPETPYASAVFALD 60
           MSL+RITKE   + +      S   +         ++YHW A I GPP++PYA  VF L 
Sbjct: 1   MSLKRITKELNDLGRDPPTSCSAGPV-------GDDLYHWQASIMGPPDSPYAGGVFFLS 53

Query: 61  VELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTREHWSPVWDLVHVIHAIW 120
           +  P  YP +PP++ F       I H N++   G ICLDIL ++ WSP   +  V+ +I 
Sbjct: 54  IHFPTDYPFKPPKISF----TTKIYHPNIN-ANGNICLDIL-KDQWSPALTISKVLLSIC 107

Query: 121 ILLGEPVPESPLNVDIANVLKAGDLEAYEGLIK 153
            LL +  P+ PL  +IA++ K  D   YE   K
Sbjct: 108 SLLTDANPDDPLVPEIAHIYKT-DRAKYEATAK 139

>SAKL0B06512g Chr2 complement(557855..558254,558581..558624) [444
           bp, 147 aa] {ON} highly similar to uniprot|P15731
           Saccharomyces cerevisiae YBR082C UBC4
           Ubiquitin-conjugating enzyme that mediates degradation
           of short-lived and abnormal proteins interacts with
           E3-CaM in ubiquitinating calmodulin interacts with many
           SCF ubiquitin protein ligases component of the cellular
           stress response
          Length = 147

 Score = 92.4 bits (228), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 56/153 (36%), Positives = 80/153 (52%), Gaps = 14/153 (9%)

Query: 1   MSLQRITKEFKSVRKTLAEDPSYNHILKLEPKDTGNMYHWIADISGPPETPYASAVFALD 60
           MSL+RITKE   + +      S   +         ++YHW A I GPP++PYA  VF L 
Sbjct: 1   MSLKRITKELNDLGRDPPTSCSAGPV-------GDDLYHWQASIMGPPDSPYAGGVFFLS 53

Query: 61  VELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTREHWSPVWDLVHVIHAIW 120
           +  P  YP +PP++ F       I H N++   G ICLDIL ++ WSP   +  V+ +I 
Sbjct: 54  IHFPTDYPFKPPKISF----TTKIYHPNIN-ANGNICLDIL-KDQWSPALTISKVLLSIC 107

Query: 121 ILLGEPVPESPLNVDIANVLKAGDLEAYEGLIK 153
            LL +  P+ PL  +IA++ K  D   YE   K
Sbjct: 108 SLLTDANPDDPLVPEIAHIYKT-DRAKYEATAK 139

>AER173C Chr5 complement(960420..960863) [444 bp, 147 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR082C
           (UBC4) and YDR059C (UBC5)
          Length = 147

 Score = 92.4 bits (228), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 56/153 (36%), Positives = 80/153 (52%), Gaps = 14/153 (9%)

Query: 1   MSLQRITKEFKSVRKTLAEDPSYNHILKLEPKDTGNMYHWIADISGPPETPYASAVFALD 60
           MSL+RITKE   + +      S   +         ++YHW A I GPP++PYA  VF L 
Sbjct: 1   MSLKRITKELNDLGRDPPTSCSAGPV-------GDDLYHWQASIMGPPDSPYAGGVFFLS 53

Query: 61  VELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTREHWSPVWDLVHVIHAIW 120
           +  P  YP +PP++ F       I H N++   G ICLDIL ++ WSP   +  V+ +I 
Sbjct: 54  IHFPTDYPFKPPKISF----TTKIYHPNIN-ANGNICLDIL-KDQWSPALTISKVLLSIC 107

Query: 121 ILLGEPVPESPLNVDIANVLKAGDLEAYEGLIK 153
            LL +  P+ PL  +IA++ K  D   YE   K
Sbjct: 108 SLLTDANPDDPLVPEIAHIYKT-DRAKYEATAK 139

>Ecym_7431 Chr7 complement(883095..883538) [444 bp, 147 aa] {ON}
           similar to Ashbya gossypii AER173C
          Length = 147

 Score = 92.0 bits (227), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 56/153 (36%), Positives = 80/153 (52%), Gaps = 14/153 (9%)

Query: 1   MSLQRITKEFKSVRKTLAEDPSYNHILKLEPKDTGNMYHWIADISGPPETPYASAVFALD 60
           MSL+RITKE   + +      S   +         ++YHW A I GPP++PYA  VF L 
Sbjct: 1   MSLKRITKELNDLGRDPPTSCSAGPV-------GDDLYHWQASIMGPPDSPYAGGVFFLS 53

Query: 61  VELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTREHWSPVWDLVHVIHAIW 120
           +  P  YP +PP++ F       I H N++   G ICLDIL ++ WSP   +  V+ +I 
Sbjct: 54  IHFPTDYPFKPPKISF----TTKIYHPNIN-ANGNICLDIL-KDQWSPALTISKVLLSIC 107

Query: 121 ILLGEPVPESPLNVDIANVLKAGDLEAYEGLIK 153
            LL +  P+ PL  +IA++ K  D   YE   K
Sbjct: 108 SLLTDANPDDPLVPEIAHIYKT-DRAKYEATAK 139

>TDEL0F02100 Chr6 (382357..382400,382469..382868) [444 bp, 147 aa]
           {ON} 
          Length = 147

 Score = 90.9 bits (224), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 58/153 (37%), Positives = 80/153 (52%), Gaps = 14/153 (9%)

Query: 1   MSLQRITKEFKSVRKTLAEDPSYNHILKLEPKDTGNMYHWIADISGPPETPYASAVFALD 60
           MSL+RITKE       L  DP  +        D   +YHW A I GPP++PYA  VF L 
Sbjct: 1   MSLKRITKELND----LGRDPPTSCSAGPVGDD---IYHWQASIMGPPDSPYAGGVFFLS 53

Query: 61  VELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTREHWSPVWDLVHVIHAIW 120
           +  P  YP +PP++ F       I H N++   G ICLDIL ++ WSP   +  V+ +I 
Sbjct: 54  IHFPTDYPFKPPKIAF----TTKIYHPNIN-ANGNICLDIL-KDQWSPALTISKVLLSIC 107

Query: 121 ILLGEPVPESPLNVDIANVLKAGDLEAYEGLIK 153
            LL +  P+ PL  +IA++ K  D   YE   +
Sbjct: 108 SLLTDANPDDPLVPEIAHIYKT-DRAKYEATAR 139

>ZYRO0G12870g Chr7 complement(1022897..1023296,1023388..1023431)
           [444 bp, 147 aa] {ON} highly similar to uniprot|P15731
           Saccharomyces cerevisiae YBR082C UBC4
           Ubiquitin-conjugating enzyme that mediates degradation
           of short-lived and abnormal proteins interacts with
           E3-CaM in ubiquitinating calmodulin interacts with many
           SCF ubiquitin protein ligases component of the cellular
           stress response
          Length = 147

 Score = 90.1 bits (222), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 58/153 (37%), Positives = 80/153 (52%), Gaps = 14/153 (9%)

Query: 1   MSLQRITKEFKSVRKTLAEDPSYNHILKLEPKDTGNMYHWIADISGPPETPYASAVFALD 60
           MSL+RITKE       L  DP  +        D   +YHW A I GPP++PYA  VF L 
Sbjct: 1   MSLKRITKELND----LGRDPPTSCSAGPVGDD---VYHWQASIMGPPDSPYAGGVFFLS 53

Query: 61  VELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTREHWSPVWDLVHVIHAIW 120
           +  P  YP +PP++ F       I H N++   G ICLDIL ++ WSP   +  V+ +I 
Sbjct: 54  IHFPTDYPFKPPKIAF----TTKIYHPNIN-ANGNICLDIL-KDQWSPALTISKVLLSIC 107

Query: 121 ILLGEPVPESPLNVDIANVLKAGDLEAYEGLIK 153
            LL +  P+ PL  +IA++ K  D   YE   +
Sbjct: 108 SLLTDANPDDPLVPEIAHIYKT-DRAKYEAQAR 139

>NDAI0A05490 Chr1 (1240963..1241006,1241105..1241504) [444 bp, 147
           aa] {ON} Anc_3.308
          Length = 147

 Score = 90.1 bits (222), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 55/153 (35%), Positives = 79/153 (51%), Gaps = 14/153 (9%)

Query: 1   MSLQRITKEFKSVRKTLAEDPSYNHILKLEPKDTGNMYHWIADISGPPETPYASAVFALD 60
           MS +RITKE   + +      S   +         ++YHW A I GPP++PYA  VF L 
Sbjct: 1   MSSKRITKELSDMGRDPPTSCSAGPV-------GDDLYHWQASIMGPPDSPYAGGVFFLS 53

Query: 61  VELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTREHWSPVWDLVHVIHAIW 120
           +  P  YP +PP++ F       I H N++   G ICLDIL ++ WSP   L  V+ +I 
Sbjct: 54  IHFPTDYPFKPPKISF----TTKIYHPNIN-ANGNICLDIL-KDQWSPALTLSKVLLSIC 107

Query: 121 ILLGEPVPESPLNVDIANVLKAGDLEAYEGLIK 153
            LL +  P+ PL  +IA++ K  D   YE   +
Sbjct: 108 SLLTDANPDDPLVPEIAHIYKT-DRPKYEATAR 139

>TBLA0I02130 Chr9 complement(489054..489453,489732..489778) [447 bp,
           148 aa] {ON} 
          Length = 148

 Score = 89.4 bits (220), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 55/152 (36%), Positives = 79/152 (51%), Gaps = 14/152 (9%)

Query: 2   SLQRITKEFKSVRKTLAEDPSYNHILKLEPKDTGNMYHWIADISGPPETPYASAVFALDV 61
           SL+RITKE   + +      S   +         ++YHW A I GPP++PYA  VF L +
Sbjct: 3   SLKRITKELNDLGRDPPTSCSAGPV-------GDDIYHWQASIMGPPDSPYAGGVFFLSI 55

Query: 62  ELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTREHWSPVWDLVHVIHAIWI 121
             P  YP +PP++ F       I H N++   G ICLDIL ++ WSP   +  V+ +I  
Sbjct: 56  HFPTDYPFKPPKISF----TTKIYHPNIN-ANGNICLDIL-KDQWSPALTISKVLLSICS 109

Query: 122 LLGEPVPESPLNVDIANVLKAGDLEAYEGLIK 153
           LL +  P+ PL  +IA++ K  D   YE   K
Sbjct: 110 LLTDANPDDPLVPEIAHIYKT-DRPKYEATAK 140

>Kpol_1052.2 s1052 (6121..6167,6406..6805) [447 bp, 148 aa] {ON}
           (6121..6167,6406..6805) [447 nt, 149 aa]
          Length = 148

 Score = 89.0 bits (219), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 58/152 (38%), Positives = 79/152 (51%), Gaps = 14/152 (9%)

Query: 2   SLQRITKEFKSVRKTLAEDPSYNHILKLEPKDTGNMYHWIADISGPPETPYASAVFALDV 61
           SL+RITKE       L  DP  +        D   +YHW A I GPP++PYA  VF L +
Sbjct: 3   SLKRITKELND----LGRDPPTSCSAGPVGDD---VYHWQASIMGPPDSPYAGGVFFLSI 55

Query: 62  ELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTREHWSPVWDLVHVIHAIWI 121
             P  YP +PP++ F       I H N++   G ICLDIL ++ WSP   +  V+ +I  
Sbjct: 56  HFPTDYPFKPPKISF----TTKIYHPNIN-ANGNICLDIL-KDQWSPALTISKVLLSICS 109

Query: 122 LLGEPVPESPLNVDIANVLKAGDLEAYEGLIK 153
           LL +  P+ PL  +IA++ K  D   YE   K
Sbjct: 110 LLTDANPDDPLVPEIAHLYKT-DRAKYEATAK 140

>TPHA0L00850 Chr12 (168648..169298) [651 bp, 216 aa] {ON} Anc_8.375
           YDR177W
          Length = 216

 Score = 90.5 bits (223), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 75/135 (55%), Gaps = 11/135 (8%)

Query: 4   QRITKEFKSVRKTLAEDPSYNHILKLEPKDTGNMYHWIADISGPPETPYASAVFALDVEL 63
           +RI KE ++VR    +DP  N  + LE     +++H      GPPETPY    F +D+E+
Sbjct: 5   KRIMKEMEAVR----DDPEAN--IDLEFVSEADIHHLKGSFLGPPETPYEGGKFIVDIEV 58

Query: 64  PIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTREHWSPVWDLVHVIHAIWILL 123
           P++YP +PP++KF       + H N+   TG ICLDIL +  WSPV  L   + ++  LL
Sbjct: 59  PMEYPFKPPKMKF----DTKVYHPNISSVTGAICLDIL-KNAWSPVITLKSALISLQALL 113

Query: 124 GEPVPESPLNVDIAN 138
             P P  P + ++A 
Sbjct: 114 QSPEPNDPQDAEVAQ 128

>TPHA0A03850 Chr1 (846488..846534,846907..847306) [447 bp, 148 aa]
           {ON} Anc_3.308 YBR082C
          Length = 148

 Score = 88.6 bits (218), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 55/152 (36%), Positives = 79/152 (51%), Gaps = 14/152 (9%)

Query: 2   SLQRITKEFKSVRKTLAEDPSYNHILKLEPKDTGNMYHWIADISGPPETPYASAVFALDV 61
           SL+RITKE   + +      S   +         ++YHW A I GPP++PYA  VF L +
Sbjct: 3   SLKRITKELNDLGRDPPTSCSAGPV-------GDDIYHWQASIMGPPDSPYAGGVFFLSI 55

Query: 62  ELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTREHWSPVWDLVHVIHAIWI 121
             P  YP +PP++ F       I H N++   G ICLDIL ++ WSP   +  V+ +I  
Sbjct: 56  HFPTDYPFKPPKISF----TTKIYHPNIN-ANGNICLDIL-KDQWSPALTISKVLLSICS 109

Query: 122 LLGEPVPESPLNVDIANVLKAGDLEAYEGLIK 153
           LL +  P+ PL  +IA++ K  D   YE   K
Sbjct: 110 LLTDANPDDPLVPEIAHLYKT-DRPKYEATAK 140

>Kpol_1030.10 s1030 complement(21147..21794) [648 bp, 215 aa] {ON}
           complement(21147..21794) [648 nt, 216 aa]
          Length = 215

 Score = 90.5 bits (223), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 49/135 (36%), Positives = 76/135 (56%), Gaps = 11/135 (8%)

Query: 4   QRITKEFKSVRKTLAEDPSYNHILKLEPKDTGNMYHWIADISGPPETPYASAVFALDVEL 63
           +RI KE ++V+    +DP+ N  + LE     +++H      GPPETPY    F +D+E+
Sbjct: 5   KRIMKEMQAVK----DDPAAN--INLEFVSESDIHHLKGSFLGPPETPYQGGRFIVDIEV 58

Query: 64  PIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTREHWSPVWDLVHVIHAIWILL 123
           P++YP +PP++KF       + H N+   TG ICLDIL +  WSPV  L   + ++  LL
Sbjct: 59  PMEYPFKPPKMKF----DTKVYHPNISSVTGAICLDIL-KNAWSPVITLKSALISLQALL 113

Query: 124 GEPVPESPLNVDIAN 138
             P P  P + ++A 
Sbjct: 114 QSPEPNDPQDAEVAQ 128

>CAGL0E04752g Chr5 complement(456202..456645) [444 bp, 147 aa] {ON}
           highly similar to uniprot|P15731 Saccharomyces
           cerevisiae YBR082c UBC4 E2 ubiquitin-conjugating enzyme
           or uniprot|P15732 Saccharomyces cerevisiae YDR059c UBC5
          Length = 147

 Score = 88.2 bits (217), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 54/153 (35%), Positives = 78/153 (50%), Gaps = 14/153 (9%)

Query: 1   MSLQRITKEFKSVRKTLAEDPSYNHILKLEPKDTGNMYHWIADISGPPETPYASAVFALD 60
           MS +RI KE   + +      S   +         ++YHW A I GPP++PYA  VF L 
Sbjct: 1   MSSKRIAKELSDLGRDPPTSCSAGPV-------GDDLYHWQASIMGPPDSPYAGGVFFLS 53

Query: 61  VELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTREHWSPVWDLVHVIHAIW 120
           +  P  YP +PP++ F       I H N++   G ICLDIL ++ WSP   L  V+ +I 
Sbjct: 54  IHFPTDYPFKPPKISF----TTKIYHPNIN-ANGNICLDIL-KDQWSPALTLSKVLLSIC 107

Query: 121 ILLGEPVPESPLNVDIANVLKAGDLEAYEGLIK 153
            LL +  P+ PL  +IA++ K  D   YE   +
Sbjct: 108 SLLTDANPDDPLVPEIAHIYKT-DRAKYEATAR 139

>KLLA0E12563g Chr5 (1117022..1117068,1117342..1117741) [447 bp, 148
           aa] {ON} highly similar to uniprot|P15731 Saccharomyces
           cerevisiae YBR082C UBC4 Ubiquitin-conjugating enzyme
           that mediates degradation of short-lived and abnormal
           proteins interacts with E3-CaM in ubiquitinating
           calmodulin interacts with many SCF ubiquitin protein
           ligases component of the cellular stress response
          Length = 148

 Score = 87.8 bits (216), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 57/152 (37%), Positives = 79/152 (51%), Gaps = 14/152 (9%)

Query: 2   SLQRITKEFKSVRKTLAEDPSYNHILKLEPKDTGNMYHWIADISGPPETPYASAVFALDV 61
           SL+RITKE       L  DP  +        D   +YHW A I GPP++PYA  VF L +
Sbjct: 3   SLKRITKELND----LGRDPPTSCSAGPVGDD---VYHWQASIMGPPDSPYAGGVFFLSI 55

Query: 62  ELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTREHWSPVWDLVHVIHAIWI 121
             P  YP +PP++ F       I H N++   G ICLDIL ++ WSP   +  V+ +I  
Sbjct: 56  HFPTDYPFKPPKISF----TTKIYHPNIN-ANGNICLDIL-KDQWSPALTISKVLLSICS 109

Query: 122 LLGEPVPESPLNVDIANVLKAGDLEAYEGLIK 153
           LL +  P+ PL  +IA++ K  D   YE   +
Sbjct: 110 LLTDANPDDPLVPEIAHLYKT-DRAKYEATAR 140

>KNAG0A04810 Chr1 complement(689230..689874) [645 bp, 214 aa] {ON}
           Anc_8.375 YDR177W
          Length = 214

 Score = 89.4 bits (220), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 49/135 (36%), Positives = 76/135 (56%), Gaps = 11/135 (8%)

Query: 4   QRITKEFKSVRKTLAEDPSYNHILKLEPKDTGNMYHWIADISGPPETPYASAVFALDVEL 63
           +RI KE ++V+    +DP  +  + LE  +  +++H      GPPETPY    F +D+E+
Sbjct: 5   KRIMKEMQAVK----DDPEAH--ITLEFVNESDIHHLKGTFQGPPETPYDRGQFVVDIEV 58

Query: 64  PIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTREHWSPVWDLVHVIHAIWILL 123
           P++YP +PP++KF       + H NV   TG ICLDIL +  WSPV  L   + ++  LL
Sbjct: 59  PMEYPFKPPKMKF----DTKVYHPNVSSVTGAICLDIL-KNAWSPVITLKSALISLQALL 113

Query: 124 GEPVPESPLNVDIAN 138
             P P  P + ++A 
Sbjct: 114 QSPEPNDPQDAEVAQ 128

>NCAS0A10800 Chr1 complement(2150862..2151261,2151377..2151423) [447
           bp, 148 aa] {ON} Anc_3.308
          Length = 148

 Score = 87.8 bits (216), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 54/152 (35%), Positives = 78/152 (51%), Gaps = 14/152 (9%)

Query: 2   SLQRITKEFKSVRKTLAEDPSYNHILKLEPKDTGNMYHWIADISGPPETPYASAVFALDV 61
           S +RITKE   + +      S   +         ++YHW A I GPP++PYA  VF L +
Sbjct: 3   SSKRITKELSDMGRDPPTSCSAGPV-------GDDLYHWQASIMGPPDSPYAGGVFFLSI 55

Query: 62  ELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTREHWSPVWDLVHVIHAIWI 121
             P  YP +PP++ F       I H N++   G ICLDIL ++ WSP   L  V+ +I  
Sbjct: 56  HFPTDYPFKPPKISF----TTKIYHPNIN-ANGNICLDIL-KDQWSPALTLSKVLLSICS 109

Query: 122 LLGEPVPESPLNVDIANVLKAGDLEAYEGLIK 153
           LL +  P+ PL  +IA++ K  D   YE   +
Sbjct: 110 LLTDANPDDPLVPEIAHIYKT-DRPKYEATAR 140

>KNAG0J02340 Chr10 complement(439355..439840) [486 bp, 161 aa] {ON} 
          Length = 161

 Score = 87.4 bits (215), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 47/118 (39%), Positives = 67/118 (56%), Gaps = 7/118 (5%)

Query: 36  NMYHWIADISGPPETPYASAVFALDVELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGE 95
           ++YHW A I GPP++PYA  VF L +  P  YP +PP++ F       I H N++   G 
Sbjct: 43  DLYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISF----TTKIYHPNIN-ANGN 97

Query: 96  ICLDILTREHWSPVWDLVHVIHAIWILLGEPVPESPLNVDIANVLKAGDLEAYEGLIK 153
           ICLDIL ++ WSP   L  V+ +I  LL +  P+ PL  +IA++ K  D   YE   +
Sbjct: 98  ICLDIL-KDQWSPALTLSKVLLSICSLLTDANPDDPLVPEIAHIYKT-DRSKYEATAR 153

>ZYRO0C03784g Chr3 (301102..301758) [657 bp, 218 aa] {ON} highly
           similar to uniprot|P21734 Saccharomyces cerevisiae
           YDR177W UBC1 Ubiquitin-conjugating enzyme that mediates
           selective degradation of short-lived and abnormal
           proteins plays a role in vesicle biogenesis and ER-
           associated protein degradation (ERAD) component of the
           cellular stress response
          Length = 218

 Score = 88.2 bits (217), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 48/135 (35%), Positives = 75/135 (55%), Gaps = 11/135 (8%)

Query: 4   QRITKEFKSVRKTLAEDPSYNHILKLEPKDTGNMYHWIADISGPPETPYASAVFALDVEL 63
           +R+ KE ++VR    +DP+ N  + LE     +++       GPPETPY    F +D+E+
Sbjct: 5   KRLMKELQAVR----DDPAAN--ITLEFISESDIHRLKGSFLGPPETPYQGGRFIIDIEV 58

Query: 64  PIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTREHWSPVWDLVHVIHAIWILL 123
           P++YP +PP++KF       + H N+   TG ICLDIL +  WSPV  L   + ++  LL
Sbjct: 59  PMEYPFKPPKMKF----DTKVYHPNISSVTGAICLDIL-KNAWSPVITLKSALISLQALL 113

Query: 124 GEPVPESPLNVDIAN 138
             P P  P + ++A 
Sbjct: 114 QSPEPNDPQDAEVAQ 128

>Suva_2.218 Chr2 complement(369003..369402,369494..369540) [447 bp,
           148 aa] {ON} YDR059C (REAL)
          Length = 148

 Score = 86.3 bits (212), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 48/118 (40%), Positives = 66/118 (55%), Gaps = 7/118 (5%)

Query: 36  NMYHWIADISGPPETPYASAVFALDVELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGE 95
           ++YHW A I GP ++PYA  VF L +  P  YP +PP+V F       I H N++  +G 
Sbjct: 30  DLYHWQASIMGPSDSPYAGGVFFLSIHFPTDYPFKPPKVNF----TTKIYHPNIN-SSGN 84

Query: 96  ICLDILTREHWSPVWDLVHVIHAIWILLGEPVPESPLNVDIANVLKAGDLEAYEGLIK 153
           ICLDIL ++ WSP   L  V+ +I  LL +  P+ PL  +IA + K  D   YE   K
Sbjct: 85  ICLDIL-KDQWSPALTLSKVLLSICSLLTDANPDDPLVPEIAQIYKT-DKAKYEATAK 140

>Skud_4.314 Chr4 complement(545266..545665,545759..545805) [447 bp,
           148 aa] {ON} YDR059C (REAL)
          Length = 148

 Score = 86.3 bits (212), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 48/118 (40%), Positives = 66/118 (55%), Gaps = 7/118 (5%)

Query: 36  NMYHWIADISGPPETPYASAVFALDVELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGE 95
           ++YHW A I GP ++PYA  VF L +  P  YP +PP+V F       I H N++  +G 
Sbjct: 30  DLYHWQASIMGPSDSPYAGGVFFLSIHFPTDYPFKPPKVNF----TTKIYHPNIN-SSGN 84

Query: 96  ICLDILTREHWSPVWDLVHVIHAIWILLGEPVPESPLNVDIANVLKAGDLEAYEGLIK 153
           ICLDIL ++ WSP   L  V+ +I  LL +  P+ PL  +IA + K  D   YE   K
Sbjct: 85  ICLDIL-KDQWSPALTLSKVLLSICSLLTDANPDDPLVPEIAQIYKT-DKAKYEATAK 140

>YDR059C Chr4 complement(569234..569633,569724..569770) [447 bp, 148
           aa] {ON}  UBC5Ubiquitin-conjugating enzyme that mediates
           selective degradation of short-lived, abnormal, or
           excess proteins, including histone H3; central component
           of the cellular stress response; expression is heat
           inducible
          Length = 148

 Score = 86.3 bits (212), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 48/118 (40%), Positives = 66/118 (55%), Gaps = 7/118 (5%)

Query: 36  NMYHWIADISGPPETPYASAVFALDVELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGE 95
           ++YHW A I GP ++PYA  VF L +  P  YP +PP+V F       I H N++  +G 
Sbjct: 30  DLYHWQASIMGPSDSPYAGGVFFLSIHFPTDYPFKPPKVNF----TTKIYHPNIN-SSGN 84

Query: 96  ICLDILTREHWSPVWDLVHVIHAIWILLGEPVPESPLNVDIANVLKAGDLEAYEGLIK 153
           ICLDIL ++ WSP   L  V+ +I  LL +  P+ PL  +IA + K  D   YE   K
Sbjct: 85  ICLDIL-KDQWSPALTLSKVLLSICSLLTDANPDDPLVPEIAQIYKT-DKAKYEATAK 140

>CAGL0E00671g Chr5 complement(61697..62338) [642 bp, 213 aa] {ON}
           highly similar to uniprot|P21734 Saccharomyces
           cerevisiae YDR177w E2 ubiquitin-conjugating enzyme
          Length = 213

 Score = 87.8 bits (216), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 48/135 (35%), Positives = 75/135 (55%), Gaps = 11/135 (8%)

Query: 4   QRITKEFKSVRKTLAEDPSYNHILKLEPKDTGNMYHWIADISGPPETPYASAVFALDVEL 63
           +RI KE ++V+    +DP  N  + LE     +++H      GPP TPY    F +D+E+
Sbjct: 5   KRIMKELQAVK----DDPEAN--ISLEFVSESDIHHLKGSFLGPPGTPYEGGKFIVDIEV 58

Query: 64  PIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTREHWSPVWDLVHVIHAIWILL 123
           P++YP +PP++KF     + + H N+   TG ICLDIL +  WSPV  L   + ++  LL
Sbjct: 59  PMEYPFKPPKMKF----DSKVYHPNISSVTGAICLDIL-KNAWSPVITLKSALISLQALL 113

Query: 124 GEPVPESPLNVDIAN 138
             P P  P + ++A 
Sbjct: 114 QSPEPNDPQDAEVAQ 128

>Smik_4.297 Chr4 complement(535773..536172,536260..536306) [447 bp,
           148 aa] {ON} YDR059C (REAL)
          Length = 148

 Score = 85.9 bits (211), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 47/118 (39%), Positives = 66/118 (55%), Gaps = 7/118 (5%)

Query: 36  NMYHWIADISGPPETPYASAVFALDVELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGE 95
           ++YHW A I GP ++PYA  VF L +  P  YP +PP+V F       I H N++  +G 
Sbjct: 30  DLYHWQASIMGPSDSPYAGGVFFLSIHFPTDYPFKPPKVNF----TTKIYHPNIN-SSGN 84

Query: 96  ICLDILTREHWSPVWDLVHVIHAIWILLGEPVPESPLNVDIANVLKAGDLEAYEGLIK 153
           ICLDIL ++ WSP   L  V+ ++  LL +  P+ PL  +IA + K  D   YE   K
Sbjct: 85  ICLDIL-KDQWSPALTLSKVLLSVCSLLTDANPDDPLVPEIAQIYKT-DKAKYEATAK 140

>YOR339C Chr15 complement(958362..958832) [471 bp, 156 aa] {ON}
           UBC11Ubiquitin-conjugating enzyme most similar in
           sequence to Xenopus ubiquitin-conjugating enzyme E2-C,
           but not a true functional homolog of this E2; unlike
           E2-C, not required for the degradation of mitotic cyclin
           Clb2
          Length = 156

 Score = 85.9 bits (211), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 48/118 (40%), Positives = 72/118 (61%), Gaps = 7/118 (5%)

Query: 31  PKDTGNMYHWIADISGPPETPYASAVFALDVELPIQYPLEPPRVKFLPGSRNNICHCNVD 90
           P D  ++ +W+  I+GP +TPY+   F + ++ P  YP  PP +KFL    + + H NVD
Sbjct: 32  PVDDNDLTYWVGYITGPKDTPYSGLKFKVSLKFPQNYPFHPPMIKFL----SPMWHPNVD 87

Query: 91  FKTGEICLDILTREHWSPVWDLVHVIHAIWILLGEPVPESPLNVDIANVLKAGDLEAY 148
            K+G ICLDIL +E WS V+++  ++ ++  LLGEP   SPLN  +A  L   D+E Y
Sbjct: 88  -KSGNICLDIL-KEKWSAVYNVETILLSLQSLLGEPNNRSPLNA-VAAELWDADMEEY 142

>TBLA0H03130 Chr8 (763830..764474) [645 bp, 214 aa] {ON} Anc_8.375
           YDR177W
          Length = 214

 Score = 87.0 bits (214), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 47/135 (34%), Positives = 76/135 (56%), Gaps = 11/135 (8%)

Query: 4   QRITKEFKSVRKTLAEDPSYNHILKLEPKDTGNMYHWIADISGPPETPYASAVFALDVEL 63
           +RI KE ++V+    +DP+ N  + L+  +  +++H      GPP TPY    F +D+E+
Sbjct: 5   KRIMKEMQAVK----DDPAAN--ITLDFVNESDIHHLKGSFLGPPGTPYEGGRFMIDIEV 58

Query: 64  PIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTREHWSPVWDLVHVIHAIWILL 123
           P++YP +PP++KF       + H N+   TG ICLDIL +  WSPV  L   + ++  LL
Sbjct: 59  PMEYPFKPPKMKF----DTKVYHPNISSVTGAICLDIL-KNAWSPVITLKSALISLQALL 113

Query: 124 GEPVPESPLNVDIAN 138
             P P  P + ++A 
Sbjct: 114 QSPEPNDPQDAEVAQ 128

>Kwal_27.12401 s27 complement(1209894..1210604) [711 bp, 236 aa]
           {ON} YBR082C (UBC4) - 1:1 [contig 457] FULL
          Length = 236

 Score = 87.4 bits (215), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 47/118 (39%), Positives = 67/118 (56%), Gaps = 7/118 (5%)

Query: 36  NMYHWIADISGPPETPYASAVFALDVELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGE 95
           ++YHW A I GPP++PYA  VF L +  P  YP +PP++ F       I H N++   G 
Sbjct: 118 DLYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISFT----TKIYHPNIN-ANGN 172

Query: 96  ICLDILTREHWSPVWDLVHVIHAIWILLGEPVPESPLNVDIANVLKAGDLEAYEGLIK 153
           ICLDIL ++ WSP   +  V+ +I  LL +  P+ PL  +IA++ K  D   YE   K
Sbjct: 173 ICLDIL-KDQWSPALTISKVLLSICSLLTDANPDDPLVPEIAHIYKT-DRAKYEATAK 228

>NDAI0A01160 Chr1 complement(245057..245707) [651 bp, 216 aa] {ON} 
          Length = 216

 Score = 86.7 bits (213), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 47/135 (34%), Positives = 75/135 (55%), Gaps = 11/135 (8%)

Query: 4   QRITKEFKSVRKTLAEDPSYNHILKLEPKDTGNMYHWIADISGPPETPYASAVFALDVEL 63
           +RI KE ++V+    +DP+    + LE  +  +++H      GPP TPY    F +D+E+
Sbjct: 5   KRIMKELQAVK----DDPTAK--IGLEFVNESDIHHLKGSFFGPPGTPYEGGQFIIDIEV 58

Query: 64  PIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTREHWSPVWDLVHVIHAIWILL 123
           P++YP +PP++KF       + H N+   TG ICLDIL +  WSPV  L   + ++  LL
Sbjct: 59  PMEYPFKPPKMKF----DTKVYHPNISSVTGAICLDIL-KNAWSPVITLKSALISLQALL 113

Query: 124 GEPVPESPLNVDIAN 138
             P P  P + ++A 
Sbjct: 114 QSPEPNDPQDAEVAQ 128

>TDEL0F04990 Chr6 (941804..942457) [654 bp, 217 aa] {ON} Anc_8.375
           YDR177W
          Length = 217

 Score = 86.7 bits (213), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 48/135 (35%), Positives = 75/135 (55%), Gaps = 11/135 (8%)

Query: 4   QRITKEFKSVRKTLAEDPSYNHILKLEPKDTGNMYHWIADISGPPETPYASAVFALDVEL 63
           +RI KE ++V+    +DP+    + LE     +++H      GPP TPY   +F +D+E+
Sbjct: 5   KRIMKEMQAVK----DDPAAK--INLEFVTESDIHHLKGSFLGPPGTPYDGGLFIVDIEV 58

Query: 64  PIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTREHWSPVWDLVHVIHAIWILL 123
           P++YP +PP++KF       + H NV   TG ICLDIL +  WSPV  L   + ++  LL
Sbjct: 59  PMEYPFKPPKMKF----DTKVYHPNVSSVTGAICLDIL-KNAWSPVITLKSALISLQALL 113

Query: 124 GEPVPESPLNVDIAN 138
             P P  P + ++A 
Sbjct: 114 QSPEPNDPQDAEVAQ 128

>Kpol_1065.12 s1065 (25814..26293) [480 bp, 159 aa] {ON}
           (25814..26293) [480 nt, 160 aa]
          Length = 159

 Score = 84.7 bits (208), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 49/118 (41%), Positives = 70/118 (59%), Gaps = 7/118 (5%)

Query: 31  PKDTGNMYHWIADISGPPETPYASAVFALDVELPIQYPLEPPRVKFLPGSRNNICHCNVD 90
           P    N+  W   I+GP ++PYA   F + +  P +YP EPP+VKF+    + + H NVD
Sbjct: 36  PDHEENLTKWSGTITGPDDSPYAGLRFKISLTFPDRYPYEPPKVKFV----SPMWHPNVD 91

Query: 91  FKTGEICLDILTREHWSPVWDLVHVIHAIWILLGEPVPESPLNVDIANVLKAGDLEAY 148
             +G ICLD+L +E WS V+++  ++ ++  LLGEP   SPLN  IA  L  GD E Y
Sbjct: 92  L-SGNICLDVL-KEKWSAVYNVQTILLSLQALLGEPNNSSPLNA-IAAELWDGDKEEY 146

>Suva_4.326 Chr4 complement(575255..575654,575770..575816) [447 bp,
           148 aa] {ON} YBR082C (REAL)
          Length = 148

 Score = 84.3 bits (207), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 47/126 (37%), Positives = 68/126 (53%), Gaps = 7/126 (5%)

Query: 36  NMYHWIADISGPPETPYASAVFALDVELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGE 95
           ++YHW A I GP ++PYA  VF L +  P  YP +PP++ F       I H N++   G 
Sbjct: 30  DLYHWQASIMGPADSPYAGGVFFLSIHFPTDYPFKPPKISF----TTKIYHPNIN-ANGN 84

Query: 96  ICLDILTREHWSPVWDLVHVIHAIWILLGEPVPESPLNVDIANVLKAGDLEAYEGLIKYY 155
           ICLDIL ++ WSP   L  V+ +I  LL +  P+ PL  +IA++ K  D   YE   + +
Sbjct: 85  ICLDIL-KDQWSPALTLSKVLLSICSLLTDANPDDPLVPEIAHIYKT-DRSKYEATAREW 142

Query: 156 IGMNGV 161
                V
Sbjct: 143 TKKYAV 148

>Smik_15.517 Chr15 complement(907953..908423) [471 bp, 156 aa] {ON}
           YOR339C (REAL)
          Length = 156

 Score = 84.0 bits (206), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 46/125 (36%), Positives = 73/125 (58%), Gaps = 6/125 (4%)

Query: 31  PKDTGNMYHWIADISGPPETPYASAVFALDVELPIQYPLEPPRVKFLPGSRNNICHCNVD 90
           P D  ++ +W+  I+GP  TPY+   F + +  P  YP  PP++KF+    + + H NVD
Sbjct: 32  PVDDNDLTYWVGYITGPQGTPYSGLKFKISLNFPENYPFHPPKIKFV----SPMWHPNVD 87

Query: 91  FKTGEICLDILTREHWSPVWDLVHVIHAIWILLGEPVPESPLNVDIANVLKAGDLEAYEG 150
            K+G ICLDIL +E WS V+++  ++ ++  LLGEP  +SPLN   A +     +E  + 
Sbjct: 88  -KSGNICLDIL-KEKWSAVYNVETILLSLQSLLGEPNNKSPLNAVAAELWDTNMVEYRKK 145

Query: 151 LIKYY 155
           L+  Y
Sbjct: 146 LLACY 150

>Skud_2.207 Chr2 complement(374501..374900,375003..375049) [447 bp,
           148 aa] {ON} YBR082C (REAL)
          Length = 148

 Score = 83.6 bits (205), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 47/126 (37%), Positives = 68/126 (53%), Gaps = 7/126 (5%)

Query: 36  NMYHWIADISGPPETPYASAVFALDVELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGE 95
           ++YHW A I GP ++PYA  VF L +  P  YP +PP++ F       I H N++   G 
Sbjct: 30  DLYHWQASIMGPADSPYAGGVFFLSIHFPTDYPFKPPKISF----TTKIYHPNIN-ANGN 84

Query: 96  ICLDILTREHWSPVWDLVHVIHAIWILLGEPVPESPLNVDIANVLKAGDLEAYEGLIKYY 155
           ICLDIL ++ WSP   L  V+ +I  LL +  P+ PL  +IA++ K  D   YE   + +
Sbjct: 85  ICLDIL-KDQWSPALTLSKVLLSICSLLTDANPDDPLVPEIAHIYKT-DRPKYEATAREW 142

Query: 156 IGMNGV 161
                V
Sbjct: 143 TKKYAV 148

>Smik_2.219 Chr2 complement(389737..390136,390239..390285) [447 bp,
           148 aa] {ON} YBR082C (REAL)
          Length = 148

 Score = 83.6 bits (205), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 47/126 (37%), Positives = 68/126 (53%), Gaps = 7/126 (5%)

Query: 36  NMYHWIADISGPPETPYASAVFALDVELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGE 95
           ++YHW A I GP ++PYA  VF L +  P  YP +PP++ F       I H N++   G 
Sbjct: 30  DLYHWQASIMGPADSPYAGGVFFLSIHFPTDYPFKPPKISF----TTKIYHPNIN-ANGN 84

Query: 96  ICLDILTREHWSPVWDLVHVIHAIWILLGEPVPESPLNVDIANVLKAGDLEAYEGLIKYY 155
           ICLDIL ++ WSP   L  V+ +I  LL +  P+ PL  +IA++ K  D   YE   + +
Sbjct: 85  ICLDIL-KDQWSPALTLSKVLLSICSLLTDANPDDPLVPEIAHIYKT-DRPKYEATAREW 142

Query: 156 IGMNGV 161
                V
Sbjct: 143 TKKYAV 148

>YBR082C Chr2 complement(406628..407027,407123..407169) [447 bp, 148
           aa] {ON}  UBC4Ubiquitin-conjugating enzyme (E2),
           mediates degradation of abnormal or excess proteins,
           including calmodulin and histone H3; interacts with many
           SCF ubiquitin protein ligases; component of the cellular
           stress response
          Length = 148

 Score = 83.6 bits (205), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 47/126 (37%), Positives = 68/126 (53%), Gaps = 7/126 (5%)

Query: 36  NMYHWIADISGPPETPYASAVFALDVELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGE 95
           ++YHW A I GP ++PYA  VF L +  P  YP +PP++ F       I H N++   G 
Sbjct: 30  DLYHWQASIMGPADSPYAGGVFFLSIHFPTDYPFKPPKISF----TTKIYHPNIN-ANGN 84

Query: 96  ICLDILTREHWSPVWDLVHVIHAIWILLGEPVPESPLNVDIANVLKAGDLEAYEGLIKYY 155
           ICLDIL ++ WSP   L  V+ +I  LL +  P+ PL  +IA++ K  D   YE   + +
Sbjct: 85  ICLDIL-KDQWSPALTLSKVLLSICSLLTDANPDDPLVPEIAHIYKT-DRPKYEATAREW 142

Query: 156 IGMNGV 161
                V
Sbjct: 143 TKKYAV 148

>KAFR0B06060 Chr2 (1251667..1252308) [642 bp, 213 aa] {ON} Anc_8.375
           YDR177W
          Length = 213

 Score = 84.3 bits (207), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 47/135 (34%), Positives = 74/135 (54%), Gaps = 11/135 (8%)

Query: 4   QRITKEFKSVRKTLAEDPSYNHILKLEPKDTGNMYHWIADISGPPETPYASAVFALDVEL 63
           +RI KE ++V+    +DP     + LE     +++H      GPP TPY +  F +D+E+
Sbjct: 5   KRIMKELQAVK----DDPEAK--ITLEFVIESDIHHLKGSFIGPPGTPYENGAFVVDIEV 58

Query: 64  PIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTREHWSPVWDLVHVIHAIWILL 123
           P++YP +PP++KF       + H N+   TG ICLDIL +  WSPV  L   + ++  LL
Sbjct: 59  PMEYPFKPPQMKF----DTKVYHPNISSVTGAICLDIL-KNAWSPVITLKSALISLQALL 113

Query: 124 GEPVPESPLNVDIAN 138
             P P  P + ++A 
Sbjct: 114 QSPEPNDPQDAEVAQ 128

>NCAS0B03150 Chr2 complement(544870..545514) [645 bp, 214 aa] {ON} 
          Length = 214

 Score = 84.3 bits (207), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 47/135 (34%), Positives = 74/135 (54%), Gaps = 11/135 (8%)

Query: 4   QRITKEFKSVRKTLAEDPSYNHILKLEPKDTGNMYHWIADISGPPETPYASAVFALDVEL 63
           +RI KE ++V+    +DP     ++LE  +  +++H      GPP TPY    F +D+E+
Sbjct: 5   KRIMKELQAVK----DDPEAR--IELEFVNESDIHHLKGSFLGPPGTPYEGGQFIVDIEV 58

Query: 64  PIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTREHWSPVWDLVHVIHAIWILL 123
           P++YP +PP +KF       + H N+   TG ICLDIL +  WSPV  L   + ++  LL
Sbjct: 59  PMEYPFKPPMMKF----DTKVYHPNISSVTGAICLDIL-KNAWSPVITLKSALISLQALL 113

Query: 124 GEPVPESPLNVDIAN 138
             P P  P + ++A 
Sbjct: 114 QSPEPNDPQDAEVAQ 128

>Suva_8.389 Chr8 complement(700070..700540) [471 bp, 156 aa] {ON}
           YOR339C (REAL)
          Length = 156

 Score = 82.8 bits (203), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 47/119 (39%), Positives = 71/119 (59%), Gaps = 7/119 (5%)

Query: 31  PKDTGNMYHWIADISGPPETPYASAVFALDVELPIQYPLEPPRVKFLPGSRNNICHCNVD 90
           P+D  ++ +W   I+GP  TPY+   F + +  P  YP  PP+VKF+    + + H NVD
Sbjct: 32  PEDDNDLTYWTGYITGPQGTPYSDLKFKISLNFPESYPFHPPKVKFV----SPMWHPNVD 87

Query: 91  FKTGEICLDILTREHWSPVWDLVHVIHAIWILLGEPVPESPLNVDIANVLKAGDLEAYE 149
             +G ICLDIL +E WS V+++  ++ ++  LLGEP   SPLN  +A  L   D+E Y+
Sbjct: 88  M-SGNICLDIL-KEKWSAVYNVETILLSLQSLLGEPNNRSPLNA-VAAELWDKDMEEYK 143

>Skud_15.504 Chr15 complement(898776..899246) [471 bp, 156 aa] {ON}
           YOR339C (REAL)
          Length = 156

 Score = 82.8 bits (203), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 48/119 (40%), Positives = 70/119 (58%), Gaps = 7/119 (5%)

Query: 31  PKDTGNMYHWIADISGPPETPYASAVFALDVELPIQYPLEPPRVKFLPGSRNNICHCNVD 90
           P D  ++ +W   I GP  TPY+   F + +  P  YP  PP+VKF+    + + H NVD
Sbjct: 32  PVDDNDLTYWTGYIMGPQGTPYSDLKFKISLNFPENYPFHPPKVKFV----SPMWHPNVD 87

Query: 91  FKTGEICLDILTREHWSPVWDLVHVIHAIWILLGEPVPESPLNVDIANVLKAGDLEAYE 149
            K+G ICLDIL +E WS V+++  ++ ++  LLGEP   SPLN  +A  L   D+E Y+
Sbjct: 88  -KSGNICLDIL-KEKWSAVYNVETILLSLQSLLGEPNNRSPLNA-VAAELWDKDMEGYK 143

>Skud_4.441 Chr4 (783817..784464) [648 bp, 215 aa] {ON} YDR177W
           (REAL)
          Length = 215

 Score = 83.6 bits (205), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 46/135 (34%), Positives = 75/135 (55%), Gaps = 11/135 (8%)

Query: 4   QRITKEFKSVRKTLAEDPSYNHILKLEPKDTGNMYHWIADISGPPETPYASAVFALDVEL 63
           +RI KE ++V+    +DP+ +  + LE     +++H      GPP TPY    F +D+E+
Sbjct: 5   KRIMKEIQAVK----DDPAAH--ITLEFVSESDIHHLKGTFLGPPGTPYEGGKFVVDIEV 58

Query: 64  PIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTREHWSPVWDLVHVIHAIWILL 123
           P++YP +PP+++F       + H N+   TG ICLDIL +  WSPV  L   + ++  LL
Sbjct: 59  PMEYPFKPPKMQF----DTKVYHPNISSVTGAICLDIL-KNAWSPVITLKSALISLQALL 113

Query: 124 GEPVPESPLNVDIAN 138
             P P  P + ++A 
Sbjct: 114 QSPEPNDPQDAEVAQ 128

>Suva_2.343 Chr2 (608195..608842) [648 bp, 215 aa] {ON} YDR177W
           (REAL)
          Length = 215

 Score = 83.6 bits (205), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 46/135 (34%), Positives = 75/135 (55%), Gaps = 11/135 (8%)

Query: 4   QRITKEFKSVRKTLAEDPSYNHILKLEPKDTGNMYHWIADISGPPETPYASAVFALDVEL 63
           +RI KE ++V+    +DP+ +  + LE     +++H      GPP TPY    F +D+E+
Sbjct: 5   KRIMKEIQAVK----DDPAAH--ITLEFVSESDIHHLKGTFLGPPGTPYEGGKFVVDIEV 58

Query: 64  PIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTREHWSPVWDLVHVIHAIWILL 123
           P++YP +PP+++F       + H N+   TG ICLDIL +  WSPV  L   + ++  LL
Sbjct: 59  PMEYPFKPPKMQF----DTKVYHPNISSVTGAICLDIL-KNAWSPVITLKSALISLQALL 113

Query: 124 GEPVPESPLNVDIAN 138
             P P  P + ++A 
Sbjct: 114 QSPEPNDPQDAEVAQ 128

>Smik_4.425 Chr4 (772926..773573) [648 bp, 215 aa] {ON} YDR177W
           (REAL)
          Length = 215

 Score = 83.6 bits (205), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 46/135 (34%), Positives = 75/135 (55%), Gaps = 11/135 (8%)

Query: 4   QRITKEFKSVRKTLAEDPSYNHILKLEPKDTGNMYHWIADISGPPETPYASAVFALDVEL 63
           +RI KE ++V+    +DP+ +  + LE     +++H      GPP TPY    F +D+E+
Sbjct: 5   KRIMKEIQAVK----DDPAAH--ITLEFVSESDIHHLKGTFLGPPGTPYEGGKFVVDIEV 58

Query: 64  PIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTREHWSPVWDLVHVIHAIWILL 123
           P++YP +PP+++F       + H N+   TG ICLDIL +  WSPV  L   + ++  LL
Sbjct: 59  PMEYPFKPPKMQF----DTKVYHPNISSVTGAICLDIL-KNAWSPVITLKSALISLQALL 113

Query: 124 GEPVPESPLNVDIAN 138
             P P  P + ++A 
Sbjct: 114 QSPEPNDPQDAEVAQ 128

>YDR177W Chr4 (816878..817525) [648 bp, 215 aa] {ON}
           UBC1Ubiquitin-conjugating enzyme that mediates selective
           degradation of short-lived and abnormal proteins; plays
           a role in vesicle biogenesis and ER-associated protein
           degradation (ERAD); component of the cellular stress
           response
          Length = 215

 Score = 83.6 bits (205), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 46/135 (34%), Positives = 75/135 (55%), Gaps = 11/135 (8%)

Query: 4   QRITKEFKSVRKTLAEDPSYNHILKLEPKDTGNMYHWIADISGPPETPYASAVFALDVEL 63
           +RI KE ++V+    +DP+ +  + LE     +++H      GPP TPY    F +D+E+
Sbjct: 5   KRIMKEIQAVK----DDPAAH--ITLEFVSESDIHHLKGTFLGPPGTPYEGGKFVVDIEV 58

Query: 64  PIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTREHWSPVWDLVHVIHAIWILL 123
           P++YP +PP+++F       + H N+   TG ICLDIL +  WSPV  L   + ++  LL
Sbjct: 59  PMEYPFKPPKMQF----DTKVYHPNISSVTGAICLDIL-KNAWSPVITLKSALISLQALL 113

Query: 124 GEPVPESPLNVDIAN 138
             P P  P + ++A 
Sbjct: 114 QSPEPNDPQDAEVAQ 128

>TPHA0I02460 Chr9 (549215..549718) [504 bp, 167 aa] {ON} Anc_2.569
           YMR022W
          Length = 167

 Score = 82.0 bits (201), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 48/138 (34%), Positives = 71/138 (51%), Gaps = 18/138 (13%)

Query: 31  PKDTGNMYHWIADISGPPETPYASAVFALDVELPIQYPLEPPRVKFLPGSRNNICHCNVD 90
           P D  NM+ W   ISGPPETPY + VF   +  P  YPL PP++ F P    ++ H N+ 
Sbjct: 30  PSDENNMFEWDCLISGPPETPYENGVFNATLLFPKDYPLSPPKLTFTP----SLLHPNI- 84

Query: 91  FKTGEICLDI------------LTREHWSPVWDLVHVIHAIWILLGEPVPESPLNVDIAN 138
           +  GE+C+ I            L  E WSPV  +  ++ ++  +L EP  ES  N+D A+
Sbjct: 85  YPNGEVCISILHSPGDDPNMYELAEERWSPVQSVEKILLSVMSMLSEPNIESGANID-AS 143

Query: 139 VLKAGDLEAYEGLIKYYI 156
           +L   +   +E  +K  I
Sbjct: 144 ILYRDNRPEFERQVKLSI 161

>ADR169C Chr4 complement(1000734..1001369) [636 bp, 211 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YDR177W
           (UBC1)
          Length = 211

 Score = 83.2 bits (204), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 73/135 (54%), Gaps = 11/135 (8%)

Query: 4   QRITKEFKSVRKTLAEDPSYNHILKLEPKDTGNMYHWIADISGPPETPYASAVFALDVEL 63
           +R+ KE +SV+    +DP  N  + L      +++H      GPP TPY    F +D+++
Sbjct: 5   KRLMKEIQSVK----DDPDAN--ISLAFVSESDIHHLKGTFLGPPGTPYHGGTFIVDIQV 58

Query: 64  PIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTREHWSPVWDLVHVIHAIWILL 123
           P++YP +PP+++F       + H N+   TG ICLDIL +  WSPV  L   + ++  LL
Sbjct: 59  PLEYPFKPPKMQF----DTKVYHPNISSVTGAICLDIL-KNSWSPVLTLKTSLISLQALL 113

Query: 124 GEPVPESPLNVDIAN 138
             P P  P + ++A 
Sbjct: 114 QSPEPNDPQDAEVAK 128

>Kwal_14.1828 s14 (488274..488732) [459 bp, 152 aa] {ON} YGL058W
           (RAD6) - Ubiquitin conjugating (E2) enzyme. The
           C-terminal 23 residues are critical for sporulation and
           histone polyubiquitinating activity, but not UV repair
           or induced mutagenesis. [contig 237] FULL
          Length = 152

 Score = 81.3 bits (199), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 62/106 (58%), Gaps = 6/106 (5%)

Query: 36  NMYHWIADISGPPETPYASAVFALDVELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGE 95
           N+  W A I GP ETPY    F L +E   +YP +PP VKFL    + I H NV +  GE
Sbjct: 17  NVMVWNAMIIGPAETPYEDGTFRLLLEFDEEYPNKPPHVKFL----SEIFHPNV-YANGE 71

Query: 96  ICLDILTREHWSPVWDLVHVIHAIWILLGEPVPESPLNVDIANVLK 141
           ICLDIL +  W+P +D+  ++ +I  L  +P P SP NV+ A + K
Sbjct: 72  ICLDIL-QNRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 116

>Ecym_6038 Chr6 (73539..74174) [636 bp, 211 aa] {ON} similar to
           Ashbya gossypii ADR169C
          Length = 211

 Score = 82.8 bits (203), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 73/135 (54%), Gaps = 11/135 (8%)

Query: 4   QRITKEFKSVRKTLAEDPSYNHILKLEPKDTGNMYHWIADISGPPETPYASAVFALDVEL 63
           +R+ KE +SV+    +DP  N  + L      +++H      GPP TPY    F +D+++
Sbjct: 5   KRLMKEIQSVK----DDPDAN--ISLSFVSESDIHHLKGTFLGPPGTPYHGGKFVVDIQV 58

Query: 64  PIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTREHWSPVWDLVHVIHAIWILL 123
           P++YP +PP+++F       + H N+   TG ICLDIL +  WSPV  L   + ++  LL
Sbjct: 59  PLEYPFKPPKMQF----DTKVYHPNISSVTGAICLDIL-KNSWSPVLTLKTSLISLQALL 113

Query: 124 GEPVPESPLNVDIAN 138
             P P  P + ++A 
Sbjct: 114 QSPEPNDPQDAEVAK 128

>TBLA0A01290 Chr1 complement(306004..306658,306780..306784) [660 bp,
           219 aa] {ON} Anc_1.436 YEL012W
          Length = 219

 Score = 82.8 bits (203), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 50/124 (40%), Positives = 69/124 (55%), Gaps = 11/124 (8%)

Query: 36  NMYHWIADISGPPETPYASAVFALDVELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGE 95
           NM  +     GP ETPY   V+ L VELP  YP + P + F+    N I H N+D  +G 
Sbjct: 28  NMQEFFIKFFGPDETPYEKGVWRLHVELPDNYPYKSPSIGFV----NKIFHPNIDIASGS 83

Query: 96  ICLDILTREHWSPVWDLVHVIHAIWI---LLGEPVPESPLNVDIANVLKAGDLEAYEGLI 152
           ICLD++    WSP++DL++++   W+   LL EP    PLN + A  L+  D + YE  I
Sbjct: 84  ICLDVIN-STWSPLYDLINIVE--WMIPGLLKEPNGTDPLNNEAAG-LQLRDKKLYEEKI 139

Query: 153 KYYI 156
           K YI
Sbjct: 140 KEYI 143

>NCAS0D03220 Chr4 (604785..605300) [516 bp, 171 aa] {ON} Anc_6.109
          Length = 171

 Score = 81.6 bits (200), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 62/106 (58%), Gaps = 6/106 (5%)

Query: 36  NMYHWIADISGPPETPYASAVFALDVELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGE 95
           N+  W A I GP ETPY    F L +E   +YP +PP VKFL    + + H NV +  GE
Sbjct: 32  NVMVWNAMIIGPAETPYEDGTFRLLLEFDEEYPNKPPHVKFL----SEMFHPNV-YANGE 86

Query: 96  ICLDILTREHWSPVWDLVHVIHAIWILLGEPVPESPLNVDIANVLK 141
           ICLDIL +  W+P +D+  ++ +I  L  +P P SP NV+ A + K
Sbjct: 87  ICLDIL-QNRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>KLTH0H06732g Chr8 (592074..592115,592201..592641) [483 bp, 160 aa]
           {ON} highly similar to uniprot|P06104 Saccharomyces
           cerevisiae YGL058W RAD6 Ubiquitin-conjugating enzyme
           (E2) involved in postreplication repair (with Rad18p)
           sporulation telomere silencing and ubiquitin-mediated N-
           end rule protein degradation (with Ubr1p)
          Length = 160

 Score = 80.9 bits (198), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 62/106 (58%), Gaps = 6/106 (5%)

Query: 36  NMYHWIADISGPPETPYASAVFALDVELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGE 95
           N+  W A I GP ETPY    F L +E   +YP +PP VKFL    + + H NV +  GE
Sbjct: 28  NVMVWNAMIIGPAETPYEDGTFRLLLEFDEEYPNKPPHVKFL----SEMFHPNV-YANGE 82

Query: 96  ICLDILTREHWSPVWDLVHVIHAIWILLGEPVPESPLNVDIANVLK 141
           ICLDIL +  W+P +D+  ++ +I  L  +P P SP NV+ A + K
Sbjct: 83  ICLDIL-QNRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 127

>KLTH0D07986g Chr4 (679875..680372) [498 bp, 165 aa] {ON} highly
           similar to uniprot|Q02159 Saccharomyces cerevisiae
           YMR022W QRI8 Ubiquitin conjugating enzyme involved in
           the ER-associated protein degradation pathway requires
           Cue1p for recruitment to the ER membrane proposed to be
           involved in chromatin assembly
          Length = 165

 Score = 80.9 bits (198), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 53/168 (31%), Positives = 82/168 (48%), Gaps = 21/168 (12%)

Query: 1   MSLQRITKEFKSVRKTLAEDPSYNHILKLEPKDTGNMYHWIADISGPPETPYASAVFALD 60
           MS     + FK +++ L + P     +   P+   N++ W   ISGPP++PY   VF   
Sbjct: 1   MSKTAQKRLFKELQQLLKDSP---EGIVAGPRSEDNLFLWDCLISGPPDSPYQGGVFNAT 57

Query: 61  VELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDI------------LTREHWSP 108
           +E P  YPL PP++ F P    +I H N+ +  GE+C+ I            L  E WSP
Sbjct: 58  LEFPKDYPLSPPKLLFTP----SILHPNI-YPNGEVCISILHSPGDDPNMYELAEERWSP 112

Query: 109 VWDLVHVIHAIWILLGEPVPESPLNVDIANVLKAGDLEAYEGLIKYYI 156
           V  +  ++ ++  +L EP  ES  N+D A +L     E +E  +K  I
Sbjct: 113 VQSVEKILLSVMSMLSEPNVESGANID-ACILWRDSREEFEKQVKRSI 159

>TPHA0O00920 Chr15 (170342..171022) [681 bp, 226 aa] {ON} Anc_1.436
           YEL012W
          Length = 226

 Score = 82.0 bits (201), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 50/124 (40%), Positives = 69/124 (55%), Gaps = 11/124 (8%)

Query: 36  NMYHWIADISGPPETPYASAVFALDVELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGE 95
           NM  +     GP +TPY   V+ L VELP  YP + P + F+    N I H N+D  +G 
Sbjct: 30  NMQEFYVKFHGPKDTPYEGGVWRLHVELPDNYPYKSPSIGFV----NKIFHPNIDIASGS 85

Query: 96  ICLDILTREHWSPVWDLVHVIHAIWI---LLGEPVPESPLNVDIANVLKAGDLEAYEGLI 152
           ICLD++    WSP++DL+++I   W+   LL EP    PLN + A  L+  D + YE  I
Sbjct: 86  ICLDVINST-WSPLYDLLNIIE--WMIPGLLKEPNGSDPLNNEAAG-LQLHDKKIYEEKI 141

Query: 153 KYYI 156
           K YI
Sbjct: 142 KEYI 145

>NDAI0D01140 Chr4 (259072..259076,259218..259950) [738 bp, 245 aa]
           {ON} 
          Length = 245

 Score = 82.0 bits (201), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 49/124 (39%), Positives = 70/124 (56%), Gaps = 11/124 (8%)

Query: 36  NMYHWIADISGPPETPYASAVFALDVELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGE 95
           NM  +     GP +TPY + V+ L VELP  YP + P + F+    N I H N+D  +G 
Sbjct: 46  NMQEFYIKFCGPKDTPYENGVWRLHVELPDNYPYKSPSIGFV----NKIFHPNIDIASGS 101

Query: 96  ICLDILTREHWSPVWDLVHVIHAIWI---LLGEPVPESPLNVDIANVLKAGDLEAYEGLI 152
           ICLD++    WSP++DL++++   W+   LL EP    PLN + A  L+  D + YE  I
Sbjct: 102 ICLDVINS-TWSPLYDLLNIVE--WMIPGLLKEPNGSDPLNNEAA-TLELKDKKLYEERI 157

Query: 153 KYYI 156
           K YI
Sbjct: 158 KEYI 161

>ZYRO0B11682g Chr2 (920866..921321) [456 bp, 151 aa] {ON} highly
           similar to uniprot|P52490 Saccharomyces cerevisiae
           YDR092W UBC13 Ubiquitin-conjugating enzyme involved in
           the error-free DNA postreplication repair pathway
           interacts with Mms2p to assemble ubiquitin chains at the
           Ub Lys-63 residue DNA damage triggers redistribution
           from the cytoplasm to the nucleus
          Length = 151

 Score = 79.7 bits (195), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 52/134 (38%), Positives = 75/134 (55%), Gaps = 13/134 (9%)

Query: 4   QRITKEFKSVRKTLAEDPSYNHILKLEPKDTGNMYHWIADISGPPETPYASAVFALDVEL 63
           +RI KE +     LA DP     +  EP +  N+ ++   I GP E+PY + VF L++ L
Sbjct: 6   KRIIKETER----LASDPVPG--ISAEPHE-DNLRYFAVTIEGPEESPYENGVFELELYL 58

Query: 64  PIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTREHWSPVWDLVHVIHAIWILL 123
           P  YP+E P+V+FL      I H N+D + G ICLD+L + +WSP   +  V+ +I  LL
Sbjct: 59  PDDYPMEAPKVRFL----TRIYHPNID-RLGRICLDVL-KNNWSPALQIRTVLLSIQALL 112

Query: 124 GEPVPESPLNVDIA 137
             P P  PL  D+A
Sbjct: 113 ASPNPNDPLANDVA 126

>ZYRO0C04950g Chr3 (389805..389846,389914..390378) [507 bp, 168 aa]
           {ON} similar to uniprot|P06104 Saccharomyces cerevisiae
           YGL058W RAD6 Ubiquitin-conjugating enzyme (E2) involved
           in postreplication repair (with Rad18p) sporulation
           telomere silencing and ubiquitin-mediated N-end rule
           protein degradation (with Ubr1p)
          Length = 168

 Score = 80.1 bits (196), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 44/106 (41%), Positives = 62/106 (58%), Gaps = 6/106 (5%)

Query: 36  NMYHWIADISGPPETPYASAVFALDVELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGE 95
           N+  W A I GP +TPY    F L +E   +YP +PP VKFL    + + H NV +  GE
Sbjct: 32  NVMVWNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFL----SEMFHPNV-YANGE 86

Query: 96  ICLDILTREHWSPVWDLVHVIHAIWILLGEPVPESPLNVDIANVLK 141
           ICLDIL +  W+P +D+  ++ +I  L  +P P SP NV+ A + K
Sbjct: 87  ICLDIL-QNRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>SAKL0A00396g Chr1 complement(43630..44277) [648 bp, 215 aa] {ON}
           highly similar to uniprot|P21734 Saccharomyces
           cerevisiae YDR177W UBC1 Ubiquitin-conjugating enzyme
           that mediates selective degradation of short-lived and
           abnormal proteins plays a role in vesicle biogenesis and
           ER- associated protein degradation (ERAD) component of
           the cellular stress response
          Length = 215

 Score = 81.3 bits (199), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 44/135 (32%), Positives = 72/135 (53%), Gaps = 11/135 (8%)

Query: 4   QRITKEFKSVRKTLAEDPSYNHILKLEPKDTGNMYHWIADISGPPETPYASAVFALDVEL 63
           +RI KE ++ +    +DP  N  L    +   +++H      GPP TPY    F +D+++
Sbjct: 5   KRIIKEIQAAK----DDPEANITLSFVSE--SDIHHLKGSFYGPPGTPYEGGNFIVDIQV 58

Query: 64  PIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTREHWSPVWDLVHVIHAIWILL 123
           P++YP +PP+++F       + H N+   TG ICLDIL +  WSPV  L   + ++  LL
Sbjct: 59  PLEYPFKPPKMQF----DTKVYHPNISSVTGAICLDIL-KNAWSPVITLKSALISLQALL 113

Query: 124 GEPVPESPLNVDIAN 138
             P P  P + ++A 
Sbjct: 114 QSPEPNDPQDAEVAQ 128

>YGL058W Chr7 (393986..394504) [519 bp, 172 aa] {ON}
           RAD6Ubiquitin-conjugating enzyme (E2), involved in
           postreplication repair (as a heterodimer with Rad18p),
           DSBR and checkpoint control (as a heterodimer with
           Bre1p), ubiquitin-mediated N-end rule protein
           degradation (as a heterodimer with Ubr1p
          Length = 172

 Score = 80.1 bits (196), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 44/106 (41%), Positives = 62/106 (58%), Gaps = 6/106 (5%)

Query: 36  NMYHWIADISGPPETPYASAVFALDVELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGE 95
           N+  W A I GP +TPY    F L +E   +YP +PP VKFL    + + H NV +  GE
Sbjct: 32  NVMVWNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFL----SEMFHPNV-YANGE 86

Query: 96  ICLDILTREHWSPVWDLVHVIHAIWILLGEPVPESPLNVDIANVLK 141
           ICLDIL +  W+P +D+  ++ +I  L  +P P SP NV+ A + K
Sbjct: 87  ICLDIL-QNRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>AAR156C Chr1 complement(626372..626884) [513 bp, 170 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL058W
           (RAD6)
          Length = 170

 Score = 80.1 bits (196), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 44/106 (41%), Positives = 62/106 (58%), Gaps = 6/106 (5%)

Query: 36  NMYHWIADISGPPETPYASAVFALDVELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGE 95
           N+  W A I GP +TPY    F L +E   +YP +PP VKFL    + + H NV +  GE
Sbjct: 32  NVMVWNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFL----SEMFHPNV-YANGE 86

Query: 96  ICLDILTREHWSPVWDLVHVIHAIWILLGEPVPESPLNVDIANVLK 141
           ICLDIL +  W+P +D+  ++ +I  L  +P P SP NV+ A + K
Sbjct: 87  ICLDIL-QNRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>TDEL0G03610 Chr7 (667177..667218,667282..667749) [510 bp, 169 aa]
           {ON} Anc_6.109 YGL058W
          Length = 169

 Score = 80.1 bits (196), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 44/106 (41%), Positives = 62/106 (58%), Gaps = 6/106 (5%)

Query: 36  NMYHWIADISGPPETPYASAVFALDVELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGE 95
           N+  W A I GP +TPY    F L +E   +YP +PP VKFL    + + H NV +  GE
Sbjct: 32  NVMVWNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFL----SEMFHPNV-YANGE 86

Query: 96  ICLDILTREHWSPVWDLVHVIHAIWILLGEPVPESPLNVDIANVLK 141
           ICLDIL +  W+P +D+  ++ +I  L  +P P SP NV+ A + K
Sbjct: 87  ICLDIL-QNRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>SAKL0A07260g Chr1 (644551..644592,644678..645145) [510 bp, 169 aa]
           {ON} highly similar to uniprot|P06104 Saccharomyces
           cerevisiae YGL058W RAD6 Ubiquitin-conjugating enzyme
           (E2) involved in postreplication repair (with Rad18p)
           sporulation telomere silencing and ubiquitin-mediated N-
           end rule protein degradation (with Ubr1p)
          Length = 169

 Score = 80.1 bits (196), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 44/106 (41%), Positives = 62/106 (58%), Gaps = 6/106 (5%)

Query: 36  NMYHWIADISGPPETPYASAVFALDVELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGE 95
           N+  W A I GP +TPY    F L +E   +YP +PP VKFL    + + H NV +  GE
Sbjct: 32  NVMVWNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFL----SEMFHPNV-YANGE 86

Query: 96  ICLDILTREHWSPVWDLVHVIHAIWILLGEPVPESPLNVDIANVLK 141
           ICLDIL +  W+P +D+  ++ +I  L  +P P SP NV+ A + K
Sbjct: 87  ICLDIL-QNRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>Smik_7.222 Chr7 (388521..389036) [516 bp, 171 aa] {ON} YGL058W
           (REAL)
          Length = 171

 Score = 80.1 bits (196), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 44/106 (41%), Positives = 62/106 (58%), Gaps = 6/106 (5%)

Query: 36  NMYHWIADISGPPETPYASAVFALDVELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGE 95
           N+  W A I GP +TPY    F L +E   +YP +PP VKFL    + + H NV +  GE
Sbjct: 32  NVMVWNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFL----SEMFHPNV-YANGE 86

Query: 96  ICLDILTREHWSPVWDLVHVIHAIWILLGEPVPESPLNVDIANVLK 141
           ICLDIL +  W+P +D+  ++ +I  L  +P P SP NV+ A + K
Sbjct: 87  ICLDIL-QNRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>Ecym_3077 Chr3 (145205..145717) [513 bp, 170 aa] {ON} similar to
           Ashbya gossypii AAR156C
          Length = 170

 Score = 80.1 bits (196), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 44/106 (41%), Positives = 62/106 (58%), Gaps = 6/106 (5%)

Query: 36  NMYHWIADISGPPETPYASAVFALDVELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGE 95
           N+  W A I GP +TPY    F L +E   +YP +PP VKFL    + + H NV +  GE
Sbjct: 32  NVMVWNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFL----SEMFHPNV-YANGE 86

Query: 96  ICLDILTREHWSPVWDLVHVIHAIWILLGEPVPESPLNVDIANVLK 141
           ICLDIL +  W+P +D+  ++ +I  L  +P P SP NV+ A + K
Sbjct: 87  ICLDIL-QNRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>CAGL0M07568g Chr13 complement(758110..758607) [498 bp, 165 aa] {ON}
           highly similar to uniprot|Q02159 Saccharomyces
           cerevisiae YMR022w E2 ubiquitin-conjugation enzyme
          Length = 165

 Score = 79.7 bits (195), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 48/138 (34%), Positives = 70/138 (50%), Gaps = 18/138 (13%)

Query: 31  PKDTGNMYHWIADISGPPETPYASAVFALDVELPIQYPLEPPRVKFLPGSRNNICHCNVD 90
           PK   N++ W   I GPP+TPYA  VF   +E P  YPL PP++ F P    +I H N+ 
Sbjct: 28  PKSDDNLFVWDCLIQGPPDTPYAGGVFNAQLEFPKDYPLSPPKLTFTP----SILHPNI- 82

Query: 91  FKTGEICLDIL------------TREHWSPVWDLVHVIHAIWILLGEPVPESPLNVDIAN 138
           +  GE+C+ IL              E WSPV  +  ++ ++  +L EP  ES  N+D A 
Sbjct: 83  YPNGEVCISILHSPGDDPNMYESAEERWSPVQSVEKILLSVMSMLSEPNIESGANID-AC 141

Query: 139 VLKAGDLEAYEGLIKYYI 156
           +L   +   +E  +K  I
Sbjct: 142 ILWRDNRAEFEKQVKLSI 159

>Suva_7.213 Chr7 (387129..387650) [522 bp, 173 aa] {ON} YGL058W
           (REAL)
          Length = 173

 Score = 80.1 bits (196), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 44/106 (41%), Positives = 62/106 (58%), Gaps = 6/106 (5%)

Query: 36  NMYHWIADISGPPETPYASAVFALDVELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGE 95
           N+  W A I GP +TPY    F L +E   +YP +PP VKFL    + + H NV +  GE
Sbjct: 32  NVMVWNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFL----SEMFHPNV-YANGE 86

Query: 96  ICLDILTREHWSPVWDLVHVIHAIWILLGEPVPESPLNVDIANVLK 141
           ICLDIL +  W+P +D+  ++ +I  L  +P P SP NV+ A + K
Sbjct: 87  ICLDIL-QNRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>TBLA0F02440 Chr6 complement(594780..595304) [525 bp, 174 aa] {ON}
           Anc_6.109 YGL058W
          Length = 174

 Score = 79.7 bits (195), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 44/106 (41%), Positives = 62/106 (58%), Gaps = 6/106 (5%)

Query: 36  NMYHWIADISGPPETPYASAVFALDVELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGE 95
           N+  W A I GP +TPY    F L +E   +YP +PP VKFL    + + H NV +  GE
Sbjct: 32  NVMLWNAMIIGPSDTPYEDGTFRLVLEFDEEYPNKPPHVKFL----SEMFHPNV-YANGE 86

Query: 96  ICLDILTREHWSPVWDLVHVIHAIWILLGEPVPESPLNVDIANVLK 141
           ICLDIL +  W+P +D+  ++ +I  L  +P P SP NV+ A + K
Sbjct: 87  ICLDIL-QNRWTPTYDVSSILTSIQSLFNDPNPASPANVEAATLFK 131

>KNAG0H01870 Chr8 complement(332441..333073) [633 bp, 210 aa] {ON}
           Anc_1.436 YEL012W
          Length = 210

 Score = 80.5 bits (197), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 67/114 (58%), Gaps = 11/114 (9%)

Query: 46  GPPETPYASAVFALDVELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTREH 105
           GP +TPY + V+ L VELP  YP + P + F+    N I H N+D  +G ICLD++    
Sbjct: 39  GPKDTPYENGVWRLHVELPDNYPFKSPSIGFV----NKIYHPNIDIASGSICLDVINST- 93

Query: 106 WSPVWDLVHVIHAIWI---LLGEPVPESPLNVDIANVLKAGDLEAYEGLIKYYI 156
           WSP++DL++++   W+   LL EP    PLN + A  L+  D + YE  IK YI
Sbjct: 94  WSPLYDLLNIVE--WMIPGLLKEPNGSDPLNNEAA-TLQLRDKKMYEEKIKEYI 144

>ZYRO0E03806g Chr5 (288494..288498,288563..289187) [630 bp, 209 aa]
           {ON} highly similar to uniprot|P28263 Saccharomyces
           cerevisiae YEL012W UBC8 Ubiquitin-conjugating enzyme
           that negatively regulates gluconeogenesis by mediating
           the glucose-induced ubiquitination of fructose-1 6-
           bisphosphatase (FBPase) cytoplasmic enzyme that
           catalyzes the ubiquitination of histones in vitro
          Length = 209

 Score = 80.5 bits (197), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 49/124 (39%), Positives = 69/124 (55%), Gaps = 11/124 (8%)

Query: 36  NMYHWIADISGPPETPYASAVFALDVELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGE 95
           NM  +     GP +TPY + V+ L VELP  YP + P + F+    N I H N+D  +G 
Sbjct: 30  NMQEFHVKFHGPKDTPYETGVWRLHVELPDNYPYKSPSIGFV----NKIFHPNIDIASGS 85

Query: 96  ICLDILTREHWSPVWDLVHVIHAIWI---LLGEPVPESPLNVDIANVLKAGDLEAYEGLI 152
           ICLD++    WSP++DL +++   W+   LL EP    PLN + A  L+  D + YE  I
Sbjct: 86  ICLDVINST-WSPLYDLKNIVE--WMIPGLLKEPNGSDPLNNEAA-TLQLRDKKLYEEKI 141

Query: 153 KYYI 156
           K YI
Sbjct: 142 KEYI 145

>KLTH0A07546g Chr1 (635570..636217) [648 bp, 215 aa] {ON} highly
           similar to uniprot|P21734 Saccharomyces cerevisiae
           YDR177W UBC1 Ubiquitin-conjugating enzyme that mediates
           selective degradation of short-lived and abnormal
           proteins plays a role in vesicle biogenesis and ER-
           associated protein degradation (ERAD) component of the
           cellular stress response
          Length = 215

 Score = 80.5 bits (197), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 74/135 (54%), Gaps = 11/135 (8%)

Query: 4   QRITKEFKSVRKTLAEDPSYNHILKLEPKDTGNMYHWIADISGPPETPYASAVFALDVEL 63
           +R+ KE ++++    +DP     L+L   +  +++       GPP TPY +  F +D+E+
Sbjct: 5   KRVMKELQAIK----DDPEAKVDLQL--VNENDIHLLKGSFLGPPGTPYENGKFIVDIEV 58

Query: 64  PIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTREHWSPVWDLVHVIHAIWILL 123
           P++YP +PP++KF       + H NV   TG ICLDIL +  WSPV  L   + ++  LL
Sbjct: 59  PMEYPFKPPKMKF----DTKVYHPNVSSVTGAICLDIL-KNAWSPVITLKSALISLQALL 113

Query: 124 GEPVPESPLNVDIAN 138
             P P  P + ++A 
Sbjct: 114 QSPEPNDPQDAEVAQ 128

>NDAI0I01650 Chr9 complement(388545..389075) [531 bp, 176 aa] {ON} 
          Length = 176

 Score = 79.7 bits (195), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 44/106 (41%), Positives = 61/106 (57%), Gaps = 6/106 (5%)

Query: 36  NMYHWIADISGPPETPYASAVFALDVELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGE 95
           N+  W A I GP ETPY    F L +E   +YP+  P VKFL    + + H NV +  GE
Sbjct: 32  NVMVWNAMIIGPAETPYEDGTFRLLLEFDEEYPINRPHVKFL----SEMFHPNV-YANGE 86

Query: 96  ICLDILTREHWSPVWDLVHVIHAIWILLGEPVPESPLNVDIANVLK 141
           ICLDIL +  W+P +D+  ++ +I  L  +P P SP NV+ A + K
Sbjct: 87  ICLDIL-QNRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>Kwal_26.8224 s26 (695345..695842) [498 bp, 165 aa] {ON} YMR022W
           (QRI8) - ubiquitin conjugating enzyme [contig 58] FULL
          Length = 165

 Score = 79.3 bits (194), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 53/168 (31%), Positives = 82/168 (48%), Gaps = 21/168 (12%)

Query: 1   MSLQRITKEFKSVRKTLAEDPSYNHILKLEPKDTGNMYHWIADISGPPETPYASAVFALD 60
           MS     + FK +++ L + P     +   PK   N++ W   ISGPP++PY   VF   
Sbjct: 1   MSKTAQKRLFKELQQLLKDSP---EGIVAGPKSEDNLFVWDCLISGPPDSPYQGGVFNAT 57

Query: 61  VELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDI------------LTREHWSP 108
           +E P  YPL PP++ F P    +I H N+ +  GE+C+ I            L  E WSP
Sbjct: 58  LEFPKDYPLSPPKLLFTP----SILHPNI-YPNGEVCISILHSPGDDPNMYELAEERWSP 112

Query: 109 VWDLVHVIHAIWILLGEPVPESPLNVDIANVLKAGDLEAYEGLIKYYI 156
           V  +  ++ ++  +L EP  ES  N+D A +L   +   +E  +K  I
Sbjct: 113 VQSVEKILLSVMSMLSEPNVESGANID-ACILWRDNRPEFERQVKLSI 159

>KAFR0H02960 Chr8 complement(566019..566582) [564 bp, 187 aa] {ON}
           Anc_1.436 YEL012W
          Length = 187

 Score = 79.7 bits (195), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 49/124 (39%), Positives = 68/124 (54%), Gaps = 11/124 (8%)

Query: 36  NMYHWIADISGPPETPYASAVFALDVELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGE 95
           NM  +     GP +TPY   V+ L VELP  YP + P + F+    N I H N+D  +G 
Sbjct: 28  NMQEFHVKFHGPKDTPYEHGVWRLHVELPDNYPYKSPSIGFV----NKIFHPNIDVASGS 83

Query: 96  ICLDILTREHWSPVWDLVHVIHAIWI---LLGEPVPESPLNVDIANVLKAGDLEAYEGLI 152
           ICLD++    WSP++DL++++   W+   LL EP    PLN + A  L+  D   YE  I
Sbjct: 84  ICLDVINST-WSPLYDLINIVE--WMIPGLLKEPNGSDPLNNEAA-TLQLRDKVLYEQKI 139

Query: 153 KYYI 156
           K YI
Sbjct: 140 KEYI 143

>CAGL0I00352g Chr9 (26900..27403) [504 bp, 167 aa] {ON} highly
           similar to uniprot|P06104 Saccharomyces cerevisiae
           YGL058w RAD6 E2 ubiquitin-conjugating
          Length = 167

 Score = 79.3 bits (194), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 44/106 (41%), Positives = 61/106 (57%), Gaps = 6/106 (5%)

Query: 36  NMYHWIADISGPPETPYASAVFALDVELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGE 95
           N+  W A I GP +TPY    F L +E    YP +PP VKFL    + + H NV +  GE
Sbjct: 32  NVMVWNAMIIGPADTPYEDGTFRLLLEFDEDYPNKPPHVKFL----SEMFHPNV-YANGE 86

Query: 96  ICLDILTREHWSPVWDLVHVIHAIWILLGEPVPESPLNVDIANVLK 141
           ICLDIL +  W+P +D+  ++ +I  L  +P P SP NV+ A + K
Sbjct: 87  ICLDIL-QNRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>Smik_13.186 Chr13 (310465..310962) [498 bp, 165 aa] {ON} YMR022W
           (REAL)
          Length = 165

 Score = 79.0 bits (193), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 48/138 (34%), Positives = 70/138 (50%), Gaps = 18/138 (13%)

Query: 31  PKDTGNMYHWIADISGPPETPYASAVFALDVELPIQYPLEPPRVKFLPGSRNNICHCNVD 90
           PK   N++ W   I GPP+TPYA  VF   +E P  YPL PP++ F P    +I H N+ 
Sbjct: 28  PKSENNIFVWDCLIQGPPDTPYADGVFNAKLEFPKDYPLSPPKLTFTP----SILHPNI- 82

Query: 91  FKTGEICLDI------------LTREHWSPVWDLVHVIHAIWILLGEPVPESPLNVDIAN 138
           +  GE+C+ I            L  E WSPV  +  ++ ++  +L EP  ES  N+D A 
Sbjct: 83  YPNGEVCISILHSPGDDPNMYELAEERWSPVQSVEKILLSVMSMLSEPNIESGANID-AC 141

Query: 139 VLKAGDLEAYEGLIKYYI 156
           +L   +   +E  +K  I
Sbjct: 142 ILWRDNRPEFEKQVKLSI 159

>TPHA0J01750 Chr10 complement(404340..404849) [510 bp, 169 aa] {ON}
           Anc_6.109 YGL058W
          Length = 169

 Score = 79.0 bits (193), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 43/106 (40%), Positives = 62/106 (58%), Gaps = 6/106 (5%)

Query: 36  NMYHWIADISGPPETPYASAVFALDVELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGE 95
           N+  W A I GP +TPY    F L +E   +YP +PP VKF+    + + H NV +  GE
Sbjct: 32  NVMIWNAMIIGPSDTPYEDGTFRLLLEFDEEYPNKPPHVKFI----SEMFHPNV-YANGE 86

Query: 96  ICLDILTREHWSPVWDLVHVIHAIWILLGEPVPESPLNVDIANVLK 141
           ICLDIL +  W+P +D+  ++ +I  L  +P P SP NV+ A + K
Sbjct: 87  ICLDIL-QNRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>Suva_13.189 Chr13 (309254..309751) [498 bp, 165 aa] {ON} YMR022W
           (REAL)
          Length = 165

 Score = 79.0 bits (193), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 48/138 (34%), Positives = 70/138 (50%), Gaps = 18/138 (13%)

Query: 31  PKDTGNMYHWIADISGPPETPYASAVFALDVELPIQYPLEPPRVKFLPGSRNNICHCNVD 90
           PK   N++ W   I GPP+TPYA  VF   +E P  YPL PP++ F P    +I H N+ 
Sbjct: 28  PKSENNIFVWDCLIQGPPDTPYADGVFNTKLEFPKDYPLSPPKLTFTP----SILHPNI- 82

Query: 91  FKTGEICLDI------------LTREHWSPVWDLVHVIHAIWILLGEPVPESPLNVDIAN 138
           +  GE+C+ I            L  E WSPV  +  ++ ++  +L EP  ES  N+D A 
Sbjct: 83  YPNGEVCISILHSPGDDPNMYELAEERWSPVQSVEKILLSVMSMLSEPNIESGANID-AC 141

Query: 139 VLKAGDLEAYEGLIKYYI 156
           +L   +   +E  +K  I
Sbjct: 142 ILWRDNRPEFERQVKLSI 159

>Kwal_23.6485 s23 (1608161..1608808) [648 bp, 215 aa] {ON} YDR177W
           (UBC1) - ubiquitin-conjugating enzyme [contig 18] FULL
          Length = 215

 Score = 80.1 bits (196), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 44/135 (32%), Positives = 75/135 (55%), Gaps = 11/135 (8%)

Query: 4   QRITKEFKSVRKTLAEDPSYNHILKLEPKDTGNMYHWIADISGPPETPYASAVFALDVEL 63
           +R+ KE ++++    +DP     L+L   +  +++       GPP TPY +  + +D+E+
Sbjct: 5   KRVMKELQAIK----DDPEARVDLQL--VNENDIHLLKGSFLGPPGTPYENGKYIVDIEV 58

Query: 64  PIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTREHWSPVWDLVHVIHAIWILL 123
           P++YP +PP++KF    +  + H NV   TG ICLDIL +  WSPV  L   + ++  LL
Sbjct: 59  PMEYPFKPPKMKF----QTKVYHPNVSSVTGAICLDIL-KNAWSPVITLKSALISLQALL 113

Query: 124 GEPVPESPLNVDIAN 138
             P P  P + ++A 
Sbjct: 114 QSPEPNDPQDAEVAQ 128

>TDEL0B05670 Chr2 (1001037..1001648) [612 bp, 203 aa] {ON} Anc_1.436
           YEL012W
          Length = 203

 Score = 79.7 bits (195), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 49/124 (39%), Positives = 68/124 (54%), Gaps = 11/124 (8%)

Query: 36  NMYHWIADISGPPETPYASAVFALDVELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGE 95
           NM  +     GP +TPY   V+ L VELP  YP + P + F+    N I H N+D  +G 
Sbjct: 16  NMQEFHVKFRGPKDTPYEKGVWRLHVELPDNYPYKSPSIGFV----NKILHPNIDVASGS 71

Query: 96  ICLDILTREHWSPVWDLVHVIHAIWI---LLGEPVPESPLNVDIANVLKAGDLEAYEGLI 152
           ICLD++    WSP++DL +++   W+   LL EP    PLN + A  L+  D + YE  I
Sbjct: 72  ICLDVINST-WSPLYDLKNIVE--WMIPGLLKEPNGSDPLNNEAA-TLQLRDKKLYEEKI 127

Query: 153 KYYI 156
           K YI
Sbjct: 128 KEYI 131

>KNAG0F02570 Chr6 (482998..483453) [456 bp, 151 aa] {ON} Anc_6.109
           YGL058W
          Length = 151

 Score = 78.6 bits (192), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 44/106 (41%), Positives = 61/106 (57%), Gaps = 6/106 (5%)

Query: 36  NMYHWIADISGPPETPYASAVFALDVELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGE 95
           N+  W A I GP +TPY    F L +E    YP +PP VKFL    + + H NV +  GE
Sbjct: 17  NVMVWNAMIIGPADTPYEDGTFRLLLEFDEDYPNKPPHVKFL----SEMFHPNV-YANGE 71

Query: 96  ICLDILTREHWSPVWDLVHVIHAIWILLGEPVPESPLNVDIANVLK 141
           ICLDIL +  W+P +D+  ++ +I  L  +P P SP NV+ A + K
Sbjct: 72  ICLDIL-QNRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 116

>Skud_5.87 Chr5 (131751..132380) [630 bp, 210 aa] {ON} YEL012W
           (REAL)
          Length = 210

 Score = 79.7 bits (195), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 67/114 (58%), Gaps = 11/114 (9%)

Query: 46  GPPETPYASAVFALDVELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTREH 105
           GP +TPY + V+ L VELP  YP + P + F+    N I H N+D  +G ICLD++    
Sbjct: 37  GPKDTPYENGVWRLHVELPDNYPYKSPSIGFV----NKIFHPNIDIASGSICLDVINS-T 91

Query: 106 WSPVWDLVHVIHAIWI---LLGEPVPESPLNVDIANVLKAGDLEAYEGLIKYYI 156
           WSP++DL++++   W+   LL EP    PLN + A  L+  D + YE  IK YI
Sbjct: 92  WSPLYDLINILE--WMIPGLLKEPNGSDPLNNEAA-TLQLRDKKLYEEKIKEYI 142

>YMR022W Chr13 (318680..319177) [498 bp, 165 aa] {ON}  UBC7Ubiquitin
           conjugating enzyme, involved in the ER-associated
           protein degradation pathway; requires Cue1p for
           recruitment to the ER membrane; proposed to be involved
           in chromatin assembly
          Length = 165

 Score = 78.6 bits (192), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 48/138 (34%), Positives = 70/138 (50%), Gaps = 18/138 (13%)

Query: 31  PKDTGNMYHWIADISGPPETPYASAVFALDVELPIQYPLEPPRVKFLPGSRNNICHCNVD 90
           PK   N++ W   I GPP+TPYA  VF   +E P  YPL PP++ F P    +I H N+ 
Sbjct: 28  PKSENNIFIWDCLIQGPPDTPYADGVFNAKLEFPKDYPLSPPKLTFTP----SILHPNI- 82

Query: 91  FKTGEICLDI------------LTREHWSPVWDLVHVIHAIWILLGEPVPESPLNVDIAN 138
           +  GE+C+ I            L  E WSPV  +  ++ ++  +L EP  ES  N+D A 
Sbjct: 83  YPNGEVCISILHSPGDDPNMYELAEERWSPVQSVEKILLSVMSMLSEPNIESGANID-AC 141

Query: 139 VLKAGDLEAYEGLIKYYI 156
           +L   +   +E  +K  I
Sbjct: 142 ILWRDNRPEFERQVKLSI 159

>YEL012W Chr5 (131772..131776,131900..132551) [657 bp, 218 aa] {ON} 
           UBC8Ubiquitin-conjugating enzyme that negatively
           regulates gluconeogenesis by mediating the
           glucose-induced ubiquitination of
           fructose-1,6-bisphosphatase (FBPase); cytoplasmic enzyme
           that catalyzes the ubiquitination of histones in vitro
          Length = 218

 Score = 80.1 bits (196), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 67/114 (58%), Gaps = 11/114 (9%)

Query: 46  GPPETPYASAVFALDVELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTREH 105
           GP +TPY + V+ L VELP  YP + P + F+    N I H N+D  +G ICLD++    
Sbjct: 38  GPKDTPYENGVWRLHVELPDNYPYKSPSIGFV----NKIFHPNIDIASGSICLDVINST- 92

Query: 106 WSPVWDLVHVIHAIWI---LLGEPVPESPLNVDIANVLKAGDLEAYEGLIKYYI 156
           WSP++DL++++   W+   LL EP    PLN + A  L+  D + YE  IK YI
Sbjct: 93  WSPLYDLINIVE--WMIPGLLKEPNGSDPLNNEAA-TLQLRDKKLYEEKIKEYI 143

>CAGL0M03399g Chr13 complement(389650..390294) [645 bp, 214 aa] {ON}
           highly similar to uniprot|P28263 Saccharomyces
           cerevisiae YEL012w UBC8 E2 ubiquitin-conjugating enzyme
          Length = 214

 Score = 79.7 bits (195), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 47/124 (37%), Positives = 70/124 (56%), Gaps = 11/124 (8%)

Query: 36  NMYHWIADISGPPETPYASAVFALDVELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGE 95
           +M  +     GP +TPY   V+ L VELP  YP + P + F+    N I H N+D  +G 
Sbjct: 29  SMQEFHVKFYGPKDTPYEGGVWRLHVELPDNYPYKSPSIGFV----NKIFHPNIDIASGS 84

Query: 96  ICLDILTREHWSPVWDLVHVIHAIWI---LLGEPVPESPLNVDIANVLKAGDLEAYEGLI 152
           ICLD++    WSP++DL++++   W+   LL EP    PLN + AN L+  D + YE  +
Sbjct: 85  ICLDVINS-TWSPLYDLLNIVE--WMLPGLLKEPNGSDPLNNEAAN-LQLKDKKVYEEKV 140

Query: 153 KYYI 156
           + YI
Sbjct: 141 REYI 144

>Kpol_461.8 s461 (14306..14809) [504 bp, 167 aa] {ON} (14306..14809)
           [504 nt, 168 aa]
          Length = 167

 Score = 78.6 bits (192), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 43/106 (40%), Positives = 62/106 (58%), Gaps = 6/106 (5%)

Query: 36  NMYHWIADISGPPETPYASAVFALDVELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGE 95
           N+  W A I GP +TPY    F L +E   +YP +PP VKF+    + + H NV +  GE
Sbjct: 32  NVMVWNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFV----SEMFHPNV-YANGE 86

Query: 96  ICLDILTREHWSPVWDLVHVIHAIWILLGEPVPESPLNVDIANVLK 141
           ICLDIL +  W+P +D+  ++ +I  L  +P P SP NV+ A + K
Sbjct: 87  ICLDIL-QNRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>KLLA0C05632g Chr3 complement(503484..503978) [495 bp, 164 aa] {ON}
           highly similar to uniprot|P06104 Saccharomyces
           cerevisiae YGL058W RAD6 Ubiquitin-conjugating enzyme
           (E2) involved in postreplication repair (with Rad18p)
           sporulation telomere silencing and ubiquitin-mediated N-
           end rule protein degradation (with Ubr1p)
          Length = 164

 Score = 78.6 bits (192), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 43/106 (40%), Positives = 62/106 (58%), Gaps = 6/106 (5%)

Query: 36  NMYHWIADISGPPETPYASAVFALDVELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGE 95
           N+  W A I GP +TPY    F L +E   +YP +PP VKFL    + + H NV +  GE
Sbjct: 32  NVMIWNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFL----SEMFHPNV-YANGE 86

Query: 96  ICLDILTREHWSPVWDLVHVIHAIWILLGEPVPESPLNVDIANVLK 141
           ICLDIL +  W+P +D+  ++ +I  L  +P P SP NV+ A + +
Sbjct: 87  ICLDIL-QNRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFQ 131

>Smik_5.98 Chr5 (138141..138145,138263..138905) [648 bp, 215 aa]
           {ON} YEL012W (REAL)
          Length = 215

 Score = 79.7 bits (195), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 67/114 (58%), Gaps = 11/114 (9%)

Query: 46  GPPETPYASAVFALDVELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTREH 105
           GP +TPY + V+ L VELP  YP + P + F+    N I H N+D  +G ICLD++    
Sbjct: 38  GPKDTPYENGVWRLHVELPDNYPYKSPSIGFV----NKIFHPNIDIASGSICLDVINST- 92

Query: 106 WSPVWDLVHVIHAIWI---LLGEPVPESPLNVDIANVLKAGDLEAYEGLIKYYI 156
           WSP++DL++++   W+   LL EP    PLN + A  L+  D + YE  IK YI
Sbjct: 93  WSPLYDLINIVE--WMIPGLLKEPNGSDPLNNEAA-TLQLRDKKLYEEKIKEYI 143

>Suva_5.53 Chr5 complement(95600..96242,96354..96358) [648 bp, 215
           aa] {ON} YEL012W (REAL)
          Length = 215

 Score = 79.7 bits (195), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 67/114 (58%), Gaps = 11/114 (9%)

Query: 46  GPPETPYASAVFALDVELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTREH 105
           GP +TPY + V+ L VELP  YP + P + F+    N I H N+D  +G ICLD++    
Sbjct: 38  GPKDTPYENGVWRLHVELPDNYPYKSPSIGFV----NKIFHPNIDIASGSICLDVINS-T 92

Query: 106 WSPVWDLVHVIHAIWI---LLGEPVPESPLNVDIANVLKAGDLEAYEGLIKYYI 156
           WSP++DL++++   W+   LL EP    PLN + A  L+  D + YE  IK YI
Sbjct: 93  WSPLYDLINIVE--WMIPGLLKEPNGSDPLNNEAA-TLQLRDKKLYEEKIKEYI 143

>Skud_13.176 Chr13 (305317..305814) [498 bp, 165 aa] {ON} YMR022W
           (REAL)
          Length = 165

 Score = 78.6 bits (192), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 47/138 (34%), Positives = 70/138 (50%), Gaps = 18/138 (13%)

Query: 31  PKDTGNMYHWIADISGPPETPYASAVFALDVELPIQYPLEPPRVKFLPGSRNNICHCNVD 90
           PK   N++ W   I GPP+TPYA  +F   +E P  YPL PP++ F P    +I H N+ 
Sbjct: 28  PKSENNIFVWDCLIQGPPDTPYADGIFNAKLEFPKDYPLSPPKLTFTP----SILHPNI- 82

Query: 91  FKTGEICLDI------------LTREHWSPVWDLVHVIHAIWILLGEPVPESPLNVDIAN 138
           +  GE+C+ I            L  E WSPV  +  ++ ++  +L EP  ES  N+D A 
Sbjct: 83  YPNGEVCISILHSPGDDPNMYELAEERWSPVQSVEKILLSVMSMLSEPNIESGANID-AC 141

Query: 139 VLKAGDLEAYEGLIKYYI 156
           +L   +   +E  +K  I
Sbjct: 142 ILWRDNRPEFEKQVKLSI 159

>SAKL0H17930g Chr8 complement(1598218..1598649,1598712..1598741)
           [462 bp, 153 aa] {ON} highly similar to uniprot|P52490
           Saccharomyces cerevisiae YDR092W UBC13
           Ubiquitin-conjugating enzyme involved in the error-free
           DNA postreplication repair pathway interacts with Mms2p
           to assemble ubiquitin chains at the Ub Lys-63 residue
           DNA damage triggers redistribution from the cytoplasm to
           the nucleus
          Length = 153

 Score = 78.2 bits (191), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 51/134 (38%), Positives = 74/134 (55%), Gaps = 13/134 (9%)

Query: 4   QRITKEFKSVRKTLAEDPSYNHILKLEPKDTGNMYHWIADISGPPETPYASAVFALDVEL 63
           +RI KE +     L  DP     +  EP D  N+ ++   I GP ++PY + VF L++ L
Sbjct: 6   KRIIKETER----LVSDPVPG--ISAEPHD-DNLRYFQVTIEGPQQSPYENGVFELELFL 58

Query: 64  PIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTREHWSPVWDLVHVIHAIWILL 123
           P  YP+E P+V+FL      I H N+D + G ICLD+L + +WSP   +  V+ +I  LL
Sbjct: 59  PEDYPMEAPKVRFL----TKIYHPNID-RLGRICLDVL-KNNWSPALQIRTVLLSIQALL 112

Query: 124 GEPVPESPLNVDIA 137
             P P  PL  D+A
Sbjct: 113 ASPNPNDPLANDVA 126

>AGR121C Chr7 complement(977481..977915,977965..977994) [465 bp, 154
           aa] {ON} Syntenic homolog of Saccharomyces cerevisiae
           YDR092W (UBC13); 1-intron
          Length = 154

 Score = 78.2 bits (191), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 51/135 (37%), Positives = 75/135 (55%), Gaps = 13/135 (9%)

Query: 4   QRITKEFKSVRKTLAEDPSYNHILKLEPKDTGNMYHWIADISGPPETPYASAVFALDVEL 63
           +RI KE +     L  DP     +  EP +  N+ ++   I GP ++PY   VF L++ L
Sbjct: 6   KRIIKETER----LVSDPVPG--ISAEPHE-DNLRYFDVSIEGPQQSPYEHGVFRLELFL 58

Query: 64  PIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTREHWSPVWDLVHVIHAIWILL 123
           P +YP+EPP+V+FL      I H N+D + G ICLD+L + +WSP   +  V+ +I  LL
Sbjct: 59  PDEYPMEPPKVRFL----TKIYHPNID-RLGRICLDVL-KTNWSPALQIRTVLLSIQALL 112

Query: 124 GEPVPESPLNVDIAN 138
             P P  PL  D+A 
Sbjct: 113 ATPNPNDPLANDVAK 127

>KLLA0C18656g Chr3 (1654787..1655473) [687 bp, 228 aa] {ON} highly
           similar to uniprot|P21734 Saccharomyces cerevisiae
           YDR177W UBC1 Ubiquitin-conjugating enzyme that mediates
           selective degradation of short-lived and abnormal
           proteins plays a role in vesicle biogenesis and ER-
           associated protein degradation (ERAD) component of the
           cellular stress response
          Length = 228

 Score = 79.7 bits (195), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 46/134 (34%), Positives = 70/134 (52%), Gaps = 11/134 (8%)

Query: 4   QRITKEFKSVRKTLAEDPSYNHILKLEPKDTGNMYHWIADISGPPETPYASAVFALDVEL 63
           +RI KE ++V+    EDP     LK    +  +++H      GP  TPY    F +D+ +
Sbjct: 5   KRILKEIQAVK----EDPEAQIELKF--VNESDIHHMKGSFIGPSGTPYEGGKFVVDINI 58

Query: 64  PIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTREHWSPVWDLVHVIHAIWILL 123
           P++YP +PP++KF       + H NV   TG ICLDIL +  W+PV  L   + ++  LL
Sbjct: 59  PVEYPYKPPQMKF----DTKVYHPNVSSVTGAICLDIL-KNAWTPVITLKSALISLQALL 113

Query: 124 GEPVPESPLNVDIA 137
             P P  P +  +A
Sbjct: 114 QSPEPNDPQDAQVA 127

>KAFR0A04700 Chr1 (930462..930923) [462 bp, 153 aa] {ON} Anc_6.109
           YGL058W
          Length = 153

 Score = 77.8 bits (190), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 44/106 (41%), Positives = 61/106 (57%), Gaps = 6/106 (5%)

Query: 36  NMYHWIADISGPPETPYASAVFALDVELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGE 95
           N+  W A I GP +TPY    F L +E    YP +PP VKFL    + + H NV +  GE
Sbjct: 17  NVMVWNAMIIGPADTPYEDGTFRLLLEFDEDYPNKPPHVKFL----SEMFHPNV-YANGE 71

Query: 96  ICLDILTREHWSPVWDLVHVIHAIWILLGEPVPESPLNVDIANVLK 141
           ICLDIL +  W+P +D+  ++ +I  L  +P P SP NV+ A + K
Sbjct: 72  ICLDIL-QNRWTPTYDVSSILTSIQSLFNDPNPASPANVEAATLFK 116

>KLTH0G14366g Chr7 (1251249..1251278,1251389..1251808) [450 bp, 149
           aa] {ON} highly similar to uniprot|P52490 Saccharomyces
           cerevisiae YDR092W UBC13 Ubiquitin-conjugating enzyme
           involved in the error-free DNA postreplication repair
           pathway interacts with Mms2p to assemble ubiquitin
           chains at the Ub Lys-63 residue DNA damage triggers
           redistribution from the cytoplasm to the nucleus
          Length = 149

 Score = 77.4 bits (189), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 61/102 (59%), Gaps = 6/102 (5%)

Query: 36  NMYHWIADISGPPETPYASAVFALDVELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGE 95
           N+ ++   I GP ++PY S VF L++ LP  YP+E P+V+FL      I H N+D + G 
Sbjct: 31  NLRYFQVTIEGPQQSPYESGVFQLELFLPDDYPMEAPKVRFL----TKIYHPNID-RLGR 85

Query: 96  ICLDILTREHWSPVWDLVHVIHAIWILLGEPVPESPLNVDIA 137
           ICLD+L + +WSP   +  V+ ++  LL  P P  PL  D+A
Sbjct: 86  ICLDVL-KTNWSPALQIRTVLLSVQALLASPNPNDPLANDVA 126

>Skud_4.352 Chr4 (607037..607465) [429 bp, 143 aa] {ON} YDR092W
           (REAL)
          Length = 143

 Score = 77.0 bits (188), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 44/108 (40%), Positives = 63/108 (58%), Gaps = 7/108 (6%)

Query: 30  EPKDTGNMYHWIADISGPPETPYASAVFALDVELPIQYPLEPPRVKFLPGSRNNICHCNV 89
           EP D  N+ ++   I GP ++PY   VF L++ LP  YP+E P+V+FL      I H N+
Sbjct: 16  EPHD-DNLRYFQVTIEGPEQSPYEDGVFELELYLPDDYPMEAPKVRFL----TRIYHPNI 70

Query: 90  DFKTGEICLDILTREHWSPVWDLVHVIHAIWILLGEPVPESPLNVDIA 137
           D + G ICLD+L + +WSP   +  V+ +I  LL  P P  PL  D+A
Sbjct: 71  D-RLGRICLDVL-KTNWSPALQIRTVLLSIQALLASPNPNDPLANDVA 116

>KAFR0A02420 Chr1 complement(506887..507330) [444 bp, 147 aa] {ON}
           Anc_8.230 YDR092W
          Length = 147

 Score = 77.0 bits (188), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 43/108 (39%), Positives = 63/108 (58%), Gaps = 7/108 (6%)

Query: 30  EPKDTGNMYHWIADISGPPETPYASAVFALDVELPIQYPLEPPRVKFLPGSRNNICHCNV 89
           EP D  N+ ++   I GP ++PY   +F L++ LP  YP+E P+V+FL      I H N+
Sbjct: 22  EPHD-DNLRYFKVSIEGPEQSPYEKGIFQLELYLPDDYPMEAPKVRFL----TKIYHPNI 76

Query: 90  DFKTGEICLDILTREHWSPVWDLVHVIHAIWILLGEPVPESPLNVDIA 137
           D + G ICLDIL + +WSP   +  V+ ++  LL  P P  PL  D+A
Sbjct: 77  D-RLGRICLDIL-KTNWSPALQIRTVLLSVQALLASPNPNDPLANDVA 122

>Suva_2.253 Chr2 (429581..430009) [429 bp, 143 aa] {ON} YDR092W
           (REAL)
          Length = 143

 Score = 77.0 bits (188), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 44/108 (40%), Positives = 63/108 (58%), Gaps = 7/108 (6%)

Query: 30  EPKDTGNMYHWIADISGPPETPYASAVFALDVELPIQYPLEPPRVKFLPGSRNNICHCNV 89
           EP D  N+ ++   I GP ++PY   VF L++ LP  YP+E P+V+FL      I H N+
Sbjct: 16  EPHD-DNLRYFQVTIEGPEQSPYEDGVFKLELFLPDDYPMEAPKVRFL----TKIYHPNI 70

Query: 90  DFKTGEICLDILTREHWSPVWDLVHVIHAIWILLGEPVPESPLNVDIA 137
           D + G ICLD+L + +WSP   +  V+ +I  LL  P P  PL  D+A
Sbjct: 71  D-RLGRICLDVL-KTNWSPALQIRTVLLSIQALLASPNPNDPLANDVA 116

>Kpol_1030.18 s1030 (30890..30894,31122..31788) [672 bp, 223 aa]
           {ON} (30890..30894,31122..31788) [672 nt, 224 aa]
          Length = 223

 Score = 79.0 bits (193), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 48/124 (38%), Positives = 68/124 (54%), Gaps = 11/124 (8%)

Query: 36  NMYHWIADISGPPETPYASAVFALDVELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGE 95
           NM  +     GP +TPY +  + L VELP  YP + P + F+    N I H N+D  +G 
Sbjct: 29  NMQEFYVKFCGPKDTPYENGCWRLHVELPDNYPYKSPSIGFV----NKIFHPNIDIASGS 84

Query: 96  ICLDILTREHWSPVWDLVHVIHAIWI---LLGEPVPESPLNVDIANVLKAGDLEAYEGLI 152
           ICLD++    WSP++DL++++   W+   LL EP    PLN + A  L+  D   YE  I
Sbjct: 85  ICLDVINS-TWSPLYDLLNIVE--WMIPGLLKEPNGSDPLNNEAAG-LQLHDKTLYEQKI 140

Query: 153 KYYI 156
           K YI
Sbjct: 141 KEYI 144

>Skud_7.222 Chr7 (397309..397821) [513 bp, 170 aa] {ON} YGL058W
           (REAL)
          Length = 170

 Score = 77.4 bits (189), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 43/106 (40%), Positives = 61/106 (57%), Gaps = 6/106 (5%)

Query: 36  NMYHWIADISGPPETPYASAVFALDVELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGE 95
           N+  W A I GP +T Y    F L +E   +YP +PP VKFL    + + H NV +  GE
Sbjct: 32  NVMVWNAMIIGPADTSYEDGTFRLLLEFDEEYPNKPPHVKFL----SEMFHPNV-YANGE 86

Query: 96  ICLDILTREHWSPVWDLVHVIHAIWILLGEPVPESPLNVDIANVLK 141
           ICLDIL +  W+P +D+  ++ +I  L  +P P SP NV+ A + K
Sbjct: 87  ICLDIL-QNRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>TDEL0A01340 Chr1 complement(239400..239843,239923..239952) [474 bp,
           157 aa] {ON} Anc_3.308 YBR082C
          Length = 157

 Score = 77.0 bits (188), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 61/102 (59%), Gaps = 6/102 (5%)

Query: 36  NMYHWIADISGPPETPYASAVFALDVELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGE 95
           N+ ++   I GP ++PY + VF L++ LP  YP+E P+V+FL      I H N+D K G 
Sbjct: 31  NLRYFQVTIEGPQQSPYENGVFNLELFLPDDYPMEAPKVRFL----TKIYHPNID-KLGR 85

Query: 96  ICLDILTREHWSPVWDLVHVIHAIWILLGEPVPESPLNVDIA 137
           ICLD+L + +WSP   +  V+ ++  LL  P P  PL  D+A
Sbjct: 86  ICLDVL-KTNWSPALQIRTVLLSVQALLASPNPNDPLANDVA 126

>Kpol_1075.1b s1075 (1500..1958) [459 bp, 152 aa] {ON} (1500..1958)
           [459 nt, 153 aa]
          Length = 152

 Score = 77.0 bits (188), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 44/108 (40%), Positives = 64/108 (59%), Gaps = 7/108 (6%)

Query: 30  EPKDTGNMYHWIADISGPPETPYASAVFALDVELPIQYPLEPPRVKFLPGSRNNICHCNV 89
           EP D  N+ ++   I GP ++PY + VF L++ LP  YP+E P+V+FL      I H N+
Sbjct: 26  EPHD-DNLRYFEVTIEGPQQSPYENGVFDLELFLPDDYPMEAPKVRFL----TKIYHPNI 80

Query: 90  DFKTGEICLDILTREHWSPVWDLVHVIHAIWILLGEPVPESPLNVDIA 137
           D + G ICLD+L + +WSP   +  V+ +I  LL  P P  PL  D+A
Sbjct: 81  D-RLGRICLDVL-KTNWSPALQIRTVLLSIQALLASPNPNDPLANDVA 126

>YDR092W Chr4 (629876..629905,630174..630605) [462 bp, 153 aa] {ON} 
           UBC13Ubiquitin-conjugating enzyme involved in the
           error-free DNA postreplication repair pathway; interacts
           with Mms2p to assemble ubiquitin chains at the Ub Lys-63
           residue; DNA damage triggers redistribution from the
           cytoplasm to the nucleus
          Length = 153

 Score = 77.0 bits (188), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 50/134 (37%), Positives = 73/134 (54%), Gaps = 13/134 (9%)

Query: 4   QRITKEFKSVRKTLAEDPSYNHILKLEPKDTGNMYHWIADISGPPETPYASAVFALDVEL 63
           +RI KE +     L  DP     +  EP D  N+ ++   I GP ++PY   +F L++ L
Sbjct: 6   KRIIKETEK----LVSDPVPG--ITAEPHD-DNLRYFQVTIEGPEQSPYEDGIFELELYL 58

Query: 64  PIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTREHWSPVWDLVHVIHAIWILL 123
           P  YP+E P+V+FL      I H N+D + G ICLD+L + +WSP   +  V+ +I  LL
Sbjct: 59  PDDYPMEAPKVRFL----TKIYHPNID-RLGRICLDVL-KTNWSPALQIRTVLLSIQALL 112

Query: 124 GEPVPESPLNVDIA 137
             P P  PL  D+A
Sbjct: 113 ASPNPNDPLANDVA 126

>Smik_4.335 Chr4 (596360..596788) [429 bp, 143 aa] {ON} YDR092W
           (REAL)
          Length = 143

 Score = 76.6 bits (187), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 43/108 (39%), Positives = 63/108 (58%), Gaps = 7/108 (6%)

Query: 30  EPKDTGNMYHWIADISGPPETPYASAVFALDVELPIQYPLEPPRVKFLPGSRNNICHCNV 89
           EP D  N+ ++   I GP ++PY   +F L++ LP  YP+E P+V+FL      I H N+
Sbjct: 16  EPHD-DNLRYFQVTIEGPEQSPYEDGIFELELYLPDDYPMEAPKVRFL----TKIYHPNI 70

Query: 90  DFKTGEICLDILTREHWSPVWDLVHVIHAIWILLGEPVPESPLNVDIA 137
           D + G ICLD+L + +WSP   +  V+ +I  LL  P P  PL  D+A
Sbjct: 71  D-RLGRICLDVL-KTNWSPALQIRTVLLSIQALLASPNPNDPLANDVA 116

>NDAI0J01540 Chr10 complement(362018..362452,362599..362628) [465
           bp, 154 aa] {ON} Anc_8.230
          Length = 154

 Score = 77.0 bits (188), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 42/108 (38%), Positives = 64/108 (59%), Gaps = 7/108 (6%)

Query: 30  EPKDTGNMYHWIADISGPPETPYASAVFALDVELPIQYPLEPPRVKFLPGSRNNICHCNV 89
           EP D  N+ ++   + GP ++PY + +F L++ LP  YP+E P+V+FL      I H N+
Sbjct: 26  EPHD-DNLRYFNVTVEGPTQSPYENGIFKLELYLPDDYPMEAPKVRFL----TKIYHPNI 80

Query: 90  DFKTGEICLDILTREHWSPVWDLVHVIHAIWILLGEPVPESPLNVDIA 137
           D + G ICLD+L + +WSP   +  V+ +I  LL  P P  PL  D+A
Sbjct: 81  D-RLGRICLDVL-KTNWSPALQIRTVLLSIQALLASPNPNDPLANDVA 126

>Kwal_34.16174 s34 (229678..230319) [642 bp, 213 aa] {ON} YEL012W
           (UBC8) - ubiquitin-conjugating enzyme; ubiquitin-protein
           ligase [contig 267] FULL
          Length = 213

 Score = 78.2 bits (191), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 48/124 (38%), Positives = 68/124 (54%), Gaps = 11/124 (8%)

Query: 36  NMYHWIADISGPPETPYASAVFALDVELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGE 95
           NM  +     GP ETPY   V+ L VELP  YP + P + F+    N I H N+D  +G 
Sbjct: 16  NMQEFHVKFHGPRETPYEGGVWRLHVELPDNYPYKSPSIGFV----NKIFHPNIDAASGS 71

Query: 96  ICLDILTREHWSPVWDLVHVIHAIWI---LLGEPVPESPLNVDIANVLKAGDLEAYEGLI 152
           ICLD++    WSP++DL++++   W+   LL EP    PLN + A  L+    E YE  I
Sbjct: 72  ICLDVINS-AWSPLYDLLNILE--WMIPGLLKEPNGSDPLNNEAA-TLQLKSKELYERKI 127

Query: 153 KYYI 156
           + +I
Sbjct: 128 REFI 131

>CAGL0G08063g Chr7 (761662..762111) [450 bp, 149 aa] {ON} highly
           similar to uniprot|P52490 Saccharomyces cerevisiae
           YDR092w UBC13 E2 ubiquitin-conjugating enzyme
          Length = 149

 Score = 76.3 bits (186), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 40/102 (39%), Positives = 60/102 (58%), Gaps = 6/102 (5%)

Query: 36  NMYHWIADISGPPETPYASAVFALDVELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGE 95
           N+ ++   I GP ++PY   +F L++ LP  YP+E P+V+FL      I H N+D + G 
Sbjct: 31  NLRYFDVTIEGPSQSPYEKGIFKLELYLPEDYPMEAPKVRFL----TKIYHPNID-RLGR 85

Query: 96  ICLDILTREHWSPVWDLVHVIHAIWILLGEPVPESPLNVDIA 137
           ICLD+L + +WSP   +  V+ +I  LL  P P  PL  D+A
Sbjct: 86  ICLDVL-KTNWSPALQIRTVLLSIQALLASPNPNDPLANDVA 126

>Ecym_5563 Chr5 (1146448..1146477,1146598..1147062) [495 bp, 164 aa]
           {ON} similar to Ashbya gossypii AGR121C
          Length = 164

 Score = 76.6 bits (187), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 62/102 (60%), Gaps = 6/102 (5%)

Query: 36  NMYHWIADISGPPETPYASAVFALDVELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGE 95
           N+ ++   I GP ++ Y + VF L++ LP +YP+EPP+V+FL      I H N+D + G 
Sbjct: 31  NLRYFDVSIEGPQQSAYENGVFRLELFLPDEYPMEPPKVRFL----TKIYHPNID-RLGR 85

Query: 96  ICLDILTREHWSPVWDLVHVIHAIWILLGEPVPESPLNVDIA 137
           ICLD+L + +WSP   +  V+ +I  LL  P P  PL  D+A
Sbjct: 86  ICLDVL-KTNWSPALQIRTVLLSIQALLATPNPNDPLANDVA 126

>SAKL0D10560g Chr4 complement(885746..886369) [624 bp, 207 aa] {ON}
           highly similar to gnl|GLV|KLLA0A11198g Kluyveromyces
           lactis KLLA0A11198g and similar to YEL012W
           uniprot|P28263 Saccharomyces cerevisiae YEL012W UBC8
           Ubiquitin- conjugating enzyme that negatively regulates
           gluconeogenesis by mediating the glucose-induced
           ubiquitination of fructose-1 6-bisphosphatase (FBPase)
           cytoplasmic enzyme that catalyzes the ubiquitination of
           histones in vitro
          Length = 207

 Score = 77.4 bits (189), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 47/124 (37%), Positives = 69/124 (55%), Gaps = 11/124 (8%)

Query: 36  NMYHWIADISGPPETPYASAVFALDVELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGE 95
           +M  +     GP +TPY   V+ L VELP  YP + P + F+    N I H N+D  +G 
Sbjct: 16  SMQEFHVKFHGPKDTPYEKGVWRLHVELPDNYPYKSPSIGFV----NKIFHPNIDAASGS 71

Query: 96  ICLDILTREHWSPVWDLVHVIHAIWI---LLGEPVPESPLNVDIANVLKAGDLEAYEGLI 152
           ICLD++    WSP++DL++++   W+   LL EP    PLN + A  L+  + E YE  I
Sbjct: 72  ICLDVINS-TWSPLYDLINIVE--WMIPGLLKEPNGSDPLNNEAA-TLQLKNKELYEEKI 127

Query: 153 KYYI 156
           + YI
Sbjct: 128 QEYI 131

>KLLA0A11198g Chr1 complement(973755..974358,974525..974529) [609
           bp, 202 aa] {ON} similar to uniprot|P28263 Saccharomyces
           cerevisiae YEL012W UBC8 Ubiquitin-conjugating enzyme
           that negatively regulates gluconeogenesis by mediating
           the glucose-induced ubiquitination of
           fructose-1,6-bisphosphatase (FBPase); cytoplasmic enzyme
           that catalyzes the ubiquitination of histones in vitro
          Length = 202

 Score = 77.4 bits (189), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 46/115 (40%), Positives = 65/115 (56%), Gaps = 11/115 (9%)

Query: 46  GPPETPYASAVFALDVELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTREH 105
           GP +TPY   V+ L VELP  YP + P + F+    N I H N+D  +G ICLD++    
Sbjct: 39  GPKDTPYEKGVWRLHVELPDNYPYKSPSIGFV----NKIFHPNIDAASGSICLDVINST- 93

Query: 106 WSPVWDLVHVIHAIWI---LLGEPVPESPLNVDIANVLKAGDLEAYEGLIKYYIG 157
           WSP++DL++++   W+   LL EP    PLN + A  L+  D + YE  I  YI 
Sbjct: 94  WSPLYDLLNIVE--WMIPGLLKEPNGSDPLNNEAA-TLQLKDKDMYEQKIHEYIN 145

>Kwal_56.23482 s56 complement(559955..560404) [450 bp, 149 aa] {ON}
           YDR092W (UBC13) - ubiquitin-conjugating enzyme [contig
           176] FULL
          Length = 149

 Score = 75.9 bits (185), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 40/102 (39%), Positives = 61/102 (59%), Gaps = 6/102 (5%)

Query: 36  NMYHWIADISGPPETPYASAVFALDVELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGE 95
           N+ ++   I GP ++PY + VF L++ LP  YP+E P+V+FL      I H N+D + G 
Sbjct: 31  NLRYFQVTIEGPQQSPYENGVFKLELFLPDDYPMEAPKVRFL----TKIYHPNID-RLGR 85

Query: 96  ICLDILTREHWSPVWDLVHVIHAIWILLGEPVPESPLNVDIA 137
           ICLD+L + +WSP   +  V+ ++  LL  P P  PL  D+A
Sbjct: 86  ICLDVL-KTNWSPALQIRTVLLSVQALLASPNPNDPLANDVA 126

>TDEL0B06570 Chr2 (1164122..1164619) [498 bp, 165 aa] {ON} Anc_2.569
           YMR022W
          Length = 165

 Score = 76.3 bits (186), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 52/165 (31%), Positives = 80/165 (48%), Gaps = 24/165 (14%)

Query: 4   QRITKEFKSVRKTLAEDPSYNHILKLEPKDTGNMYHWIADISGPPETPYASAVFALDVEL 63
           +R+ KE++     L  DP    +    PK   N++ W   I GPP+TPY   +F   ++ 
Sbjct: 7   RRLLKEYQQ----LIRDPPPGILAA--PKSESNLFLWDCLIQGPPDTPYEGGIFNARLDF 60

Query: 64  PIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDI------------LTREHWSPVWD 111
           P  YPL PP++ F P    +I H N+ +  GE+C+ I            L  E WSPV  
Sbjct: 61  PKDYPLSPPKLTFTP----SILHPNI-YHNGEVCISILHSPGDDPNMYELAEERWSPVQS 115

Query: 112 LVHVIHAIWILLGEPVPESPLNVDIANVLKAGDLEAYEGLIKYYI 156
           +  ++ ++  +L EP  ES  NVD A +L   +   +E  +K  I
Sbjct: 116 VEKILLSVMSMLSEPNIESGANVD-ACILWRDNRPEFERRVKTAI 159

>KLLA0C17622g Chr3 (1555873..1555902,1556004..1556453) [480 bp, 159
           aa] {ON} highly similar to uniprot|P52490 Saccharomyces
           cerevisiae YDR092W UBC13 Ubiquitin-conjugating enzyme
           involved in the error-free DNA postreplication repair
           pathway interacts with Mms2p to assemble ubiquitin
           chains at the Ub Lys-63 residue DNA damage triggers
           redistribution from the cytoplasm to the nucleus ,
          Length = 159

 Score = 76.3 bits (186), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 40/102 (39%), Positives = 61/102 (59%), Gaps = 6/102 (5%)

Query: 36  NMYHWIADISGPPETPYASAVFALDVELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGE 95
           N+ ++   I GP ++PY + VF L++ LP  YP+E P+V+FL      I H N+D + G 
Sbjct: 31  NLRYFQVTIEGPQQSPYENGVFQLELFLPDDYPMEAPKVRFL----TKIYHPNID-RLGR 85

Query: 96  ICLDILTREHWSPVWDLVHVIHAIWILLGEPVPESPLNVDIA 137
           ICLD+L + +WSP   +  V+ ++  LL  P P  PL  D+A
Sbjct: 86  ICLDVL-KNNWSPALQIRTVLLSVQALLASPNPNDPLANDVA 126

>KAFR0A02160 Chr1 (452814..453311) [498 bp, 165 aa] {ON} Anc_2.569
           YMR022W
          Length = 165

 Score = 76.3 bits (186), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 44/138 (31%), Positives = 70/138 (50%), Gaps = 18/138 (13%)

Query: 31  PKDTGNMYHWIADISGPPETPYASAVFALDVELPIQYPLEPPRVKFLPGSRNNICHCNVD 90
           PK   N++ W   + GPP++PY   VF   ++ P  YPL PP++ F P    +I H N+ 
Sbjct: 28  PKTEDNIFQWDCLVQGPPDSPYEGGVFNAQLDFPKDYPLSPPKLTFTP----SILHPNI- 82

Query: 91  FKTGEICLDI------------LTREHWSPVWDLVHVIHAIWILLGEPVPESPLNVDIAN 138
           +  GE+C+ I            L  E WSPV  +  ++ ++  +L EP  ES  N+D A 
Sbjct: 83  YPNGEVCISILHSPGEDPNMYELAEERWSPVQSVEKILLSVMSMLSEPNIESGANID-AC 141

Query: 139 VLKAGDLEAYEGLIKYYI 156
           +L   + + +E  +K  I
Sbjct: 142 ILWRDNRKEFERQVKLNI 159

>KLTH0H13816g Chr8 complement(1208214..1208910,1209008..1209012)
           [702 bp, 233 aa] {ON} highly similar to uniprot|P28263
           Saccharomyces cerevisiae YEL012W UBC8
           Ubiquitin-conjugating enzyme that negatively regulates
           gluconeogenesis by mediating the glucose-induced
           ubiquitination of fructose-1 6- bisphosphatase (FBPase)
           cytoplasmic enzyme that catalyzes the ubiquitination of
           histones in vitro
          Length = 233

 Score = 77.4 bits (189), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 47/124 (37%), Positives = 69/124 (55%), Gaps = 11/124 (8%)

Query: 36  NMYHWIADISGPPETPYASAVFALDVELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGE 95
           NM  +     GP  TPY + V+ L VELP  YP + P + F+    N I H N+D  +G 
Sbjct: 28  NMQEFHIKFHGPQGTPYEAGVWRLHVELPDNYPYKSPSIGFV----NKIFHPNIDAASGS 83

Query: 96  ICLDILTREHWSPVWDLVHVIHAIWI---LLGEPVPESPLNVDIANVLKAGDLEAYEGLI 152
           ICLD++    WSP++DL++++   W+   LL EP    PLN + A  L+  + E YE  I
Sbjct: 84  ICLDVINST-WSPLYDLINIVE--WMIPGLLKEPNGSDPLNNEAA-TLQLKNKELYEQKI 139

Query: 153 KYYI 156
           + +I
Sbjct: 140 REFI 143

>SAKL0D13552g Chr4 (1123716..1124213) [498 bp, 165 aa] {ON} highly
           similar to uniprot|Q02159 Saccharomyces cerevisiae
           YMR022W QRI8 Ubiquitin conjugating enzyme involved in
           the ER-associated protein degradation pathway requires
           Cue1p for recruitment to the ER membrane proposed to be
           involved in chromatin assembly
          Length = 165

 Score = 76.3 bits (186), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 46/144 (31%), Positives = 71/144 (49%), Gaps = 23/144 (15%)

Query: 4   QRITKEFKSVRKTLAEDPSYNHILKLEPKDTGNMYHWIADISGPPETPYASAVFALDVEL 63
           +R+ KE + + +   E       +   PK   N++ W   I+GPP++PY   VF   +E 
Sbjct: 7   KRLLKELQQLARDSPEG------IVAGPKSEDNLFLWDCLITGPPDSPYEGGVFNAMLEF 60

Query: 64  PIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDI------------LTREHWSPVWD 111
           P  YPL PPR+ F P    +I H N+ +  GE+C+ I            L  E WSPV  
Sbjct: 61  PKDYPLSPPRLTFTP----SILHPNI-YPNGEVCISILHSPGEDPNMYELAEERWSPVQS 115

Query: 112 LVHVIHAIWILLGEPVPESPLNVD 135
           +  ++ ++  +L EP  ES  N+D
Sbjct: 116 VEKILLSVTSMLSEPNVESGANID 139

>NDAI0E03870 Chr5 complement(850773..851267) [495 bp, 164 aa] {ON}
           Anc_7.54
          Length = 164

 Score = 75.9 bits (185), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 46/119 (38%), Positives = 67/119 (56%), Gaps = 7/119 (5%)

Query: 31  PKDTGNMYHWIADISGPPETPYASAVFALDVELPIQYPLEPPRVKFLPGSRNNICHCNVD 90
           P D  ++ HW A I+GP +TPY    F L  +    YP  PP VKF+    + + H NVD
Sbjct: 40  PNDEEDLTHWSAIITGPKDTPYDGLRFKLSFQFSDSYPYAPPLVKFI----SPMWHPNVD 95

Query: 91  FKTGEICLDILTREHWSPVWDLVHVIHAIWILLGEPVPESPLNVDIANVLKAGDLEAYE 149
             +G ICLDIL ++ WS V+++  ++ ++  LL EP   SPLN  +A  L   D+  Y+
Sbjct: 96  M-SGNICLDIL-KDQWSAVYNVETILLSLQALLEEPNNSSPLNA-VAAELWDDDMNEYK 151

>NCAS0G03130 Chr7 (575808..576503) [696 bp, 231 aa] {ON} 
          Length = 231

 Score = 77.4 bits (189), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 47/126 (37%), Positives = 69/126 (54%), Gaps = 11/126 (8%)

Query: 34  TGNMYHWIADISGPPETPYASAVFALDVELPIQYPLEPPRVKFLPGSRNNICHCNVDFKT 93
             +M  +     GP +TPY   V+ L VELP  YP + P + F+    N I H N+D  +
Sbjct: 49  NNSMQEFHIKFHGPKDTPYEKGVWRLHVELPDNYPYKSPSIGFV----NKIFHPNIDIAS 104

Query: 94  GEICLDILTREHWSPVWDLVHVIHAIWI---LLGEPVPESPLNVDIANVLKAGDLEAYEG 150
           G ICLD++    WSP++DL++++   W+   LL EP    PLN + A  L+  D + YE 
Sbjct: 105 GSICLDVINST-WSPLYDLLNIVE--WMIPGLLKEPNGSDPLNNEAA-TLELRDKKLYEE 160

Query: 151 LIKYYI 156
            I+ YI
Sbjct: 161 KIREYI 166

>NCAS0A12740 Chr1 (2515651..2516148) [498 bp, 165 aa] {ON} Anc_2.569
          Length = 165

 Score = 75.5 bits (184), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 43/138 (31%), Positives = 70/138 (50%), Gaps = 18/138 (13%)

Query: 31  PKDTGNMYHWIADISGPPETPYASAVFALDVELPIQYPLEPPRVKFLPGSRNNICHCNVD 90
           PK+  N++ W   + GPP+T Y   +F   +E P  YPL PP++ F P    +I H N+ 
Sbjct: 28  PKNENNLFIWDCLVQGPPDTAYEGGIFNARLEFPKDYPLSPPKLTFTP----SILHPNI- 82

Query: 91  FKTGEICLDI------------LTREHWSPVWDLVHVIHAIWILLGEPVPESPLNVDIAN 138
           +  GE+C+ I            L  E WSPV  +  ++ ++  +L EP  ES  N+D A 
Sbjct: 83  YPNGEVCISILHSPGDDPNMYELAEERWSPVQSIEKILLSVMSMLSEPNIESGANID-AC 141

Query: 139 VLKAGDLEAYEGLIKYYI 156
           +L   + E +E  ++  +
Sbjct: 142 ILWRDNREEFERQVRQSV 159

>KAFR0H01230 Chr8 (229718..230050) [333 bp, 110 aa] {ON} Anc_3.301
           YDR054C
          Length = 110

 Score = 73.9 bits (180), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 42/108 (38%), Positives = 60/108 (55%), Gaps = 7/108 (6%)

Query: 46  GPPETPYASAVFALDVELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTREH 105
           GPP++PYA  VF L +  P  YP +PP++ F       I H N++   G ICLDIL ++ 
Sbjct: 2   GPPDSPYAGGVFFLSIHFPTDYPFKPPKISF----TTKIYHPNIN-ANGNICLDIL-KDQ 55

Query: 106 WSPVWDLVHVIHAIWILLGEPVPESPLNVDIANVLKAGDLEAYEGLIK 153
           WSP   L  V+ +I  LL +  P+ PL  +IA++ K  D   YE   +
Sbjct: 56  WSPALTLSKVLLSICSLLTDANPDDPLVPEIAHIYKT-DRPKYEATAR 102

>Ecym_4578 Chr4 complement(1130475..1130972) [498 bp, 165 aa] {ON}
           similar to Ashbya gossypii ABR059W
          Length = 165

 Score = 75.1 bits (183), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 45/144 (31%), Positives = 71/144 (49%), Gaps = 23/144 (15%)

Query: 4   QRITKEFKSVRKTLAEDPSYNHILKLEPKDTGNMYHWIADISGPPETPYASAVFALDVEL 63
           +R+ KE + + K   E       +   P +  NM+ W   I+GPP++PY   +F   ++ 
Sbjct: 7   KRLMKEMQQLLKDCPEG------IVAGPVNEENMFLWDCLIAGPPDSPYEGGIFNARLQF 60

Query: 64  PIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDIL------------TREHWSPVWD 111
           P  YPL PP++ F P    +I H NV +  GE+C+ IL              E WSPV  
Sbjct: 61  PTDYPLSPPKLTFTP----SILHPNV-YPNGEVCISILHAPGEDPNMYEEASERWSPVQS 115

Query: 112 LVHVIHAIWILLGEPVPESPLNVD 135
           +  ++ ++  +L EP  ES  N+D
Sbjct: 116 VEKILLSVMSMLSEPNVESGANID 139

>ZYRO0E06358g Chr5 (484003..484500) [498 bp, 165 aa] {ON} highly
           similar to uniprot|Q02159 Saccharomyces cerevisiae
           YMR022W QRI8 Ubiquitin conjugating enzyme involved in
           the ER-associated protein degradation pathway requires
           Cue1p for recruitment to the ER membrane proposed to be
           involved in chromatin assembly
          Length = 165

 Score = 75.1 bits (183), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 51/165 (30%), Positives = 80/165 (48%), Gaps = 24/165 (14%)

Query: 4   QRITKEFKSVRKTLAEDPSYNHILKLEPKDTGNMYHWIADISGPPETPYASAVFALDVEL 63
           +R+ KE + + K    D S   +    P+   +++ W   I GPP+TPY   +F   +E 
Sbjct: 7   KRLLKELQQLMK----DSSTGIVAG--PRSENDLFVWDCLIQGPPDTPYEGGIFNAKLEF 60

Query: 64  PIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDI------------LTREHWSPVWD 111
           P  YPL PP++ F P    +I H N+ +  GE+C+ I            L  E WSPV  
Sbjct: 61  PKDYPLSPPKLTFTP----SILHPNI-YHNGEVCISILHSPGDDPNMYELAEERWSPVQS 115

Query: 112 LVHVIHAIWILLGEPVPESPLNVDIANVLKAGDLEAYEGLIKYYI 156
           +  ++ ++  +L EP  ES  NVD A +L   +   +E  +K  I
Sbjct: 116 VEKILLSVMSMLSEPNVESGANVD-ACILWRDNRPEFELQVKRSI 159

>TPHA0B03410 Chr2 complement(793271..793729) [459 bp, 152 aa] {ON}
           Anc_8.230 YDR092W
          Length = 152

 Score = 74.7 bits (182), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 50/134 (37%), Positives = 72/134 (53%), Gaps = 13/134 (9%)

Query: 4   QRITKEFKSVRKTLAEDPSYNHILKLEPKDTGNMYHWIADISGPPETPYASAVFALDVEL 63
           +RI KE +     L  DP     +  EP D  N+ ++   I GP  +PY   +F L++ L
Sbjct: 6   KRIIKETER----LVSDPVPG--ITAEPHD-DNLRYFSVTIEGPEGSPYEHGIFDLELFL 58

Query: 64  PIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTREHWSPVWDLVHVIHAIWILL 123
           P  YP+E P+V+FL      I H N+D + G ICLD+L + +WSP   +  V+ +I  LL
Sbjct: 59  PDDYPMESPKVRFL----TKIYHPNID-RLGRICLDVL-KTNWSPALQIRTVLLSIQALL 112

Query: 124 GEPVPESPLNVDIA 137
             P P  PL  D+A
Sbjct: 113 ASPNPNDPLANDVA 126

>TBLA0H02610 Chr8 complement(617205..617702) [498 bp, 165 aa] {ON}
           Anc_2.569 YMR022W
          Length = 165

 Score = 74.7 bits (182), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 47/144 (32%), Positives = 71/144 (49%), Gaps = 23/144 (15%)

Query: 4   QRITKEFKSVRKTLAEDPSYNHILKLEPKDTGNMYHWIADISGPPETPYASAVFALDVEL 63
           +R+ KE +     L  DP    I    PK   +++ W   ++GPP+TPYA  +F   ++ 
Sbjct: 7   KRLLKELQQ----LTRDPPPGIIAA--PKTESDLFTWDCLVAGPPDTPYAGGLFNCQLQF 60

Query: 64  PIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDI------------LTREHWSPVWD 111
           P  YPL PP + F P    +I H NV +  GE+C+ I            L  E WSPV  
Sbjct: 61  PTDYPLSPPTLTFTP----SILHPNV-YPNGEVCISILHAPGSDPNMYELPEERWSPVQS 115

Query: 112 LVHVIHAIWILLGEPVPESPLNVD 135
           +  ++ ++  +L EP  ES  N+D
Sbjct: 116 VEKILLSVVSMLSEPNVESGANID 139

>KNAG0H02980 Chr8 (551453..551482,551689..552117) [459 bp, 152 aa]
           {ON} Anc_8.230 YDR092W
          Length = 152

 Score = 74.3 bits (181), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 42/108 (38%), Positives = 63/108 (58%), Gaps = 7/108 (6%)

Query: 30  EPKDTGNMYHWIADISGPPETPYASAVFALDVELPIQYPLEPPRVKFLPGSRNNICHCNV 89
           EP D  N+ ++   + GP  +PY + +F L++ LP  YP+E P+V+FL      I H N+
Sbjct: 26  EPHD-DNLRYFEVTVEGPVGSPYENGIFQLELYLPDDYPMEAPKVRFL----TKIYHPNI 80

Query: 90  DFKTGEICLDILTREHWSPVWDLVHVIHAIWILLGEPVPESPLNVDIA 137
           D + G ICLD+L + +WSP   +  V+ +I  LL  P P  PL  D+A
Sbjct: 81  D-RLGRICLDVL-KTNWSPALQIRTVLLSIQALLASPNPNDPLANDVA 126

>AEL045W Chr5 (549376..549380,549444..550074) [636 bp, 211 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YEL012W
           (UBC8); 1-intron
          Length = 211

 Score = 75.5 bits (184), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 47/124 (37%), Positives = 68/124 (54%), Gaps = 11/124 (8%)

Query: 36  NMYHWIADISGPPETPYASAVFALDVELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGE 95
           NM  +     GP  TPY   V+ L VELP  YP + P + F+    N I H N+D  +G 
Sbjct: 28  NMQEFHVKFHGPKGTPYERGVWRLHVELPDNYPYKSPSIGFV----NKIFHPNIDAASGS 83

Query: 96  ICLDILTREHWSPVWDLVHVIHAIWI---LLGEPVPESPLNVDIANVLKAGDLEAYEGLI 152
           ICLD++    WSP++DL++++   W+   LL EP    PLN + A  L+  + + YE  I
Sbjct: 84  ICLDVINST-WSPLYDLLNIVE--WMIPGLLKEPNGSDPLNNEAA-TLQLKNPQMYEEKI 139

Query: 153 KYYI 156
           + YI
Sbjct: 140 QEYI 143

>TBLA0F03790 Chr6 (936410..936865) [456 bp, 151 aa] {ON} Anc_4.49
           YLR306W
          Length = 151

 Score = 73.9 bits (180), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 40/102 (39%), Positives = 60/102 (58%), Gaps = 6/102 (5%)

Query: 36  NMYHWIADISGPPETPYASAVFALDVELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGE 95
           N+ ++   I GP ++ Y + VF L++ LP  YP+E P+V+FL      I H N+D + G 
Sbjct: 31  NLRYFSVTIEGPKDSAYENGVFELELFLPDDYPMEAPKVRFL----TKIYHPNID-RLGR 85

Query: 96  ICLDILTREHWSPVWDLVHVIHAIWILLGEPVPESPLNVDIA 137
           ICLD+L + +WSP   +  V+ +I  LL  P P  PL  D+A
Sbjct: 86  ICLDVL-KNNWSPALQIRTVLLSIQALLASPNPNDPLANDVA 126

>NCAS0B04010 Chr2 complement(724414..724845,724986..725015) [462 bp,
           153 aa] {ON} Anc_8.230
          Length = 153

 Score = 73.9 bits (180), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 60/102 (58%), Gaps = 6/102 (5%)

Query: 36  NMYHWIADISGPPETPYASAVFALDVELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGE 95
           N+ ++   + GP  +PY + +F L++ LP  YP+E P+V+FL      I H N+D + G 
Sbjct: 31  NLRYFNVTVEGPAGSPYENGIFQLELYLPDDYPMEAPKVRFL----TKIYHPNID-RLGR 85

Query: 96  ICLDILTREHWSPVWDLVHVIHAIWILLGEPVPESPLNVDIA 137
           ICLD+L + +WSP   +  V+ ++  LL  P P  PL  D+A
Sbjct: 86  ICLDVL-KTNWSPALQIRTVLLSVQALLASPNPNDPLANDVA 126

>KNAG0M02150 Chr13 (400133..400645) [513 bp, 170 aa] {ON} Anc_2.569
           YMR022W
          Length = 170

 Score = 73.9 bits (180), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 49/165 (29%), Positives = 80/165 (48%), Gaps = 24/165 (14%)

Query: 4   QRITKEFKSVRKTLAEDPSYNHILKLEPKDTGNMYHWIADISGPPETPYASAVFALDVEL 63
           +R+ KE +     L  DP    +    P+D  +++ W   + GPP++PY   VF   +  
Sbjct: 7   RRLLKELQQ----LMRDPPPGIVAG--PQDESDLFLWDCLVQGPPDSPYEGGVFEAQLRF 60

Query: 64  PIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDI------------LTREHWSPVWD 111
           P  YPL PP++ F+P    ++ H NV +  GE+C+ I            L  E WSPV  
Sbjct: 61  PRDYPLSPPKLTFVP----SVLHPNV-YPNGEVCISILHAPGEDPNQYELAEERWSPVQS 115

Query: 112 LVHVIHAIWILLGEPVPESPLNVDIANVLKAGDLEAYEGLIKYYI 156
           +  ++ ++  +L EP  ES  N+D A VL   +   +E  +K  +
Sbjct: 116 VEKILLSVVSMLSEPNVESGANID-ACVLWRDNRPEFERQVKRNV 159

>Ecym_1348 Chr1 complement(720137..720767,720872..720876) [636 bp,
           211 aa] {ON} similar to Ashbya gossypii AEL045W
           1-intron
          Length = 211

 Score = 75.1 bits (183), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 47/124 (37%), Positives = 68/124 (54%), Gaps = 11/124 (8%)

Query: 36  NMYHWIADISGPPETPYASAVFALDVELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGE 95
           NM  +     GP  TPY   V+ L VELP  YP + P + F+    N I H N+D  +G 
Sbjct: 28  NMQEFHVKFLGPRGTPYERGVWRLHVELPDNYPYKSPSIGFV----NKIFHPNIDAASGS 83

Query: 96  ICLDILTREHWSPVWDLVHVIHAIWI---LLGEPVPESPLNVDIANVLKAGDLEAYEGLI 152
           ICLD++    WSP++DL++++   W+   LL EP    PLN + A  L+  + + YE  I
Sbjct: 84  ICLDVINST-WSPLYDLINIVE--WMIPGLLKEPNGSDPLNNEAA-TLQLKNPKMYEEKI 139

Query: 153 KYYI 156
           + YI
Sbjct: 140 QEYI 143

>NCAS0A05940 Chr1 (1171599..1172180) [582 bp, 193 aa] {ON} Anc_4.49
          Length = 193

 Score = 73.2 bits (178), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 50/155 (32%), Positives = 77/155 (49%), Gaps = 15/155 (9%)

Query: 7   TKEFKSVRKTLAED-------PSYNHILKLEPKDTGNMYHWIAD-ISGPPETPYASAVFA 58
           T++  + R  L  D       P+ +  + + P D  ++ + + D I  P E  Y +  F 
Sbjct: 29  TRQISAARIRLQRDIDDLELPPTVSLTICISPTDPSSLDNPLLDVIISPDEGYYKNGHFR 88

Query: 59  LDVELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTREHWSPVWDLVHVIHA 118
             +E    YP+EPP+V      RN I H N+D + G++CL+IL RE WSP  DL  +I  
Sbjct: 89  FSLEFNDNYPMEPPKV----VCRNRIYHPNIDVQ-GKVCLNIL-REDWSPALDLQSIIVG 142

Query: 119 IWILLGEPVPESPLNVDIANVLKAGDLEAYEGLIK 153
           +  L  EP  + PLN D A V  + D  A+   ++
Sbjct: 143 LLFLFLEPNAKDPLNTDAAAVF-SKDSNAFAKFVR 176

>TDEL0H03970 Chr8 complement(677619..678089) [471 bp, 156 aa] {ON}
           Anc_7.54 YOR339C
          Length = 156

 Score = 72.0 bits (175), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 44/119 (36%), Positives = 67/119 (56%), Gaps = 7/119 (5%)

Query: 31  PKDTGNMYHWIADISGPPETPYASAVFALDVELPIQYPLEPPRVKFLPGSRNNICHCNVD 90
           P    ++  W   I GP  TPY +  F L ++   QYP +PP+V F+    + + H NVD
Sbjct: 33  PASEDDLTQWFGVIVGPEGTPYENLKFRLSLKFTDQYPYQPPKVTFV----SPMWHPNVD 88

Query: 91  FKTGEICLDILTREHWSPVWDLVHVIHAIWILLGEPVPESPLNVDIANVLKAGDLEAYE 149
             +G ICLDIL ++ WS V+++  ++ ++  LL EP   SPLN  IA  L   D++ Y+
Sbjct: 89  M-SGNICLDIL-KDQWSAVYNVQTILLSLQALLEEPNNGSPLNA-IAAELWDTDMDEYK 144

>Kpol_1056.5 s1056 complement(8947..9444) [498 bp, 165 aa] {ON}
           complement(8947..9444) [498 nt, 166 aa]
          Length = 165

 Score = 71.2 bits (173), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 49/168 (29%), Positives = 77/168 (45%), Gaps = 21/168 (12%)

Query: 1   MSLQRITKEFKSVRKTLAEDPSYNHILKLEPKDTGNMYHWIADISGPPETPYASAVFALD 60
           MS     + FK  ++ + + P     +   P +  +++ W   I GPP+TPY   VF   
Sbjct: 1   MSKTAQKRLFKEYQQLIRDSPPG---IVAGPANENDLFLWDCLIQGPPDTPYEHGVFNAQ 57

Query: 61  VELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDI------------LTREHWSP 108
           +  P  YPL PP + F P     I H N+ +  GE+C+ I            L  E WSP
Sbjct: 58  LRFPRDYPLSPPTLTFTPA----ILHPNI-YPNGEVCISILHSPGDDPNMYELAEERWSP 112

Query: 109 VWDLVHVIHAIWILLGEPVPESPLNVDIANVLKAGDLEAYEGLIKYYI 156
           V  +  ++ ++  +L EP  ES  N+D A +L   +   +E  +K  I
Sbjct: 113 VQSVEKILLSVMSMLSEPNVESGANID-ACILWRDNRPEFERQVKRSI 159

>NDAI0B01520 Chr2 complement(356566..357063) [498 bp, 165 aa] {ON}
           Anc_2.569
          Length = 165

 Score = 71.2 bits (173), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 41/138 (29%), Positives = 69/138 (50%), Gaps = 18/138 (13%)

Query: 31  PKDTGNMYHWIADISGPPETPYASAVFALDVELPIQYPLEPPRVKFLPGSRNNICHCNVD 90
           P +  N++ W   + GPP+T Y   +F   ++ P  YPL PP++ F P    +I H N+ 
Sbjct: 28  PANENNLFVWDCLVQGPPDTAYEGGIFNARLDFPKDYPLSPPKLTFTP----SILHPNI- 82

Query: 91  FKTGEICLDI------------LTREHWSPVWDLVHVIHAIWILLGEPVPESPLNVDIAN 138
           +  GE+C+ I            L  E WSPV  +  ++ ++  +L EP  ES  N+D A 
Sbjct: 83  YPNGEVCISILHSPGDDPNMYELAEERWSPVQSVEKILLSVMSMLSEPNIESGANID-AC 141

Query: 139 VLKAGDLEAYEGLIKYYI 156
           +L   + + +E  +K  +
Sbjct: 142 ILWRDNRKEFERQVKLSV 159

>ZYRO0D04466g Chr4 complement(370627..371106) [480 bp, 159 aa] {ON}
           highly similar to uniprot|P52492 Saccharomyces
           cerevisiae YOR339C
          Length = 159

 Score = 70.9 bits (172), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 43/125 (34%), Positives = 66/125 (52%), Gaps = 6/125 (4%)

Query: 31  PKDTGNMYHWIADISGPPETPYASAVFALDVELPIQYPLEPPRVKFLPGSRNNICHCNVD 90
           P +  ++  W   I GP  TPY S  F + +  P  YP  PP+VKF+    + + H NVD
Sbjct: 36  PNNEDDLRDWSGMIVGPEGTPYESLKFKISLHFPDSYPYVPPKVKFI----SPMWHPNVD 91

Query: 91  FKTGEICLDILTREHWSPVWDLVHVIHAIWILLGEPVPESPLNVDIANVLKAGDLEAYEG 150
             +G ICLDIL ++ WS V+++  ++ ++  L  EP   SPLN   A +     +E  + 
Sbjct: 92  M-SGNICLDIL-KDQWSAVYNVQTILLSLQSLFEEPNNSSPLNAVAAELWDKDMVEYKKR 149

Query: 151 LIKYY 155
           L+  Y
Sbjct: 150 LLSRY 154

>KLLA0E07745g Chr5 complement(693694..694191) [498 bp, 165 aa] {ON}
           highly similar to uniprot|Q02159 Saccharomyces
           cerevisiae YMR022W QRI8 Ubiquitin conjugating enzyme
           involved in the ER-associated protein degradation
           pathway requires Cue1p for recruitment to the ER
           membrane proposed to be involved in chromatin assembly
          Length = 165

 Score = 69.7 bits (169), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 48/162 (29%), Positives = 77/162 (47%), Gaps = 24/162 (14%)

Query: 4   QRITKEFKSVRKTLAEDPSYNHILKLEPKDTGNMYHWIADISGPPETPYASAVFALDVEL 63
           +R+ KE + + K   E       +   P D  N++ W   I GPP++ Y   VF   ++ 
Sbjct: 7   KRLLKELEKLTKDSPEG------ILASPIDDSNLFQWDCLIMGPPDSCYEGGVFNARLDF 60

Query: 64  PIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTR------------EHWSPVWD 111
           P  YPL PP++ F P    +I H N+ +  GE+C+ IL              E WSPV  
Sbjct: 61  PKDYPLNPPKLTFQP----SILHPNI-YPNGEVCISILHSPGSDPNMYEHECERWSPVQS 115

Query: 112 LVHVIHAIWILLGEPVPESPLNVDIANVLKAGDLEAYEGLIK 153
           +  ++ ++  +L EP  ES  N+D A +L   +   +E  +K
Sbjct: 116 VEMILLSVMSILSEPNIESGANID-ACILWRDNRPEFERQVK 156

>TPHA0B00770 Chr2 (173656..174129) [474 bp, 157 aa] {ON} Anc_4.249
           YDL064W
          Length = 157

 Score = 68.9 bits (167), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 47/134 (35%), Positives = 67/134 (50%), Gaps = 12/134 (8%)

Query: 1   MSLQRITKEFKSVRKTLAEDPSYNHILKLEPKDTGNM--YHWIADISGPPETPYASAVFA 58
           + LQR+ +E K  RK    D  ++   K   K  G M   HW A I G   T +A AV+ 
Sbjct: 4   LCLQRLQEERKKWRK----DHPFSFFAKPLKKADGTMDLQHWEAGIPGKAGTLWADAVYP 59

Query: 59  LDVELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTREH-WSPVWDLVHVIH 117
           + +E P +YP +PP+VKF  G      H N+ + +G +CL IL  +  W P   L  ++ 
Sbjct: 60  ISIEYPDEYPSKPPKVKFPAG----FYHPNI-YPSGTVCLSILNEDQDWRPAITLKQIVL 114

Query: 118 AIWILLGEPVPESP 131
            +  LL  P P SP
Sbjct: 115 GVQDLLDSPNPNSP 128

>ABR059W Chr2 (503221..503718) [498 bp, 165 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR022W (QRI8)
          Length = 165

 Score = 68.6 bits (166), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 39/117 (33%), Positives = 58/117 (49%), Gaps = 17/117 (14%)

Query: 31  PKDTGNMYHWIADISGPPETPYASAVFALDVELPIQYPLEPPRVKFLPGSRNNICHCNVD 90
           P    N++ W   I GP ++PY   VF   ++ P  YPL PP++ F P    +I H NV 
Sbjct: 28  PVSEDNLFLWDCLIEGPADSPYEGGVFNARLQFPRDYPLSPPKLTFTP----SILHPNV- 82

Query: 91  FKTGEICLDIL------------TREHWSPVWDLVHVIHAIWILLGEPVPESPLNVD 135
           +  GE+C+ IL              E WSPV  +  ++ ++  +L EP  ES  N+D
Sbjct: 83  YPNGEVCISILHAPGEDPNMYEEASERWSPVQSVEKILLSVMSMLSEPNVESGANID 139

>TBLA0E01570 Chr5 complement(371348..371929,372031..372033) [585 bp,
           194 aa] {ON} 
          Length = 194

 Score = 68.6 bits (166), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 42/100 (42%), Positives = 51/100 (51%), Gaps = 6/100 (6%)

Query: 47  PPETPYASAVFALDVELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTREHW 106
           P E  Y    F   +     YP+EPP VKFL      I H N+D   G+ICL+IL RE W
Sbjct: 75  PDEGIYKDGYFPFSMVFKDSYPIEPPVVKFL----KKIYHPNIDL-NGKICLNIL-REDW 128

Query: 107 SPVWDLVHVIHAIWILLGEPVPESPLNVDIANVLKAGDLE 146
           SPV DL  +I  +  L  EP P  PLN+    +LK    E
Sbjct: 129 SPVLDLQSIIIGLMFLFLEPNPRDPLNLKAGELLKENKQE 168

>Smik_4.171 Chr4 (313921..313958,314069..314504) [474 bp, 157 aa]
           {ON} YDL064W (REAL)
          Length = 157

 Score = 67.0 bits (162), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 48/134 (35%), Positives = 65/134 (48%), Gaps = 12/134 (8%)

Query: 1   MSLQRITKEFKSVRKTLAEDPSYNHILKLEPKDTGNM--YHWIADISGPPETPYASAVFA 58
           + LQR+ +E K  RK    D  +    K   K  G+M    W A I G   T +A  V+ 
Sbjct: 4   LCLQRLQEERKKWRK----DHPFGFYAKPVKKSDGSMDLQKWEAGIPGKEGTNWAGGVYP 59

Query: 59  LDVELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTREH-WSPVWDLVHVIH 117
           + VE P +YP +PP+VKF  G      H NV + +G ICL IL  +  W P   L  ++ 
Sbjct: 60  ISVEYPNEYPSKPPKVKFPAG----FYHPNV-YPSGTICLSILNEDQDWRPAITLKQIVL 114

Query: 118 AIWILLGEPVPESP 131
            +  LL  P P SP
Sbjct: 115 GVQDLLDSPNPNSP 128

>Skud_4.191 Chr4 (332944..332981,333094..333529) [474 bp, 157 aa]
           {ON} YDL064W (REAL)
          Length = 157

 Score = 66.2 bits (160), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 48/134 (35%), Positives = 65/134 (48%), Gaps = 12/134 (8%)

Query: 1   MSLQRITKEFKSVRKTLAEDPSYNHILKLEPKDTGNM--YHWIADISGPPETPYASAVFA 58
           + LQR+ +E K  RK    D  +    K   K  G+M    W A I G   T +A  V+ 
Sbjct: 4   LCLQRLQEERKKWRK----DHPFGFYAKPVKKADGSMDLQKWEAGIPGKDATNWAGGVYP 59

Query: 59  LDVELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTREH-WSPVWDLVHVIH 117
           + VE P +YP +PP+VKF  G      H NV + +G ICL IL  +  W P   L  ++ 
Sbjct: 60  ITVEYPNEYPSKPPKVKFPAG----FYHPNV-YPSGTICLSILNEDQDWRPAITLKQIVL 114

Query: 118 AIWILLGEPVPESP 131
            +  LL  P P SP
Sbjct: 115 GVQDLLDSPNPNSP 128

>Smik_12.389 Chr12 (682460..683020) [561 bp, 187 aa] {ON} YLR306W
           (REAL)
          Length = 187

 Score = 67.0 bits (162), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 41/112 (36%), Positives = 54/112 (48%), Gaps = 6/112 (5%)

Query: 46  GPPETPYASAVFALDVELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTREH 105
            P E  Y        ++    YP+EPP+V  L      I H N+DFK G +CL+IL RE 
Sbjct: 68  NPDEGYYTHGSINFSLDFNEVYPIEPPKVACL----KRIFHPNIDFK-GNVCLNIL-RED 121

Query: 106 WSPVWDLVHVIHAIWILLGEPVPESPLNVDIANVLKAGDLEAYEGLIKYYIG 157
           WSP  DL  ++  +  L  EP P  PLN D A +L   + E  E +     G
Sbjct: 122 WSPALDLQSIVTGLLFLFLEPNPNDPLNKDAAKLLCQDEKEFAEAVRSTMSG 173

>YDL064W Chr4 (337487..337524,337635..338070) [474 bp, 157 aa] {ON} 
           UBC9SUMO-conjugating enzyme involved in the Smt3p
           conjugation pathway; nuclear protein required for S- and
           M-phase cyclin degradation and mitotic control; involved
           in proteolysis mediated by the anaphase-promoting
           complex cyclosome (APCC)
          Length = 157

 Score = 66.2 bits (160), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 48/134 (35%), Positives = 65/134 (48%), Gaps = 12/134 (8%)

Query: 1   MSLQRITKEFKSVRKTLAEDPSYNHILKLEPKDTGNM--YHWIADISGPPETPYASAVFA 58
           + LQR+ +E K  RK    D  +    K   K  G+M    W A I G   T +A  V+ 
Sbjct: 4   LCLQRLQEERKKWRK----DHPFGFYAKPVKKADGSMDLQKWEAGIPGKEGTNWAGGVYP 59

Query: 59  LDVELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTREH-WSPVWDLVHVIH 117
           + VE P +YP +PP+VKF  G      H NV + +G ICL IL  +  W P   L  ++ 
Sbjct: 60  ITVEYPNEYPSKPPKVKFPAG----FYHPNV-YPSGTICLSILNEDQDWRPAITLKQIVL 114

Query: 118 AIWILLGEPVPESP 131
            +  LL  P P SP
Sbjct: 115 GVQDLLDSPNPNSP 128

>YLR306W Chr12 (744151..744153,744288..744851) [567 bp, 188 aa] {ON}
            UBC12Enzyme that mediates the conjugation of Rub1p, a
           ubiquitin-like protein, to other proteins; related to E2
           ubiquitin-conjugating enzymes
          Length = 188

 Score = 66.6 bits (161), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 43/100 (43%), Positives = 53/100 (53%), Gaps = 8/100 (8%)

Query: 52  YASAVFALDVELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTREHWSPVWD 111
           Y S  F LD      YP+EPP+V  L      I H N+D K G +CL+IL RE WSP  D
Sbjct: 77  YGSINFNLDFNE--VYPIEPPKVVCL----KKIFHPNIDLK-GNVCLNIL-REDWSPALD 128

Query: 112 LVHVIHAIWILLGEPVPESPLNVDIANVLKAGDLEAYEGL 151
           L  +I  +  L  EP P  PLN D A +L  G+ E  E +
Sbjct: 129 LQSIITGLLFLFLEPNPNDPLNKDAAKLLCEGEKEFAEAV 168

>Suva_4.186 Chr4 (327039..327076,327179..327614) [474 bp, 157 aa]
           {ON} YDL064W (REAL)
          Length = 157

 Score = 65.9 bits (159), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 48/134 (35%), Positives = 65/134 (48%), Gaps = 12/134 (8%)

Query: 1   MSLQRITKEFKSVRKTLAEDPSYNHILKLEPKDTGNM--YHWIADISGPPETPYASAVFA 58
           + LQR+ +E K  RK    D  +    K   K  G+M    W A I G   T +A  V+ 
Sbjct: 4   LCLQRLQEERKKWRK----DHPFGFYAKPVKKADGSMDLQKWEAGIPGREGTNWAGGVYP 59

Query: 59  LDVELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTREH-WSPVWDLVHVIH 117
           + VE P +YP +PP+VKF  G      H NV + +G ICL IL  +  W P   L  ++ 
Sbjct: 60  ITVEYPNEYPSKPPKVKFPAG----FYHPNV-YPSGTICLSILNEDQDWRPAITLKQIVL 114

Query: 118 AIWILLGEPVPESP 131
            +  LL  P P SP
Sbjct: 115 GVQDLLDSPNPNSP 128

>NDAI0D04380 Chr4 (1027182..1027219,1027322..1027757) [474 bp, 157
           aa] {ON} Anc_4.249 YDL064W
          Length = 157

 Score = 64.7 bits (156), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 48/134 (35%), Positives = 63/134 (47%), Gaps = 12/134 (8%)

Query: 1   MSLQRITKEFKSVRKTLAEDPSYNHILKLEPKDTG--NMYHWIADISGPPETPYASAVFA 58
           + LQR+ +E K  RK    D  +    K   K  G  N+  W A I G   T +A  V+ 
Sbjct: 4   LCLQRLQEERKKWRK----DHPFGFFAKPTKKTDGTMNLQKWEAGIPGKEGTLWAEGVYP 59

Query: 59  LDVELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTREH-WSPVWDLVHVIH 117
           + +E P +YP +PP+VK   G      H NV + +G ICL IL  E  W P   L  +  
Sbjct: 60  ITIEYPNEYPSKPPKVKLPAG----FYHPNV-YPSGTICLSILNEEQDWRPAITLKQICL 114

Query: 118 AIWILLGEPVPESP 131
            I  LL  P P SP
Sbjct: 115 GIQDLLDSPNPNSP 128

>AER056C Chr5 complement(741224..741659,741718..741755) [474 bp, 157
           aa] {ON} Syntenic homolog of Saccharomyces cerevisiae
           YDL064W (UBC9); 1-intron
          Length = 157

 Score = 64.7 bits (156), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 49/155 (31%), Positives = 73/155 (47%), Gaps = 13/155 (8%)

Query: 1   MSLQRITKEFKSVRKTLAEDPSYNHILKLEPKDTG--NMYHWIADISGPPETPYASAVFA 58
           + LQR+ +E K  RK    D  +    K   K+ G  N+  W A I G   T +   V+ 
Sbjct: 4   LCLQRLQEERKKWRK----DHPFGFWAKPTKKEDGSMNLQKWEAGIPGREGTIWKDGVYP 59

Query: 59  LDVELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTREH-WSPVWDLVHVIH 117
           + +E P  YP +PPRVKF  G      H N+ + +G +CL IL  +  W P   +  ++ 
Sbjct: 60  ITIEYPDDYPSKPPRVKFPAG----FYHPNI-YPSGTVCLSILNEDQDWKPAITMKQILL 114

Query: 118 AIWILLGEPVPESPLNVDIANVLKAGDLEAYEGLI 152
            +  LL  P P SP   + A    A +L+ YE  +
Sbjct: 115 GVQDLLTSPNPNSPAQ-EPAWRAYAKNLQEYEKKV 148

>KLLA0E05039g Chr5 (443446..443919) [474 bp, 157 aa] {ON} highly
           similar to uniprot|P50623 Saccharomyces cerevisiae
           YDL064W UBC9 SUMO-conjugating enzyme involved in the
           Smt3p conjugation pathway nuclear protein required for
           S- and M-phase cyclin degradation and mitotic control
           involved in proteolysis mediated by the
           anaphase-promoting complex cyclosome (APCC)
          Length = 157

 Score = 64.3 bits (155), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 47/134 (35%), Positives = 64/134 (47%), Gaps = 12/134 (8%)

Query: 1   MSLQRITKEFKSVRKTLAEDPSYNHILKLEPKDTG--NMYHWIADISGPPETPYASAVFA 58
           + LQR+ +E K  RK    D  Y    K   K  G  N+  W A I G   T + + ++ 
Sbjct: 4   LCLQRLQEERKKWRK----DHPYGFFAKPTKKTDGSMNLQKWEAGIPGRDGTLWKNGLYP 59

Query: 59  LDVELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTREH-WSPVWDLVHVIH 117
           L +E P  YP +PP+VKF  G      H NV + +G ICL IL  +  W P   L  ++ 
Sbjct: 60  LTIEYPDDYPSKPPKVKFPAG----FYHPNV-YPSGTICLSILNEDQDWRPAITLKQLLL 114

Query: 118 AIWILLGEPVPESP 131
            +  LL  P P SP
Sbjct: 115 GVQDLLDSPNPNSP 128

>CAGL0D00814g Chr4 (98589..99062) [474 bp, 157 aa] {ON} highly
           similar to uniprot|P50623 Saccharomyces cerevisiae
           YDL064w UBC9 E2 ubiquitin-conjugating enzyme
          Length = 157

 Score = 64.3 bits (155), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 46/134 (34%), Positives = 64/134 (47%), Gaps = 12/134 (8%)

Query: 1   MSLQRITKEFKSVRKTLAEDPSYNHILK--LEPKDTGNMYHWIADISGPPETPYASAVFA 58
           + LQR+ +E K  RK    D  +    K    P  T N+  W A I G   T +   VF 
Sbjct: 4   LCLQRLQEERKKWRK----DHPFGFYAKPTKGPDGTLNLQKWEAGIPGKEGTIWQDGVFP 59

Query: 59  LDVELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTREH-WSPVWDLVHVIH 117
           + VE P +YP +PP+VKF  G      H N+ + +G +CL IL  +  W P   L  ++ 
Sbjct: 60  ITVEYPDEYPSKPPKVKFPAG----FYHPNI-YPSGTVCLSILNEDQDWRPAITLKQIVL 114

Query: 118 AIWILLGEPVPESP 131
            +  LL  P P SP
Sbjct: 115 GVQDLLDSPNPNSP 128

>Ecym_3270 Chr3 (511488..511525,511617..512052) [474 bp, 157 aa]
           {ON} similar to Ashbya gossypii AER056C
          Length = 157

 Score = 64.3 bits (155), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 48/155 (30%), Positives = 75/155 (48%), Gaps = 13/155 (8%)

Query: 1   MSLQRITKEFKSVRKTLAEDPSYNHILKLEPKDTG--NMYHWIADISGPPETPYASAVFA 58
           + LQR+ +E K  RK    D  +    K   K+ G  N+  W A I G   T +  AV+ 
Sbjct: 4   LCLQRLQEERKKWRK----DHPFGFWAKPTKKEDGSMNLQKWEAGIPGREGTIWKDAVYP 59

Query: 59  LDVELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTREH-WSPVWDLVHVIH 117
           + +E P  YP +PP+VKF  G      H N+ + +G +CL IL  +  W P   +  ++ 
Sbjct: 60  ITIEYPDDYPSKPPKVKFPAG----FYHPNI-YPSGTVCLSILNEDQDWKPAITMKQILL 114

Query: 118 AIWILLGEPVPESPLNVDIANVLKAGDLEAYEGLI 152
            +  LL  P P+SP   + A    A +++ YE  +
Sbjct: 115 GVQDLLTSPNPDSPAQ-EPAWRAYAKNVQEYEKKV 148

>KNAG0D04390 Chr4 complement(797747..798220) [474 bp, 157 aa] {ON}
           Anc_4.249 YDL064W
          Length = 157

 Score = 63.9 bits (154), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 48/134 (35%), Positives = 66/134 (49%), Gaps = 12/134 (8%)

Query: 1   MSLQRITKEFKSVRKTLAEDPSYNHILK--LEPKDTGNMYHWIADISGPPETPYASAVFA 58
           + LQR+ +E K  RK    D  +    K   +P  T ++  W A I G   T +A  ++ 
Sbjct: 4   LCLQRLQEERKKWRK----DHPFGFFAKPTRKPDGTMDLQRWEAGIPGKQGTLWADGLYP 59

Query: 59  LDVELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTREH-WSPVWDLVHVIH 117
           L +E P +YP +PP+VK LP    N  H NV + +G ICL IL  +  W P   L  +  
Sbjct: 60  LTIEYPDEYPSKPPKVK-LPA---NFYHPNV-YPSGTICLSILNEDQDWRPAITLKQICL 114

Query: 118 AIWILLGEPVPESP 131
            I  LL  P P SP
Sbjct: 115 GIQDLLDSPNPNSP 128

>SAKL0B10582g Chr2 complement(914784..915269) [486 bp, 161 aa] {ON}
           highly similar to uniprot|P52492 Saccharomyces
           cerevisiae YOR339C
          Length = 161

 Score = 63.9 bits (154), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 49/144 (34%), Positives = 76/144 (52%), Gaps = 9/144 (6%)

Query: 6   ITKEFKSVRKTLAEDPSYNHILKLEPKDTGNMYHWIADISGPPETPYASAVFALDVELPI 65
           +TK  +S    L   PS    L   P++  ++  W   I+GP  TPY    F + ++ P 
Sbjct: 15  VTKRLQSELVQLMMSPSPG--LSAFPENEDDLTKWSGIITGPDGTPYEGLRFKISLQFPQ 72

Query: 66  QYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTREHWSPVWDLVHVIHAIWILLGE 125
            YP   PRV F+    + + H NVD  +G ICLDIL ++ WS V+++  ++ ++  LL E
Sbjct: 73  SYPYTAPRVTFV----SPMWHPNVDM-SGNICLDIL-KDQWSAVYNVQTILLSLQSLLEE 126

Query: 126 PVPESPLNVDIANVLKAGDLEAYE 149
           P   SPLN  +A  L   ++E Y+
Sbjct: 127 PNNSSPLNA-VAAELWDKNMEEYK 149

>NCAS0A02490 Chr1 complement(474534..474969,475041..475078) [474 bp,
           157 aa] {ON} Anc_4.249 YDL064W
          Length = 157

 Score = 63.5 bits (153), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 48/134 (35%), Positives = 65/134 (48%), Gaps = 12/134 (8%)

Query: 1   MSLQRITKEFKSVRKTLAEDPSYNHILK--LEPKDTGNMYHWIADISGPPETPYASAVFA 58
           + LQR+ +E K  RK    D  +    K    P  + N+  W A I G   T +A  V+ 
Sbjct: 4   LCLQRLQEERKKWRK----DHPFGFFAKPTRHPDGSMNLQKWEAGIPGKEGTIWAEGVYP 59

Query: 59  LDVELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTREH-WSPVWDLVHVIH 117
           + +E P +YP +PP+VK LP    N  H NV + +G ICL IL  +  W P   L  +  
Sbjct: 60  ITIEYPNEYPSKPPKVK-LPA---NFYHPNV-YPSGTICLSILNEDQDWRPAITLKQICL 114

Query: 118 AIWILLGEPVPESP 131
            I  LL  P P SP
Sbjct: 115 GIQDLLDSPNPNSP 128

>Kpol_YGOB_414.2 s414 complement(6958..7536,7733..7735) [582 bp, 193
           aa] {ON} ANNOTATED BY YGOB -
          Length = 193

 Score = 63.5 bits (153), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 41/111 (36%), Positives = 57/111 (51%), Gaps = 11/111 (9%)

Query: 46  GPPETPYASAVFALDVELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTREH 105
            P E  Y S  F  D++    YP+EPP V  +    N I H N+D   G+ICL+IL RE 
Sbjct: 76  SPDEGYYKSGKFKFDLKFNENYPIEPPIVLCM----NKIFHPNIDL-DGKICLNIL-RED 129

Query: 106 WSPVWDLVHVIHAIWILLGEPVPESPLNVDIANVLKAGDLEAYEGLIKYYI 156
           WSP  DL  +I  +  L  E   + PLN + AN+L +      E + + Y+
Sbjct: 130 WSPALDLNSIIIGLLYLFLECNAKDPLNKEAANILHSD-----EDMFRKYV 175

>Kpol_414.2 s414 complement(6958..7536) [579 bp, 192 aa] {OFF}
           complement(6958..7536) [579 nt, 193 aa]
          Length = 192

 Score = 63.5 bits (153), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 41/111 (36%), Positives = 57/111 (51%), Gaps = 11/111 (9%)

Query: 46  GPPETPYASAVFALDVELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTREH 105
            P E  Y S  F  D++    YP+EPP V  +    N I H N+D   G+ICL+IL RE 
Sbjct: 75  SPDEGYYKSGKFKFDLKFNENYPIEPPIVLCM----NKIFHPNIDL-DGKICLNIL-RED 128

Query: 106 WSPVWDLVHVIHAIWILLGEPVPESPLNVDIANVLKAGDLEAYEGLIKYYI 156
           WSP  DL  +I  +  L  E   + PLN + AN+L +      E + + Y+
Sbjct: 129 WSPALDLNSIIIGLLYLFLECNAKDPLNKEAANILHSD-----EDMFRKYV 174

>TDEL0E05560 Chr5 complement(1024888..1025448,1025504..1025506) [564
           bp, 187 aa] {ON} Anc_4.49 YLR306W
          Length = 187

 Score = 63.5 bits (153), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 52/97 (53%), Gaps = 6/97 (6%)

Query: 44  ISGPPETPYASAVFALDVELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTR 103
           I  P E  Y    F  ++    +YP+EPP+V+ +    N I H N+D + G+ICL+IL R
Sbjct: 67  IVSPDEGFYRKGHFTFEMTFTEKYPIEPPQVRCM----NQIFHPNIDLQ-GKICLNIL-R 120

Query: 104 EHWSPVWDLVHVIHAIWILLGEPVPESPLNVDIANVL 140
           E WSP  DL  VI  I  L  E     PLN   A++L
Sbjct: 121 EDWSPALDLQSVIIGILFLFLEVSGRDPLNKQAASLL 157

>KAFR0G03240 Chr7 complement(673831..674304) [474 bp, 157 aa] {ON}
           Anc_4.249 YDL064W
          Length = 157

 Score = 62.8 bits (151), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 47/134 (35%), Positives = 62/134 (46%), Gaps = 12/134 (8%)

Query: 1   MSLQRITKEFKSVRKTLAEDPSYNHILKLEPKDTG--NMYHWIADISGPPETPYASAVFA 58
           + LQR+ +E K  RK    D  +    K   K  G  N+  W A I G   T +   V+ 
Sbjct: 4   LCLQRLQEERKKWRK----DHPFGFFAKPTKKQDGSLNLQRWEAGIPGKEGTLWHEGVYP 59

Query: 59  LDVELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTREH-WSPVWDLVHVIH 117
           L +E P +YP +PP+VK   G      H NV + +G ICL IL  +  W P   L  +  
Sbjct: 60  LTIEYPDEYPSKPPKVKLPAG----FYHPNV-YPSGTICLSILNEDQDWRPAITLKQICL 114

Query: 118 AIWILLGEPVPESP 131
            I  LL  P P SP
Sbjct: 115 GIQDLLDSPNPNSP 128

>KLTH0D14344g Chr4 complement(1178849..1179284,1179376..1179413)
           [474 bp, 157 aa] {ON} highly similar to uniprot|P50623
           Saccharomyces cerevisiae YDL064W UBC9 SUMO-conjugating
           enzyme involved in the Smt3p conjugation pathway nuclear
           protein required for S- and M-phase cyclin degradation
           and mitotic control involved in proteolysis mediated by
           the anaphase-promoting complex cyclosome (APCC)
          Length = 157

 Score = 62.8 bits (151), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 45/134 (33%), Positives = 62/134 (46%), Gaps = 12/134 (8%)

Query: 1   MSLQRITKEFKSVRKTLAEDPSYNHILKLEPKDTG--NMYHWIADISGPPETPYASAVFA 58
           + LQR+ +E K  RK    D  +    K   K  G  N+  W A I G   T +   VF 
Sbjct: 4   LCLQRLQEERKKWRK----DHPFGFFAKPTKKPDGSMNLQKWEAGIPGKEGTIWKDGVFP 59

Query: 59  LDVELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTREH-WSPVWDLVHVIH 117
           + +E P  YP +PP+VKF  G      H N+ + +G +CL IL  +  W P   L  +  
Sbjct: 60  ITIEYPDDYPSKPPKVKFPAG----FYHPNI-YPSGTVCLSILNEDQDWRPAITLKQIAL 114

Query: 118 AIWILLGEPVPESP 131
            +  LL  P P SP
Sbjct: 115 GVQDLLDSPNPNSP 128

>SAKL0H03058g Chr8 (288751..288788,288851..289286) [474 bp, 157 aa]
           {ON} highly similar to uniprot|P50623 Saccharomyces
           cerevisiae YDL064W UBC9 SUMO-conjugating enzyme involved
           in the Smt3p conjugation pathway nuclear protein
           required for S- and M-phase cyclin degradation and
           mitotic control involved in proteolysis mediated by the
           anaphase-promoting complex cyclosome (APCC)
          Length = 157

 Score = 62.4 bits (150), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 44/134 (32%), Positives = 64/134 (47%), Gaps = 12/134 (8%)

Query: 1   MSLQRITKEFKSVRKTLAEDPSYNHILKLEPKDTG--NMYHWIADISGPPETPYASAVFA 58
           + LQR+ +E K  RK    D  +    K   K  G  N+  W A I G   T +   V+ 
Sbjct: 4   LCLQRLQEERKKWRK----DHPFGFWAKPTRKADGSMNLQKWEAGIPGKEGTIWKEGVYP 59

Query: 59  LDVELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTREH-WSPVWDLVHVIH 117
           + +E P  YP +PP+VKF  G      H N+ + +G +CL IL  +  W P   L  ++ 
Sbjct: 60  ITIEYPDDYPSKPPKVKFPAG----FYHPNI-YPSGTVCLSILNEDQDWRPAITLKQIVL 114

Query: 118 AIWILLGEPVPESP 131
            +  LL  P P+SP
Sbjct: 115 GVQDLLNSPNPDSP 128

>Skud_12.389 Chr12 (685275..685835) [561 bp, 187 aa] {ON} YLR306W
           (REAL)
          Length = 187

 Score = 62.8 bits (151), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 43/113 (38%), Positives = 55/113 (48%), Gaps = 11/113 (9%)

Query: 31  PKDTGNMYHWIADISGPPETPY---ASAVFALDVELPIQYPLEPPRVKFLPGSRNNICHC 87
           P  T  M     +++  P+  Y    S  F LD      YP+EPP+V  L      I H 
Sbjct: 52  PDSTDRMQSPKLEVTVSPDEGYYNHGSINFGLDFNE--VYPIEPPKVACL----KKIFHP 105

Query: 88  NVDFKTGEICLDILTREHWSPVWDLVHVIHAIWILLGEPVPESPLNVDIANVL 140
           N+D K G +CL+IL RE WSP  DL  +I  +  L  EP P  PLN D A + 
Sbjct: 106 NIDLK-GNVCLNIL-REDWSPALDLQSIITGLLFLFLEPNPNDPLNKDAAKLF 156

>KLTH0D01760g Chr4 (171356..171841) [486 bp, 161 aa] {ON} highly
           similar to uniprot|P52492 Saccharomyces cerevisiae
           YOR339C
          Length = 161

 Score = 62.0 bits (149), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 43/125 (34%), Positives = 66/125 (52%), Gaps = 6/125 (4%)

Query: 31  PKDTGNMYHWIADISGPPETPYASAVFALDVELPIQYPLEPPRVKFLPGSRNNICHCNVD 90
           P+D  ++  W   I+GP  TPY    F + +E    YP   P+V+F+    + + H NVD
Sbjct: 38  PEDEEDLTKWCGIITGPDGTPYEGMRFKIALEFAQTYPYTAPKVRFV----SPMWHPNVD 93

Query: 91  FKTGEICLDILTREHWSPVWDLVHVIHAIWILLGEPVPESPLNVDIANVLKAGDLEAYEG 150
             +G ICLDIL ++ WS V+++  ++ ++  LL EP   SPLN   A +      E  + 
Sbjct: 94  M-SGNICLDIL-KDQWSAVYNVQTILLSLQSLLEEPNNSSPLNAVAAELWDKDMREYKKK 151

Query: 151 LIKYY 155
           LI  Y
Sbjct: 152 LIARY 156

>TBLA0I02960 Chr9 complement(706068..706503,706636..706673) [474 bp,
           157 aa] {ON} Anc_4.249 YDL064W
          Length = 157

 Score = 61.6 bits (148), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 44/134 (32%), Positives = 65/134 (48%), Gaps = 12/134 (8%)

Query: 1   MSLQRITKEFKSVRKTLAEDPSYNHILKLEPKDTG--NMYHWIADISGPPETPYASAVFA 58
           + LQR+ +E K  RK    D  +    K   K  G  N+  W A I G   T +  A++ 
Sbjct: 4   LCLQRLQEERKKWRK----DHPFGFFAKPTKKVDGSMNLQLWEAGIPGKESTIWHGALYP 59

Query: 59  LDVELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTREH-WSPVWDLVHVIH 117
           + +E P +YP +PP+VKF  G      H N+ + +G +CL IL  +  W P   L  ++ 
Sbjct: 60  ITIEYPDEYPSKPPKVKFPAG----FYHPNI-YPSGTVCLSILNEDQDWRPAITLKQIVL 114

Query: 118 AIWILLGEPVPESP 131
            +  LL  P P SP
Sbjct: 115 GVQDLLDTPNPNSP 128

>Kwal_26.7009 s26 (162391..162876) [486 bp, 161 aa] {ON} YOR339C
           (UBC11) - homolog of ubiquitin carrier protein E2-C
           [contig 46] FULL
          Length = 161

 Score = 61.6 bits (148), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 48/144 (33%), Positives = 75/144 (52%), Gaps = 9/144 (6%)

Query: 6   ITKEFKSVRKTLAEDPSYNHILKLEPKDTGNMYHWIADISGPPETPYASAVFALDVELPI 65
           +TK  +S    L   PS    L   P+   ++  W   I+GP  TPY    F + +E   
Sbjct: 15  VTKRLQSELVQLMMSPSPG--LSAFPESEDDLTKWCGIITGPDGTPYEGLRFKIALEFAQ 72

Query: 66  QYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTREHWSPVWDLVHVIHAIWILLGE 125
            YP   P+V+F+    + + H NVD  +G ICLDIL ++ WS V+++  ++ ++  LL E
Sbjct: 73  TYPYTAPKVRFV----SPMWHPNVDM-SGNICLDIL-KDQWSAVYNVQTILLSLQSLLEE 126

Query: 126 PVPESPLNVDIANVLKAGDLEAYE 149
           P   SPLN  +A  L   D++ Y+
Sbjct: 127 PNNSSPLNA-VAAELWDTDMQEYK 149

>Suva_10.401 Chr10 (705317..705877) [561 bp, 187 aa] {ON} YLR306W
           (REAL)
          Length = 187

 Score = 62.0 bits (149), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 48/143 (33%), Positives = 67/143 (46%), Gaps = 14/143 (9%)

Query: 21  PSYNHILKLEPKDTGNMYHWIADISGPPETPY---ASAVFALDVELPIQYPLEPPRVKFL 77
           P+    +K  P+ T  M     ++   P+  Y    S  F+LD      YP+EPP+V  L
Sbjct: 42  PTVTLSIKASPQSTDRMQPPKLEVVVSPDEGYYNHGSISFSLDFNE--VYPIEPPKVTCL 99

Query: 78  PGSRNNICHCNVDFKTGEICLDILTREHWSPVWDLVHVIHAIWILLGEPVPESPLNVDIA 137
                 I H N+D   G +CL+IL RE WSP  DL  +I  +  L  EP P  PLN D A
Sbjct: 100 ----KKIFHPNIDL-NGNVCLNIL-REDWSPALDLQSIIIGLLFLFLEPNPNDPLNKDAA 153

Query: 138 NVLKAGDLEAYEGLIKYYIGMNG 160
            +      +  E +I   + M+G
Sbjct: 154 KLFCQDQKKFAETVI---LAMSG 173

>TPHA0F00390 Chr6 complement(90730..91308,91376..91378) [582 bp, 193
           aa] {ON} Anc_4.49 YLR306W
          Length = 193

 Score = 61.6 bits (148), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 44/136 (32%), Positives = 64/136 (47%), Gaps = 16/136 (11%)

Query: 27  LKLEPKDTGNMYHWIADIS---------GPPETPYASAVFALDVELPIQYPLEPPRVKFL 77
           L L P+ T  +   ++D++          P E PY    F  +++    YP+EPP    L
Sbjct: 48  LNLPPQCTLELQSSLSDMNEQPLITLCISPREGPYLGGAFKFNLKFNEMYPIEPPSAICL 107

Query: 78  PGSRNNICHCNVDFKTGEICLDILTREHWSPVWDLVHVIHAIWILLGEPVPESPLNVDIA 137
               N I H N+D   G+ICL+IL RE WSP  DL  ++  +  L  +     PLN   A
Sbjct: 108 ----NKIFHPNIDL-NGKICLNIL-REDWSPALDLTSIVIGLLYLFLDFTSTDPLNQQAA 161

Query: 138 NVLKAGDLEAYEGLIK 153
            VL A D   +  L++
Sbjct: 162 EVL-ANDRNRFCELVQ 176

>ZYRO0B12386g Chr2 complement(1001376..1001849) [474 bp, 157 aa]
           {ON} highly similar to uniprot|P50623 Saccharomyces
           cerevisiae YDL064W UBC9 SUMO-conjugating enzyme involved
           in the Smt3p conjugation pathway nuclear protein
           required for S- and M-phase cyclin degradation and
           mitotic control involved in proteolysis mediated by the
           anaphase-promoting complex cyclosome (APCC)
          Length = 157

 Score = 60.8 bits (146), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 44/134 (32%), Positives = 63/134 (47%), Gaps = 12/134 (8%)

Query: 1   MSLQRITKEFKSVRKTLAEDPSYNHILKLEPKDTG--NMYHWIADISGPPETPYASAVFA 58
           + LQR+ +E K  RK    D  +    K   K  G  N+  W A I G   T +   V+ 
Sbjct: 4   LCLQRLQEERKKWRK----DHPFGFYAKPCKKADGSMNLQKWEAGIPGKEGTIWQDGVYP 59

Query: 59  LDVELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTREH-WSPVWDLVHVIH 117
           + +E P +YP +PP+VKF  G      H N+ + +G +CL IL  +  W P   L  +  
Sbjct: 60  ITIEYPDEYPSKPPKVKFPAG----FYHPNI-YPSGTVCLSILNEDQDWRPAITLKQIAL 114

Query: 118 AIWILLGEPVPESP 131
            +  LL  P P SP
Sbjct: 115 GVQDLLDSPNPNSP 128

>KAFR0F03040 Chr6 complement(599277..599786) [510 bp, 169 aa] {ON}
           Anc_4.49 YLR306W
          Length = 169

 Score = 60.8 bits (146), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 48/94 (51%), Gaps = 6/94 (6%)

Query: 47  PPETPYASAVFALDVELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTREHW 106
           P E  Y    F  ++     YP++PP V  L      I H N+D   G+ICL+IL RE W
Sbjct: 53  PDEGFYNGGRFKFNLTTSESYPIDPPSVVCL----QKIYHPNIDLN-GKICLNIL-REDW 106

Query: 107 SPVWDLVHVIHAIWILLGEPVPESPLNVDIANVL 140
           SP  D+  VI  +  L  EP P  PLN D A+ L
Sbjct: 107 SPALDIQSVIVGLLFLFLEPNPRDPLNKDAASTL 140

>KNAG0I02940 Chr9 (581958..582063,582240..582727) [594 bp, 197 aa]
           {ON} Anc_4.49 YLR306W
          Length = 197

 Score = 59.7 bits (143), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 47/84 (55%), Gaps = 6/84 (7%)

Query: 57  FALDVELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTREHWSPVWDLVHVI 116
           F     +   YP+EPP+V  L      I H N++ +TGEICL+IL RE WSP  DL  VI
Sbjct: 91  FRFQFTINENYPIEPPKVVCL----TKIYHPNIN-RTGEICLNIL-REDWSPALDLQSVI 144

Query: 117 HAIWILLGEPVPESPLNVDIANVL 140
             +  L  EP P+ PLN   A+ L
Sbjct: 145 IGLLFLFIEPNPKDPLNKQAADTL 168

>TDEL0E01220 Chr5 (240860..241333) [474 bp, 157 aa] {ON} Anc_4.249
           YDL064W
          Length = 157

 Score = 59.3 bits (142), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 42/134 (31%), Positives = 63/134 (47%), Gaps = 12/134 (8%)

Query: 1   MSLQRITKEFKSVRKTLAEDPSYNHILK--LEPKDTGNMYHWIADISGPPETPYASAVFA 58
           + LQR+ +E K  RK    D  +    K       T N+  W A I G   T +   V+ 
Sbjct: 4   LCLQRLQEERKKWRK----DHPFGFFAKPTRNADGTMNLQKWEAGIPGREGTLWDHGVYP 59

Query: 59  LDVELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTREH-WSPVWDLVHVIH 117
           + +E P +YP +PP+V+F  G      H N+ + +G +CL IL  +  W P   L  ++ 
Sbjct: 60  ISIEYPDEYPSKPPKVRFPAG----FYHPNI-YPSGTVCLSILNEDQDWRPAITLKQIVI 114

Query: 118 AIWILLGEPVPESP 131
            +  LL  P P SP
Sbjct: 115 GVQDLLDTPNPNSP 128

>SAKL0H24112g Chr8 (2080968..2080970,2081030..2081584) [558 bp, 185
           aa] {ON} similar to uniprot|P52491 Saccharomyces
           cerevisiae YLR306W UBC12 Enzyme that mediates the
           conjugation of Rub1p a ubiquitin-like protein to other
           proteins related to E2 ubiquitin-conjugating enzymes
          Length = 185

 Score = 59.3 bits (142), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 41/115 (35%), Positives = 57/115 (49%), Gaps = 7/115 (6%)

Query: 47  PPETPYASAVFALDVELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTREHW 106
           P E  Y    F   +     YP+EPP VK +    N I H N+D + G +CL+IL RE W
Sbjct: 68  PDEGYYKPGYFRFSLFFKDTYPIEPPAVKCV----NKIYHPNIDTQ-GNVCLNIL-REDW 121

Query: 107 SPVWDLVHVIHAIWILLGEPVPESPLNVDIANVLKAGDLEAYEGLIKYYIGMNGV 161
           SPV DL  V+  +  L  EP  + PLN   A  L     + ++  ++  +G N V
Sbjct: 122 SPVLDLQSVVIGLLFLFLEPNDKDPLNRMAAQELSKSPAD-FKRHVQRSLGGNQV 175

>Ecym_8371 Chr8 (747395..748198) [804 bp, 267 aa] {ON} similar to
           Ashbya gossypii ADL035C 1-intron
          Length = 267

 Score = 60.1 bits (144), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 36/95 (37%), Positives = 49/95 (51%), Gaps = 6/95 (6%)

Query: 46  GPPETPYASAVFALDVELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTREH 105
            P E  Y    F   V     YP++PP VK L      I H N+D+  G ICL++L RE 
Sbjct: 149 SPDEGFYKHGHFGFSVSFKDSYPIDPPIVKCL----TTIYHPNIDY-NGNICLNVL-RED 202

Query: 106 WSPVWDLVHVIHAIWILLGEPVPESPLNVDIANVL 140
           W+PV DL  ++  +  L  EP P+ PLN   A+ +
Sbjct: 203 WTPVLDLQTIVIGLLFLFLEPNPKDPLNKHAAHTM 237

>KLTH0H09504g Chr8 complement(817855..818406,818463..818465) [555
           bp, 184 aa] {ON} similar to uniprot|P52491 Saccharomyces
           cerevisiae YLR306W UBC12 Enzyme that mediates the
           conjugation of Rub1p a ubiquitin-like protein to other
           proteins related to E2 ubiquitin-conjugating enzymes
          Length = 184

 Score = 58.9 bits (141), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 50/97 (51%), Gaps = 6/97 (6%)

Query: 47  PPETPYASAVFALDVELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTREHW 106
           P E  Y    F         YP+EPP+V  L    + I H N+D + G +CL+IL RE W
Sbjct: 68  PDEGYYKCGHFKFCATFKDTYPIEPPKVTLL----SKIFHPNIDLQ-GNVCLNIL-REDW 121

Query: 107 SPVWDLVHVIHAIWILLGEPVPESPLNVDIANVLKAG 143
           SPV D+  ++  + +L  EP    PLN   A+VL A 
Sbjct: 122 SPVLDVQSILIGLLMLFLEPNATDPLNKVAADVLAAN 158

>ZYRO0G19910g Chr7 (1650667..1651206) [540 bp, 179 aa] {ON} similar
           to uniprot|P52491 Saccharomyces cerevisiae YLR306W UBC12
           Enzyme that mediates the conjugation of Rub1p a
           ubiquitin-like protein to other proteins related to E2
           ubiquitin-conjugating enzymes
          Length = 179

 Score = 58.5 bits (140), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 38/115 (33%), Positives = 55/115 (47%), Gaps = 7/115 (6%)

Query: 47  PPETPYASAVFALDVELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTREHW 106
           P E  Y    F  ++    QYP+EPP+VK L    N I H N+D   G +CL+IL R+ W
Sbjct: 61  PDEGYYKGGNFTFELLFNEQYPMEPPKVKCL----NRIYHPNID-TDGRVCLNIL-RQDW 114

Query: 107 SPVWDLVHVIHAIWILLGEPVPESPLNVDIANVLKAGDLEAYEGLIKYYIGMNGV 161
           +P  DL  VI  +  L  E     PLN   A      + + +   ++  +G N +
Sbjct: 115 TPALDLQSVIIGLLFLFLEISGVDPLNKQAAETFNR-NRQNFAHAVRQSMGGNTI 168

>Kpol_483.16 s483 complement(45694..46062) [369 bp, 122 aa] {ON}
           complement(45694..46062) [369 nt, 123 aa]
          Length = 122

 Score = 57.0 bits (136), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 49/97 (50%), Gaps = 6/97 (6%)

Query: 36  NMYHWIADISGPPETPYASAVFALDVELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGE 95
           ++  W A I G   T +A  V+ + +E P +YP +PP+V F  G      H NV + +G 
Sbjct: 2   DLQRWEAGIPGRTGTLWAEGVYPITIEYPDEYPSKPPKVMFPKG----FYHPNV-YPSGT 56

Query: 96  ICLDILTREH-WSPVWDLVHVIHAIWILLGEPVPESP 131
           ICL IL  E  W P   L  ++  +  LL  P P SP
Sbjct: 57  ICLSILNEEQDWRPAITLKQIVLGVQDLLDSPNPNSP 93

>Kwal_23.4227 s23 (626678..627046) [369 bp, 122 aa] {ON} YDL064W
           (UBC9) - ubiquitin-conjugating enzyme [contig 1] FULL
          Length = 122

 Score = 56.6 bits (135), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 34/97 (35%), Positives = 47/97 (48%), Gaps = 6/97 (6%)

Query: 36  NMYHWIADISGPPETPYASAVFALDVELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGE 95
           N+  W A I G   T +   VF + +E P  YP +PP+VKF  G      H N+ + +G 
Sbjct: 2   NLQKWEAGIPGKEGTIWKEGVFPITIEYPDDYPSKPPKVKFPAG----FYHPNI-YPSGT 56

Query: 96  ICLDILTREH-WSPVWDLVHVIHAIWILLGEPVPESP 131
           +CL IL  +  W P   L  +   +  LL  P P SP
Sbjct: 57  VCLSILNEDQDWRPAITLKQIALGVQDLLDSPNPNSP 93

>KLLA0C17248g Chr3 complement(1509885..1510439) [555 bp, 184 aa]
           {ON} similar to uniprot|P52491 Saccharomyces cerevisiae
           YLR306W UBC12 Enzyme that mediates the conjugation of
           Rub1p a ubiquitin-like protein to other proteins related
           to E2 ubiquitin-conjugating enzymes
          Length = 184

 Score = 57.8 bits (138), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 47/89 (52%), Gaps = 6/89 (6%)

Query: 52  YASAVFALDVELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTREHWSPVWD 111
           YA   +  +V +   YP+EPP VK +    + I H N+D   G +CL++L RE W+P  D
Sbjct: 72  YAGGTYYFNVFIKDTYPMEPPVVKCM----HRIYHPNIDID-GNVCLNLL-REDWTPALD 125

Query: 112 LVHVIHAIWILLGEPVPESPLNVDIANVL 140
           +  +I  I  L  EP    PLN D A  L
Sbjct: 126 IQSIIIGILFLFHEPNGRDPLNKDAAKTL 154

>ADL035C Chr4 complement(634056..634607,634660..634710) [603 bp, 200
           aa] {ON} Syntenic homolog of Saccharomyces cerevisiae
           YLR306W (UBC12); 1-intron
          Length = 200

 Score = 57.8 bits (138), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 39/95 (41%), Positives = 49/95 (51%), Gaps = 6/95 (6%)

Query: 46  GPPETPYASAVFALDVELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTREH 105
            P E  Y    F   V     YP+EPP VK L    N I H N+D+ +G ICL++L RE 
Sbjct: 82  SPEEGVYRGGHFRFSVVFRDTYPIEPPTVKCL----NTIYHPNIDY-SGNICLNVL-RED 135

Query: 106 WSPVWDLVHVIHAIWILLGEPVPESPLNVDIANVL 140
           WSPV DL  V+  +  L  EP    PLN   A+ +
Sbjct: 136 WSPVMDLQTVVLGLLFLFLEPNGSDPLNRQAADTM 170

>CAGL0D06468g Chr4 (615364..615927) [564 bp, 187 aa] {ON} similar to
           uniprot|P52491 Saccharomyces cerevisiae YLR306w UBC12 E2
           ubiquitin-conjugating enzyme
          Length = 187

 Score = 57.8 bits (138), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 41/115 (35%), Positives = 56/115 (48%), Gaps = 9/115 (7%)

Query: 47  PPETPYASAVFALDVELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTREHW 106
           P E  Y    F         YP++PP+V       N I H N+D   G+ICL+IL RE W
Sbjct: 71  PDEGFYKGGKFRFTATFLETYPIDPPKVI----CNNKIFHPNID-PHGKICLNIL-REDW 124

Query: 107 SPVWDLVHVIHAIWILLGEPVPESPLNVDIANVLKAGDLEAYEGLIKYYIGMNGV 161
           SP  DL  ++  +  L  EP    PLN + A VL    LE +  L++  + M+G 
Sbjct: 125 SPALDLQCIVLGLLSLFQEPNGNDPLNKEAAEVLNKDKLE-FGNLVR--LAMSGA 176

>KNAG0H01040 Chr8 (174417..175307) [891 bp, 296 aa] {ON} 
          Length = 296

 Score = 55.8 bits (133), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 44/147 (29%), Positives = 68/147 (46%), Gaps = 24/147 (16%)

Query: 3   LQRITKEFKSVRKTLAEDPSYNHILKLEPKDTGNMYHW-IADISGPPETPYASAVFALDV 61
           L R  +E    RK +   PS+N    +E +D  N++ W +  +    ++ Y    F   +
Sbjct: 12  LLRQYRELTDPRKCI---PSFN----IELEDDSNIFVWNVGVMVLNEDSLYHGGYFKAQM 64

Query: 62  ELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTR-----------EHWSPVW 110
             P  +P  PP+ +F P     I H NV ++ G +C+ IL +           E WSPV 
Sbjct: 65  RFPEDFPFSPPQFRFTPA----IYHPNV-YRDGRLCISILHQSGDPMTDEPDAETWSPVQ 119

Query: 111 DLVHVIHAIWILLGEPVPESPLNVDIA 137
            +  V+ +I  LL +P   SP NVD A
Sbjct: 120 TVESVLISIVSLLEDPNISSPANVDAA 146

>NCAS0I01430 Chr9 (264456..265232) [777 bp, 258 aa] {ON} 
          Length = 258

 Score = 55.5 bits (132), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 38/123 (30%), Positives = 60/123 (48%), Gaps = 17/123 (13%)

Query: 27  LKLEPKDTGNMYHW-IADISGPPETPYASAVFALDVELPIQYPLEPPRVKFLPGSRNNIC 85
             +E +D  N++ W I  +    ++ Y    F   ++ P  +P  PP+ KF+P     I 
Sbjct: 36  FHIELEDDSNIFTWNIGVMVLNKDSIYHGGYFQSQMKFPKDFPFSPPQFKFIPP----IY 91

Query: 86  HCNVDFKTGEICLDILTR-----------EHWSPVWDLVHVIHAIWILLGEPVPESPLNV 134
           H NV ++ G++C+ IL +           E WSPV  +  V+ +I  LL +P   SP NV
Sbjct: 92  HPNV-YRDGKLCISILHQSGDAMTSEPDNETWSPVQSVESVLISIVSLLEDPNVSSPANV 150

Query: 135 DIA 137
           D A
Sbjct: 151 DAA 153

>KAFR0H01270 Chr8 (239005..239868) [864 bp, 287 aa] {ON} 
          Length = 287

 Score = 55.5 bits (132), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 44/147 (29%), Positives = 67/147 (45%), Gaps = 24/147 (16%)

Query: 3   LQRITKEFKSVRKTLAEDPSYNHILKLEPKDTGNMYHW-IADISGPPETPYASAVFALDV 61
           L R  +E    +K +   PS+N    +E  D  N++ W I  +    ++ Y    F   +
Sbjct: 12  LLRQYRELTDPKKAI---PSFN----IELDDDSNIFVWNIGVMVLNEDSIYHGGYFKAQM 64

Query: 62  ELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTR-----------EHWSPVW 110
             P  +P  PP+ +F P     I H NV ++ G +C+ IL +           E WSPV 
Sbjct: 65  RFPDDFPFSPPQFRFTPA----IYHPNV-YRDGRLCISILHQSGDPMTDEPDAETWSPVQ 119

Query: 111 DLVHVIHAIWILLGEPVPESPLNVDIA 137
            +  V+ +I  LL +P   SP NVD A
Sbjct: 120 TVESVLISIVSLLEDPNISSPANVDAA 146

>TPHA0M01280 Chr13 complement(262582..263889) [1308 bp, 435 aa] {ON}
           Anc_3.301 YDR054C
          Length = 435

 Score = 55.5 bits (132), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 52/163 (31%), Positives = 76/163 (46%), Gaps = 25/163 (15%)

Query: 3   LQRITKEFKSVRKTLAEDPSYNHILKLEPKDTGNMYHW-IADISGPPETPYASAVFALDV 61
           L R  +E    +K++   PS+ HI  LE  D  N++ W I  +    E+ Y    F   +
Sbjct: 12  LLRQYRELTDPKKSI---PSF-HI-NLE--DDSNIFVWNIGVMVLNEESIYHGGYFKAQM 64

Query: 62  ELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTR-----------EHWSPVW 110
             P  +P  PP+ +F P     I H NV ++ G +C+ IL +           E WSPV 
Sbjct: 65  RFPDDFPFSPPQFRFTPA----IYHPNV-YRDGRLCISILHQSGDPMTDELDAETWSPVQ 119

Query: 111 DLVHVIHAIWILLGEPVPESPLNVDIANVLKAGDLEAYEGLIK 153
            +  V+ +I  LL +P   SP NVD A V    + E Y+  IK
Sbjct: 120 SVESVLISIVSLLEDPNISSPANVDAA-VDYRKNPEQYKQRIK 161

>TBLA0G03270 Chr7 complement(866771..867763) [993 bp, 330 aa] {ON}
           Anc_3.301 YDR054C
          Length = 330

 Score = 55.1 bits (131), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 49/163 (30%), Positives = 75/163 (46%), Gaps = 25/163 (15%)

Query: 3   LQRITKEFKSVRKTLAEDPSYNHILKLEPKDTGNMYHW-IADISGPPETPYASAVFALDV 61
           L R  +E    RK +   PS++    +E +D  N++ W I  +    ++ Y    F   +
Sbjct: 12  LLRQYRELTDPRKAI---PSFH----IELEDESNLFIWNIGVMVLNEDSIYHGGYFKSQM 64

Query: 62  ELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTR-----------EHWSPVW 110
             P  +P  PP+ +F P     I H NV ++ G +C+ IL +           E WSPV 
Sbjct: 65  RFPEDFPFSPPQFRFTPA----IYHPNV-YRDGRLCISILHQSGDPTTDEPDAETWSPVQ 119

Query: 111 DLVHVIHAIWILLGEPVPESPLNVDIANVLKAGDLEAYEGLIK 153
            +  V+ +I  LL +P   SP NVD A V    + E Y+  IK
Sbjct: 120 TVESVLISIVSLLEDPNISSPANVDAA-VDYRKNPEQYKQRIK 161

>TDEL0D03260 Chr4 (610053..610922) [870 bp, 289 aa] {ON} Anc_3.301
           YDR054C
          Length = 289

 Score = 54.3 bits (129), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 44/147 (29%), Positives = 68/147 (46%), Gaps = 24/147 (16%)

Query: 3   LQRITKEFKSVRKTLAEDPSYNHILKLEPKDTGNMYHW-IADISGPPETPYASAVFALDV 61
           L R  +E    +K +   PS++    +E +D  N++ W I  +    E+ Y    F   +
Sbjct: 12  LLRQYRELTDPKKAI---PSFH----IELEDDSNIFVWNIGVMVLNEESIYHGGYFKAQM 64

Query: 62  ELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTR-----------EHWSPVW 110
             P  +P  PP+ +F P     I H NV ++ G +C+ IL +           E WSPV 
Sbjct: 65  RFPEDFPFSPPQFRFTPA----IYHPNV-YRDGRLCISILHQSGDPMTDEPDAETWSPVQ 119

Query: 111 DLVHVIHAIWILLGEPVPESPLNVDIA 137
            +  V+ +I  LL +P   SP NVD A
Sbjct: 120 TVESVLISIVSLLEDPNISSPANVDAA 146

>Skud_4.306 Chr4 complement(537399..538292) [894 bp, 297 aa] {ON}
           YDR054C (REAL)
          Length = 297

 Score = 53.9 bits (128), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 47/166 (28%), Positives = 76/166 (45%), Gaps = 25/166 (15%)

Query: 3   LQRITKEFKSVRKTLAEDPSYNHILKLEPKDTGNMYHW-IADISGPPETPYASAVFALDV 61
           L R  +E    +K +   PS++    +E +D  N++ W I  +    ++ Y    F   +
Sbjct: 12  LLRQYRELTDPKKAI---PSFH----IELEDDSNIFTWNIGVMVLNEDSIYHGGFFKAQM 64

Query: 62  ELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTR-----------EHWSPVW 110
             P  +P  PP+ +F P     I H NV ++ G +C+ IL +           E WSPV 
Sbjct: 65  RFPEDFPFSPPQFRFTPA----IYHPNV-YRDGRLCISILHQSGDPMTDEPDAETWSPVQ 119

Query: 111 DLVHVIHAIWILLGEPVPESPLNVDIANVLKAGDLEAYEGLIKYYI 156
            +  V+ +I  LL +P   SP NVD A V    + E Y+  +K  +
Sbjct: 120 TVESVLISIVSLLEDPNINSPANVDAA-VDYRKNPEQYKQRVKMEV 164

>Smik_4.290 Chr4 complement(527854..528747) [894 bp, 297 aa] {ON}
           YDR054C (REAL)
          Length = 297

 Score = 53.9 bits (128), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 47/166 (28%), Positives = 76/166 (45%), Gaps = 25/166 (15%)

Query: 3   LQRITKEFKSVRKTLAEDPSYNHILKLEPKDTGNMYHW-IADISGPPETPYASAVFALDV 61
           L R  +E    +K +   PS++    +E +D  N++ W I  +    ++ Y    F   +
Sbjct: 12  LLRQYRELTDPKKAI---PSFH----IELEDDSNIFTWNIGVMVLNEDSIYHGGFFKAQM 64

Query: 62  ELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTR-----------EHWSPVW 110
             P  +P  PP+ +F P     I H NV ++ G +C+ IL +           E WSPV 
Sbjct: 65  RFPEDFPFSPPQFRFTPA----IYHPNV-YRDGRLCISILHQSGDPMTDEPDAETWSPVQ 119

Query: 111 DLVHVIHAIWILLGEPVPESPLNVDIANVLKAGDLEAYEGLIKYYI 156
            +  V+ +I  LL +P   SP NVD A V    + E Y+  +K  +
Sbjct: 120 TVESVLISIVSLLEDPNINSPANVDAA-VDYRKNPEQYKQRVKMEV 164

>YDR054C Chr4 complement(561440..562327) [888 bp, 295 aa] {ON}
           CDC34Ubiquitin-conjugating enzyme (E2) and catalytic
           subunit of SCF ubiquitin-protein ligase complex
           (together with Skp1p, Rbx1p, Cdc53p, and an F-box
           protein) that regulates cell cycle progression by
           targeting key substrates for degradation
          Length = 295

 Score = 53.9 bits (128), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 47/166 (28%), Positives = 76/166 (45%), Gaps = 25/166 (15%)

Query: 3   LQRITKEFKSVRKTLAEDPSYNHILKLEPKDTGNMYHW-IADISGPPETPYASAVFALDV 61
           L R  +E    +K +   PS++    +E +D  N++ W I  +    ++ Y    F   +
Sbjct: 12  LLRQYRELTDPKKAI---PSFH----IELEDDSNIFTWNIGVMVLNEDSIYHGGFFKAQM 64

Query: 62  ELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTR-----------EHWSPVW 110
             P  +P  PP+ +F P     I H NV ++ G +C+ IL +           E WSPV 
Sbjct: 65  RFPEDFPFSPPQFRFTPA----IYHPNV-YRDGRLCISILHQSGDPMTDEPDAETWSPVQ 119

Query: 111 DLVHVIHAIWILLGEPVPESPLNVDIANVLKAGDLEAYEGLIKYYI 156
            +  V+ +I  LL +P   SP NVD A V    + E Y+  +K  +
Sbjct: 120 TVESVLISIVSLLEDPNINSPANVDAA-VDYRKNPEQYKQRVKMEV 164

>NDAI0A07570 Chr1 complement(1734788..1735507) [720 bp, 239 aa] {ON}
          Length = 239

 Score = 53.5 bits (127), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 41/137 (29%), Positives = 68/137 (49%), Gaps = 18/137 (13%)

Query: 29  LEPKDTGNMYHW-IADISGPPETPYASAVFALDVELPIQYPLEPPRVKFLPGSRNNICHC 87
           +E ++  N++ W I  I    ++ Y    F  +++ P  +P  PP  KF+P     I H 
Sbjct: 32  IELENDSNIFVWHIGFIILNEDSIYNGGYFKSEMKFPSNFPYSPPHFKFVPP----IYHP 87

Query: 88  NVDFKTGEICLDILTR-----------EHWSPVWDLVHVIHAIWILLGEPVPESPLNVDI 136
           NV +K G++C+ IL +           E WSPV  +  V+ +I  LL +P   SP NVD 
Sbjct: 88  NV-YKDGKLCISILHQSGDSMTSEPDNETWSPVQSVESVLISIISLLEDPNISSPANVD- 145

Query: 137 ANVLKAGDLEAYEGLIK 153
           A+V    + + Y+  ++
Sbjct: 146 ASVEYRKNFQEYKRKVR 162

>NDAI0A05530 Chr1 (1251593..1252414) [822 bp, 273 aa] {ON} Anc_3.301
           YDR054C
          Length = 273

 Score = 53.5 bits (127), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 47/163 (28%), Positives = 74/163 (45%), Gaps = 25/163 (15%)

Query: 3   LQRITKEFKSVRKTLAEDPSYNHILKLEPKDTGNMYHW-IADISGPPETPYASAVFALDV 61
           L R  +E    +K +   PS++    +E  D  N++ W I  +    ++ Y    F   +
Sbjct: 12  LLRQYRELTDPKKAI---PSFH----IELDDDSNLFVWNIGVMVLNEDSIYHGGYFKAQM 64

Query: 62  ELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTR-----------EHWSPVW 110
             P  +P  PP+ +F P     I H NV ++ G +C+ IL +           E WSPV 
Sbjct: 65  RFPEDFPFSPPQFRFTPA----IYHPNV-YRDGRLCISILHQGGDPMTDEPDAETWSPVQ 119

Query: 111 DLVHVIHAIWILLGEPVPESPLNVDIANVLKAGDLEAYEGLIK 153
            +  V+ +I  LL +P   SP NVD A V    + E Y+  +K
Sbjct: 120 TVESVLISIVSLLEDPNISSPANVDAA-VDYRKNQEQYKQRVK 161

>KLTH0C04818g Chr3 (416167..416994) [828 bp, 275 aa] {ON} highly
           similar to uniprot|P14682 Saccharomyces cerevisiae
           YDR054C CDC34 Ubiquitin-conjugating enzyme or E2
           together with Skp1p Rbx1p Cdc53p and an F-box protein
           forms a ubiquitin-protein ligase called the SCF complex
           which regulates cell cycle progression by targeting key
           substrates for degradation
          Length = 275

 Score = 53.5 bits (127), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 46/163 (28%), Positives = 73/163 (44%), Gaps = 25/163 (15%)

Query: 3   LQRITKEFKSVRKTLAEDPSYNHILKLEPKDTGNMYHW-IADISGPPETPYASAVFALDV 61
           L R  +E    +K +   PS++    +E  D  N++ W I  +    ++ Y    F   +
Sbjct: 12  LLRQYRELTDAKKAI---PSFH----IELDDDSNIFLWNIGVMVLNEDSIYHGGYFKAQM 64

Query: 62  ELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDIL-----------TREHWSPVW 110
             P  +P  PP  +F P     I H NV ++ G +C+ IL             E WSPV 
Sbjct: 65  RFPEDFPFSPPTFRFTPA----IYHPNV-YRDGRLCISILHTSGDPTSEEPDSETWSPVQ 119

Query: 111 DLVHVIHAIWILLGEPVPESPLNVDIANVLKAGDLEAYEGLIK 153
            +  V+ +I  LL +P   SP NVD A V    ++E Y+  ++
Sbjct: 120 TVESVLISIVSLLEDPNISSPANVDAA-VDYRKNIEQYKQRVQ 161

>ZYRO0G12650g Chr7 complement(1002296..1003153) [858 bp, 285 aa]
           {ON} highly similar to uniprot|Q750Z0 Ashbya gossypii
           AGL203C AGL203Cp and similar to YDR054C uniprot|P14682
           Saccharomyces cerevisiae YDR054C CDC34 Ubiquitin-
           conjugating enzyme or E2 together with Skp1p Rbx1p
           Cdc53p and an F-box protein forms a ubiquitin-protein
           ligase called the SCF complex which regulates cell cycle
           progression by targeting key substrates for degradation
          Length = 285

 Score = 53.1 bits (126), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 43/147 (29%), Positives = 68/147 (46%), Gaps = 24/147 (16%)

Query: 3   LQRITKEFKSVRKTLAEDPSYNHILKLEPKDTGNMYHW-IADISGPPETPYASAVFALDV 61
           L R  +E    +K +   PS++    +E +D  N++ W I  +    ++ Y    F   +
Sbjct: 12  LLRQYRELTDPKKAI---PSFH----IELEDDSNIFVWNIGVMVLNEDSIYHGGFFKAQM 64

Query: 62  ELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTR-----------EHWSPVW 110
             P  +P  PP+ +F P     I H NV ++ G +C+ IL +           E WSPV 
Sbjct: 65  RFPEDFPFSPPQFRFTPA----IYHPNV-YRDGRLCISILHQSGDPMTDEPDAETWSPVQ 119

Query: 111 DLVHVIHAIWILLGEPVPESPLNVDIA 137
            +  V+ +I  LL +P   SP NVD A
Sbjct: 120 TVESVLISIVSLLEDPNISSPANVDAA 146

>CAGL0E04598g Chr5 complement(444525..445412) [888 bp, 295 aa] {ON}
           highly similar to uniprot|P14682 Saccharomyces
           cerevisiae YDR054c CDC34 E2 ubiquitin-conjugating enzyme
          Length = 295

 Score = 53.1 bits (126), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 46/163 (28%), Positives = 75/163 (46%), Gaps = 25/163 (15%)

Query: 3   LQRITKEFKSVRKTLAEDPSYNHILKLEPKDTGNMYHW-IADISGPPETPYASAVFALDV 61
           L R  +E    +K +   PS++    +E +D  N++ W I  +    ++ Y    F   +
Sbjct: 12  LLRQYRELTDPKKAI---PSFH----IELEDDSNIFVWNIGVMVLNEDSIYHGGYFKAQM 64

Query: 62  ELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTR-----------EHWSPVW 110
             P  +P  PP+ +F P     I H NV ++ G +C+ IL +           E WSPV 
Sbjct: 65  RFPDDFPFSPPQFRFTPA----IYHPNV-YRDGRLCISILHQSGDPMTDEPDAETWSPVQ 119

Query: 111 DLVHVIHAIWILLGEPVPESPLNVDIANVLKAGDLEAYEGLIK 153
            +  V+ +I  LL +P   SP NVD A   +  + E Y+  +K
Sbjct: 120 TVESVLISIVSLLEDPNISSPANVDAAVDFRK-NPEQYKQRVK 161

>Suva_2.211 Chr2 complement(361071..361964) [894 bp, 297 aa] {ON}
           YDR054C (REAL)
          Length = 297

 Score = 53.1 bits (126), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 47/166 (28%), Positives = 76/166 (45%), Gaps = 25/166 (15%)

Query: 3   LQRITKEFKSVRKTLAEDPSYNHILKLEPKDTGNMYHW-IADISGPPETPYASAVFALDV 61
           L R  +E    +K +   PS++    +E +D  N++ W I  +    ++ Y    F   +
Sbjct: 12  LLRQYRELTDPKKAI---PSFH----IELEDDSNIFIWNIGVMVLNEDSIYHGGFFKAQM 64

Query: 62  ELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTR-----------EHWSPVW 110
             P  +P  PP+ +F P     I H NV ++ G +C+ IL +           E WSPV 
Sbjct: 65  RFPEDFPFSPPQFRFTPA----IYHPNV-YRDGRLCISILHQSGDPMTDEPDAETWSPVQ 119

Query: 111 DLVHVIHAIWILLGEPVPESPLNVDIANVLKAGDLEAYEGLIKYYI 156
            +  V+ +I  LL +P   SP NVD A V    + E Y+  +K  +
Sbjct: 120 TVESVLISIVSLLEDPNINSPANVDAA-VDYRKNPEQYKQRVKMEV 164

>KLLA0D09196g Chr4 (772795..773673) [879 bp, 292 aa] {ON} similar to
           uniprot|P14682 Saccharomyces cerevisiae YDR054C CDC34
           Ubiquitin-conjugating enzyme or E2 together with Skp1p
           Rbx1p Cdc53p and an F-box protein forms a
           ubiquitin-protein ligase called the SCF complex which
           regulates cell cycle progression by targeting key
           substrates for degradation
          Length = 292

 Score = 53.1 bits (126), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 44/147 (29%), Positives = 66/147 (44%), Gaps = 24/147 (16%)

Query: 3   LQRITKEFKSVRKTLAEDPSYNHILKLEPKDTGNMYHW-IADISGPPETPYASAVFALDV 61
           L R  +E    +K +   PS++  L+    D  N++ W I  +    E+ Y    F   +
Sbjct: 11  LLRQYRELTDPKKAI---PSFHIALE----DDSNIFLWNIGVMVLNEESIYHGGYFKAQM 63

Query: 62  ELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDIL-----------TREHWSPVW 110
           + P  +P  PP  +F P     I H NV ++ G +C+ IL             E WSPV 
Sbjct: 64  KFPDDFPFSPPTFRFTPA----IYHPNV-YRDGRLCISILHQSGNPTSDEPDEETWSPVQ 118

Query: 111 DLVHVIHAIWILLGEPVPESPLNVDIA 137
            +  V+ +I  LL +P   SP NVD A
Sbjct: 119 TVESVLISIVSLLEDPNISSPANVDAA 145

>NCAS0A10770 Chr1 complement(2142376..2143197) [822 bp, 273 aa] {ON}
           Anc_3.301
          Length = 273

 Score = 52.8 bits (125), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 47/163 (28%), Positives = 74/163 (45%), Gaps = 25/163 (15%)

Query: 3   LQRITKEFKSVRKTLAEDPSYNHILKLEPKDTGNMYHW-IADISGPPETPYASAVFALDV 61
           L R  +E    +K +   PS++    +E  D  N++ W I  +    ++ Y    F   +
Sbjct: 12  LLRQYRELTDPKKAI---PSFH----IELDDDSNLFVWNIGVMVLNEDSIYHGGYFKAQM 64

Query: 62  ELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTR-----------EHWSPVW 110
             P  +P  PP+ +F P     I H NV ++ G +C+ IL +           E WSPV 
Sbjct: 65  RFPEDFPFSPPQFRFTPA----IYHPNV-YRDGRLCISILHQGGDPMTDEPDAETWSPVQ 119

Query: 111 DLVHVIHAIWILLGEPVPESPLNVDIANVLKAGDLEAYEGLIK 153
            +  V+ +I  LL +P   SP NVD A V    + E Y+  +K
Sbjct: 120 TVESVLISIVSLLEDPNISSPANVDAA-VDYRKNPEQYKQRVK 161

>Kpol_1065.45 s1065 (121426..122397) [972 bp, 323 aa] {ON}
           (121426..122397) [972 nt, 324 aa]
          Length = 323

 Score = 53.1 bits (126), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 48/163 (29%), Positives = 76/163 (46%), Gaps = 25/163 (15%)

Query: 3   LQRITKEFKSVRKTLAEDPSYNHILKLEPKDTGNMYHW-IADISGPPETPYASAVFALDV 61
           L R  +E  + +K +   PS++  + LE  D  N++ W I  +    ++ Y    F   +
Sbjct: 12  LLRQYRELTNPKKAI---PSFH--INLE--DDSNIFVWNIGVMVLNEDSIYHGGYFKAQM 64

Query: 62  ELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTR-----------EHWSPVW 110
             P  +P  PP+ +F P     I H NV ++ G +C+ IL +           E WSPV 
Sbjct: 65  RFPDDFPFSPPQFRFTPA----IYHPNV-YRDGRLCISILHQSGDPMTDELDAETWSPVQ 119

Query: 111 DLVHVIHAIWILLGEPVPESPLNVDIANVLKAGDLEAYEGLIK 153
            +  V+ +I  LL +P   SP NVD A V    + E Y+  +K
Sbjct: 120 TVESVLISIVSLLEDPNISSPANVDAA-VDYRKNPEQYKQRVK 161

>AGL203C Chr7 complement(317749..318561) [813 bp, 270 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR054C
           (CDC34)
          Length = 270

 Score = 52.4 bits (124), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 47/163 (28%), Positives = 73/163 (44%), Gaps = 25/163 (15%)

Query: 3   LQRITKEFKSVRKTLAEDPSYNHILKLEPKDTGNMYHW-IADISGPPETPYASAVFALDV 61
           L R  +E    +K +   PS++    +E  D  N++ W I  +    ++ Y    F   +
Sbjct: 12  LLRQYRELTDPKKAI---PSFH----IELDDDSNIFSWNIGVMVLNEDSIYHGGYFKAQM 64

Query: 62  ELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTR-----------EHWSPVW 110
             P  +P  PP  +F P     I H NV ++ G +C+ IL +           E WSPV 
Sbjct: 65  RFPEDFPFSPPSFRFTPA----IYHPNV-YRDGRLCISILHQSGDPTSDEPDSETWSPVQ 119

Query: 111 DLVHVIHAIWILLGEPVPESPLNVDIANVLKAGDLEAYEGLIK 153
            +  V+ +I  LL +P   SP NVD A V    + E Y+  +K
Sbjct: 120 TVESVLISIVSLLEDPNISSPANVDAA-VDYRKNPEQYKQRVK 161

>Kwal_27.10444 s27 (347585..348421) [837 bp, 278 aa] {ON} YDR054C
           (CDC34) - ubiquitin-conjugating enzyme, E2 [contig 36]
           FULL
          Length = 278

 Score = 52.4 bits (124), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 42/147 (28%), Positives = 65/147 (44%), Gaps = 24/147 (16%)

Query: 3   LQRITKEFKSVRKTLAEDPSYNHILKLEPKDTGNMYHW-IADISGPPETPYASAVFALDV 61
           L R  +E    +K +   PS++    +E  D  N++ W +  +    ++ Y    F   +
Sbjct: 12  LLRQYRELTDAKKAI---PSFH----IELDDDSNIFLWNVGVMVLNEDSIYHGGYFKAQM 64

Query: 62  ELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDIL-----------TREHWSPVW 110
             P  +P  PP  +F P     I H NV ++ G +C+ IL             E WSPV 
Sbjct: 65  RFPEDFPFSPPTFRFTPA----IYHPNV-YRDGRLCISILHTSGDPTSEEPDSETWSPVQ 119

Query: 111 DLVHVIHAIWILLGEPVPESPLNVDIA 137
            +  V+ +I  LL +P   SP NVD A
Sbjct: 120 TVESVLISIVSLLEDPNISSPANVDAA 146

>SAKL0D02530g Chr4 (200047..200865) [819 bp, 272 aa] {ON} highly
           similar to uniprot|Q750Z0 Ashbya gossypii AGL203C
           AGL203Cp and similar to YDR054C uniprot|P14682
           Saccharomyces cerevisiae YDR054C CDC34 Ubiquitin-
           conjugating enzyme or E2 together with Skp1p Rbx1p
           Cdc53p and an F-box protein forms a ubiquitin-protein
           ligase called the SCF complex which regulates cell cycle
           progression by targeting key substrates for degradation
          Length = 272

 Score = 52.0 bits (123), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 43/147 (29%), Positives = 67/147 (45%), Gaps = 24/147 (16%)

Query: 3   LQRITKEFKSVRKTLAEDPSYNHILKLEPKDTGNMYHW-IADISGPPETPYASAVFALDV 61
           L R  +E    +K +   PS++    +E  D  N++ W I  +    ++ Y    F   +
Sbjct: 12  LLRQYRELTDPKKAI---PSFH----IELDDDSNIFLWNIGVMVLNEDSIYHGGYFKAQM 64

Query: 62  ELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTR-----------EHWSPVW 110
           + P  +P  PP  +F P     I H NV ++ G +C+ IL +           E WSPV 
Sbjct: 65  KFPEDFPFSPPNFRFTPA----IYHPNV-YRDGRLCISILHQSGDPTSDEPDSETWSPVQ 119

Query: 111 DLVHVIHAIWILLGEPVPESPLNVDIA 137
            +  V+ +I  LL +P   SP NVD A
Sbjct: 120 TVESVLISIVSLLEDPNISSPANVDAA 146

>NDAI0D02910 Chr4 (685459..686028) [570 bp, 189 aa] {ON} Anc_4.49
          Length = 189

 Score = 51.2 bits (121), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 62/123 (50%), Gaps = 8/123 (6%)

Query: 31  PKDTGNMYHWIADISG-PPETPYASAVFALDVELPIQYPLEPPRVKFLPGSRNNICHCNV 89
           P D G+    + +I+  P E  Y    F   +E    YP+EPP V       + + H N+
Sbjct: 56  PIDPGSRSPPLLEITAYPDEGFYKGGHFTFKLEFNDAYPIEPPTVI----CTSKLYHPNI 111

Query: 90  DFKTGEICLDILTREHWSPVWDLVHVIHAIWILLGEPVPESPLNVDIANVLKAGDLEAYE 149
           D   G++CL+IL RE WSP  D+  +I  +  LL EP  + PLN D A +L + D   + 
Sbjct: 112 DID-GKVCLNIL-REDWSPALDVQSIIIGLLFLLLEPNAKDPLNKDAAMML-STDTARFA 168

Query: 150 GLI 152
            L+
Sbjct: 169 SLV 171

>Ecym_2669 Chr2 (1289437..1290243) [807 bp, 268 aa] {ON} similar to
           Ashbya gossypii AGL203C
          Length = 268

 Score = 51.6 bits (122), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 47/163 (28%), Positives = 73/163 (44%), Gaps = 25/163 (15%)

Query: 3   LQRITKEFKSVRKTLAEDPSYNHILKLEPKDTGNMYHW-IADISGPPETPYASAVFALDV 61
           L R  +E    +K +   PS++    +E  D  N++ W I  +    ++ Y    F   +
Sbjct: 12  LLRQYRELTDPKKAI---PSFH----IELDDDSNIFLWNIGVMVLNEDSIYHGGYFKAQM 64

Query: 62  ELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTR-----------EHWSPVW 110
             P  +P  PP  +F P     I H NV ++ G +C+ IL +           E WSPV 
Sbjct: 65  RFPEDFPFSPPSFRFTPA----IYHPNV-YRDGRLCISILHQSGDPTSDEPDSETWSPVQ 119

Query: 111 DLVHVIHAIWILLGEPVPESPLNVDIANVLKAGDLEAYEGLIK 153
            +  V+ +I  LL +P   SP NVD A V    + E Y+  +K
Sbjct: 120 TVESVLISIVSLLEDPNISSPANVDAA-VDYRKNPEQYKQRVK 161

>Kpol_1002.65 s1002 (176569..176874) [306 bp, 101 aa] {ON}
          (176569..176874) [306 nt, 102 aa]
          Length = 101

 Score = 45.8 bits (107), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 38/61 (62%), Gaps = 6/61 (9%)

Query: 37 MYHWIADISGPPETPYASAVFALDVELPIQYPLEPPRVKFLPGSRNNI-CHCNVDFKTGE 95
          M +W   I GPP + +A+ +++L +E    YP EPP++KF+  SR N+ C   VD  TGE
Sbjct: 1  MTYWNGTILGPPHSNHANRIYSLSIECGPNYPDEPPKIKFI--SRVNLPC---VDVNTGE 55

Query: 96 I 96
          +
Sbjct: 56 V 56

>KLLA0E20395g Chr5 (1814618..1815373) [756 bp, 251 aa] {ON} similar
           to uniprot|P33296 Saccharomyces cerevisiae YER100W UBC6
           Ubiquitin-conjugating enzyme involved in ER- associated
           protein degradation located at the cytosolic side of the
           ER membrane tail region contains a transmembrane segment
           at the C-terminus substrate of the ubiquitin-proteasome
           pathway
          Length = 251

 Score = 46.2 bits (108), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 33/124 (26%), Positives = 59/124 (47%), Gaps = 20/124 (16%)

Query: 4   QRITKEFKSVRKTLAEDPSYNHILKLEPKDTGNMYHWIADISGPPETPYASAVFALDVEL 63
           +R+TKE+K++   +   P +  I+    +D  N+  W   I+GPP TPY +  +   +  
Sbjct: 8   KRLTKEYKNI---VNNPPPF--IIAAPHED--NILEWHYVITGPPSTPYENGQYHGTLTF 60

Query: 64  PIQYPLEPPRVKFL-PGSRNNICHCNVDFKTG-EICLDILTR--EHWSPVWDLVHVIHAI 119
           P  YP  PP ++ + P  R         FK    +CL +     E W+P W +V +++ +
Sbjct: 61  PSDYPFNPPAIRMITPNGR---------FKENTRLCLSMSDYHPEAWNPAWSVVTILNGL 111

Query: 120 WILL 123
              +
Sbjct: 112 LSFM 115

>SAKL0F12474g Chr6 (974485..975240) [756 bp, 251 aa] {ON} similar to
           uniprot|P33296 Saccharomyces cerevisiae YER100W UBC6
           Ubiquitin-conjugating enzyme involved in ER- associated
           protein degradation located at the cytosolic side of the
           ER membrane tail region contains a transmembrane segment
           at the C-terminus substrate of the ubiquitin-proteasome
           pathway
          Length = 251

 Score = 45.4 bits (106), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 29/125 (23%), Positives = 56/125 (44%), Gaps = 22/125 (17%)

Query: 4   QRITKEFKSVRKTLAEDPSYNHILKLEPKDTGNMYHWIADISGPPETPYASAVFALDVEL 63
           +R+TKE+K++     E+P     +  +P +  N+  W   I+GPP+TPY    +   +  
Sbjct: 8   KRLTKEYKAI----IENPP--QFINAQPNE-DNILEWHYIITGPPDTPYTDGQYHGTLVF 60

Query: 64  PIQYPLEPPRVKFL-PGSR----NNICHCNVDFKTGEICLDILTREHWSPVWDLVHVIHA 118
           P  YP +PP ++ + P  R      +C    D+            + W+P W +  ++  
Sbjct: 61  PADYPFKPPAIRMITPNGRFKENTRLCMTMSDYHP----------DTWNPAWSVATILMG 110

Query: 119 IWILL 123
           +   +
Sbjct: 111 LLSFM 115

>KNAG0J02280 Chr10 complement(424795..425448) [654 bp, 217 aa] {ON} 
          Length = 217

 Score = 45.1 bits (105), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 44/159 (27%), Positives = 67/159 (42%), Gaps = 21/159 (13%)

Query: 6   ITKEFKSVRKTLAEDPSYNHILKLEPKDTGNMYHW-IADISGPPETPYASAVFALDVELP 64
           + ++F+ +R      P + HI  +E     N++ W +  +    ++ Y  A     +  P
Sbjct: 13  LLRQFRELRDPRRRMPCF-HIELVE---KSNIFEWEVGFMVTNEDSIYHGAYLTGLLCFP 68

Query: 65  IQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDIL-----------TREHWSPVWDLV 113
             +P  PP   F P     I H NV F  G +C+ IL             E WSPV  + 
Sbjct: 69  RNFPFSPPTFLFCPP----IYHPNV-FSNGSLCISILHECGDDTNEEPDSETWSPVQTVE 123

Query: 114 HVIHAIWILLGEPVPESPLNVDIANVLKAGDLEAYEGLI 152
            V+ +I  LL +P   SP NVD A   K    E  + +I
Sbjct: 124 TVLISIISLLDDPNVSSPANVDAAVEYKNARQEYNKRVI 162

>NDAI0E04170 Chr5 complement(940288..941061) [774 bp, 257 aa] {ON}
           Anc_7.392
          Length = 257

 Score = 45.1 bits (105), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 34/127 (26%), Positives = 60/127 (47%), Gaps = 20/127 (15%)

Query: 1   MSLQRITKEFKSVRKTLAEDPSYNHILKLEPKDTGNMYHWIADISGPPETPYASAVFALD 60
            + +R+TKE+K    TL E P   +IL    +D  N+  W   I+GPP++PY+   +   
Sbjct: 5   QAFKRLTKEYK----TLTETPP-PYILARPNED--NILEWHYIITGPPDSPYSEGQYHGT 57

Query: 61  VELPIQYPLEPPRVKFL-PGSRNNICHCNVDFKTG-EICLDILTR--EHWSPVWDLVHVI 116
           +  P  YP +PP ++ + P  R         FK    +CL +     + W+P W +  ++
Sbjct: 58  LTFPTDYPYKPPAIRMITPNGR---------FKENTRLCLSMSDYHPDLWNPSWSVSTIL 108

Query: 117 HAIWILL 123
             +   +
Sbjct: 109 TGLLSFM 115

>Ecym_4683 Chr4 complement(1330525..1331256) [732 bp, 243 aa] {ON}
           similar to Ashbya gossypii AGR372W
          Length = 243

 Score = 44.7 bits (104), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 32/126 (25%), Positives = 60/126 (47%), Gaps = 18/126 (14%)

Query: 1   MSLQRITKEFKSVRKTLAEDPSYNHILKLEPKDTGNMYHWIADISGPPETPYASAVFALD 60
            + +R++KE+K +   +   P Y  I+ + P D  N+  W   I+GPP+TPY    +   
Sbjct: 5   QAYKRLSKEYKMI---MENTPPY--IIAV-PNDE-NILEWHYVITGPPDTPYEGGQYHGT 57

Query: 61  VELPIQYPLEPPRVKFLPGSRNNICHCNVDFKT-GEICLDILTR--EHWSPVWDLVHVIH 117
           +  P +YP +PP ++        I   N  FK    +CL +     + W+P W +  +++
Sbjct: 58  LHFPPEYPFKPPAIR--------ISTPNGRFKQHTRLCLSMSDYHPDTWNPSWSVATILN 109

Query: 118 AIWILL 123
            +   +
Sbjct: 110 GLLSFM 115

>AFL064W Chr6 (314210..314220,314273..314678) [417 bp, 138 aa]
          {ON} Syntenic homolog of Saccharomyces cerevisiae
          YGL087C (MMS2); 1-intron
          Length = 138

 Score = 43.1 bits (100), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 50/94 (53%), Gaps = 11/94 (11%)

Query: 5  RITKEFKSVRKTLA-EDPSYNHILKLEPKDTGNMYHWIADISGPPETPYASAVFALDVEL 63
          R+ +E +   K +  E  SY     L   D  +M HW   I GPP + + + ++++ +E 
Sbjct: 9  RLLEELEKGEKGMGPESCSYG----LADGDDISMTHWNGTILGPPHSSHENRIYSVVIEC 64

Query: 64 PIQYPLEPPRVKFLPGSRNNI-CHCNVDFKTGEI 96
            +YP  PP+V+F+  SR N+ C   VD  TGE+
Sbjct: 65 GAEYPDRPPKVRFI--SRINLPC---VDPSTGEV 93

>TPHA0J02250 Chr10 complement(501615..502017,502181..502191) [414
           bp, 137 aa] {ON} Anc_6.187 YGL087C
          Length = 137

 Score = 42.7 bits (99), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 33/123 (26%), Positives = 61/123 (49%), Gaps = 9/123 (7%)

Query: 5   RITKEFKSVRKTLA-EDPSYNHILKLEPKDTGNMYHWIADISGPPETPYASAVFALDVEL 63
           R+ +E +   K +  E  SY     L   D  +M +W   I GPP + +++ +++L +E 
Sbjct: 9   RLLEELEKGEKGMGPESCSYG----LADSDDISMTNWNGTILGPPHSNHSNRIYSLSIEC 64

Query: 64  PIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTREHWSPVWDLVHVIHAIWILL 123
              YP EPP +KF+  S+ N+ +C VD  TG +  D    ++W   + +  ++  +   +
Sbjct: 65  GPSYPDEPPTLKFI--SKINL-NC-VDSATGVVKPDFNPIKNWKRSYTMETILLELRKEM 120

Query: 124 GEP 126
             P
Sbjct: 121 AHP 123

>NCAS0E02600 Chr5 complement(519792..520559) [768 bp, 255 aa] {ON}
           Anc_7.392
          Length = 255

 Score = 43.9 bits (102), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 34/122 (27%), Positives = 60/122 (49%), Gaps = 20/122 (16%)

Query: 2   SLQRITKEFKSVRKTLAEDPSYNHILKLEPKDTGNMYHWIADISGPPETPYASAVFALDV 61
           +L+R+TKE+K     + E+P   +IL    +D  N+  W   I+GPP+TPY    +   +
Sbjct: 6   ALKRLTKEYK----LMVENPP-PYILARPNED--NILEWHYIITGPPDTPYKDGQYHGTL 58

Query: 62  ELPIQYPLEPPRVKFL-PGSRNNICHCNVDFKTG-EICLDILTR--EHWSPVWDLVHVIH 117
             P  YP +PP ++ + P  R         FK    +CL +     + W+P W +  +++
Sbjct: 59  TFPSDYPYKPPAIRMITPNGR---------FKENTRLCLSMSDYHPDLWNPGWSVNTILN 109

Query: 118 AI 119
            +
Sbjct: 110 GL 111

>TDEL0G01580 Chr7 (311978..311988,312055..312460) [417 bp, 138 aa]
           {ON} Anc_6.187 YGL087C
          Length = 138

 Score = 42.7 bits (99), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 33/111 (29%), Positives = 54/111 (48%), Gaps = 12/111 (10%)

Query: 5   RITKEFKSVRKTLA-EDPSYNHILKLEPKDTGNMYHWIADISGPPETPYASAVFALDVEL 63
           R+ +E +   K L  E  SY     L   D   M +W   I GPP + + + ++++ +E 
Sbjct: 9   RLLEELEKGEKGLGPESCSYG----LADSDDITMTNWNGTILGPPHSNHENRIYSVSIEC 64

Query: 64  PIQYPLEPPRVKFLPGSRNNI-CHCNVDFKTGEICLDIL-TREHWSPVWDL 112
              YP EPP++KF+  S+ N+ C   VD  TGE+   +  T   W   + +
Sbjct: 65  GPNYPDEPPKIKFV--SKVNVPC---VDSTTGEVKSSVFHTLRDWKRAYTM 110

>KLTH0H04796g Chr8 (428760..428770,428834..429239) [417 bp, 138 aa]
           {ON} highly similar to uniprot|P53152 Saccharomyces
           cerevisiae YGL087C MMS2 Protein involved in error-free
           postreplication DNA repair forms a heteromeric complex
           with Ubc13p that has a ubiquitin-conjugating activity
           cooperates with chromatin-associated RING finger
           proteins Rad18p and Rad5p
          Length = 138

 Score = 42.7 bits (99), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 55/109 (50%), Gaps = 16/109 (14%)

Query: 5   RITKEFKSVRKTLA-EDPSYNHILKLEPKDTGNMYHWIADISGPPETPYASAVFALDVEL 63
           R+ +E +   K +  E  SY     L   D   M HW   I GPP + + + ++++ +E 
Sbjct: 9   RLLEELEKGEKGMGPESCSYG----LAHSDDITMTHWNGTILGPPHSNHENRIYSVAIEC 64

Query: 64  PIQYPLEPPRVKFLPGSRNNI-CHCNVDFKTGEICLDILTREHWSPVWD 111
              YP +PP+++FL  S+ N+ C   VD  TGE+      +E +S + D
Sbjct: 65  GEAYPDQPPKIRFL--SKVNLPC---VDQNTGEV-----KKEQFSTLRD 103

>Suva_7.182 Chr7 complement(339292..339694,339786..339796) [414 bp,
           137 aa] {ON} YGL087C (REAL)
          Length = 137

 Score = 42.4 bits (98), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 46/100 (46%), Gaps = 6/100 (6%)

Query: 29  LEPKDTGNMYHWIADISGPPETPYASAVFALDVELPIQYPLEPPRVKFLPGSRNNI-CHC 87
           L   D   M  W   I GPP + + + +++L +E    YP  PP+V F+  S+ N+ C  
Sbjct: 30  LADSDDITMTKWNGTILGPPHSNHENRIYSLSIECGPNYPDSPPKVTFI--SKINLPC-- 85

Query: 88  NVDFKTGEICLDILTREHWSPVWDLVHVIHAIWILLGEPV 127
            V+  TGEI  D  T   W   + +  ++  +   +  P 
Sbjct: 86  -VNQTTGEIQTDFHTLRDWKRAYTMETLLLDLRKEMATPA 124

>KNAG0B02360 Chr2 complement(462478..463233) [756 bp, 251 aa] {ON}
           Anc_7.392 YER100W
          Length = 251

 Score = 43.5 bits (101), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 33/127 (25%), Positives = 58/127 (45%), Gaps = 20/127 (15%)

Query: 1   MSLQRITKEFKSVRKTLAEDPSYNHILKLEPKDTGNMYHWIADISGPPETPYASAVFALD 60
            +L+R+TKE+K +   +   P Y   +   P +  N+  W   I+GPPETPY    +   
Sbjct: 5   QALKRLTKEYKLI---VENPPPY---VTARPNE-DNILEWHYVITGPPETPYEGGQYHGT 57

Query: 61  VELPIQYPLEPPRVKFL-PGSRNNICHCNVDFKTG-EICLDILTR--EHWSPVWDLVHVI 116
           +  P  YP +PP ++ + P  R         FK    +CL +     + W+P W +  ++
Sbjct: 58  LTFPSDYPYKPPAIRMVTPNGR---------FKENTRLCLSMSDYHPDLWNPGWSVSTIL 108

Query: 117 HAIWILL 123
             +   +
Sbjct: 109 TGLLSFM 115

>ZYRO0B03344g Chr2 (278107..278859) [753 bp, 250 aa] {ON} similar to
           uniprot|P33296 Saccharomyces cerevisiae YER100W UBC6
           Ubiquitin-conjugating enzyme involved in ER- associated
           protein degradation located at the cytosolic side of the
           ER membrane tail region contains a transmembrane segment
           at the C-terminus substrate of the ubiquitin-proteasome
           pathway
          Length = 250

 Score = 43.5 bits (101), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 31/124 (25%), Positives = 58/124 (46%), Gaps = 20/124 (16%)

Query: 4   QRITKEFKSVRKTLAEDPSYNHILKLEPKDTGNMYHWIADISGPPETPYASAVFALDVEL 63
           +R+ KEFK+    + EDP     +   P ++ N+  W   I+GPP TPY +  +   +  
Sbjct: 8   KRLAKEFKA----MTEDPP--PYIMARPNES-NILDWHYIITGPPGTPYENGQYHGTLTF 60

Query: 64  PIQYPLEPPRVKFL-PGSRNNICHCNVDFKTGEICLDILTREH---WSPVWDLVHVIHAI 119
           P  YP +PP ++ + P  R          +   +CL  ++  H   W+P W +  +++ +
Sbjct: 61  PSDYPFQPPAIRMVTPSGRFQ--------ENTRLCLS-MSDYHPTTWNPGWSVSTILNGL 111

Query: 120 WILL 123
              +
Sbjct: 112 LSFM 115

>SAKL0A05192g Chr1 (468949..468959,469039..469450) [423 bp, 140 aa]
           {ON} highly similar to uniprot|P53152 Saccharomyces
           cerevisiae YGL087C MMS2 Protein involved in error-free
           postreplication DNA repair forms a heteromeric complex
           with Ubc13p that has a ubiquitin-conjugating activity
           cooperates with chromatin-associated RING finger
           proteins Rad18p and Rad5p
          Length = 140

 Score = 42.4 bits (98), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 36/126 (28%), Positives = 59/126 (46%), Gaps = 12/126 (9%)

Query: 5   RITKEFKSVRKTLA-EDPSYNHILKLEPKDTGNMYHWIADISGPPETPYASAVFALDVEL 63
           R+ +E +   K L  E  SY     L   D   M +W   I GPP + + + ++++ +E 
Sbjct: 11  RLLEELEKGEKGLGPESCSYG----LADGDDITMTNWNGTILGPPHSNHENRIYSVAIEC 66

Query: 64  PIQYPLEPPRVKFLPGSRNNI-CHCNVDFKTGEICLDIL-TREHWSPVWDLVHVIHAIWI 121
              YP EPP +KF+  S+ N+ C   VD  TGE+  D   T   W   + +  ++  +  
Sbjct: 67  GANYPDEPPLIKFV--SKINLPC---VDQTTGEVKHDQFHTLRDWKRSYTMETLLLDLRK 121

Query: 122 LLGEPV 127
            +G P 
Sbjct: 122 EMGTPT 127

>CAGL0I05478g Chr9 complement(518933..519673) [741 bp, 246 aa] {ON}
           highly similar to uniprot|P33296 Saccharomyces
           cerevisiae YER100w UBC6 E2 ubiquitin-conjugating enzyme
          Length = 246

 Score = 43.1 bits (100), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 32/124 (25%), Positives = 57/124 (45%), Gaps = 20/124 (16%)

Query: 4   QRITKEFKSVRKTLAEDPSYNHILKLEPKDTGNMYHWIADISGPPETPYASAVFALDVEL 63
           +R+TKE+K     + E+P    I +    +  N+  W   ISGPP+TPY    +   +  
Sbjct: 8   KRLTKEYK----MMVENPPPFIIAR---PNEENILEWHYVISGPPDTPYDGGQYHGTLTF 60

Query: 64  PIQYPLEPPRVKFL-PGSRNNICHCNVDFKTG-EICLDILTR--EHWSPVWDLVHVIHAI 119
           P  YP +PP ++ + P  R         FK    +CL +     + W+P W +  +++ +
Sbjct: 61  PSDYPYKPPAIRMITPNGR---------FKENTRLCLSMSDYHPDTWNPGWSVATILNGL 111

Query: 120 WILL 123
              +
Sbjct: 112 LSFM 115

>KAFR0C02140 Chr3 complement(427907..428312,428412..428422) [417
          bp, 138 aa] {ON} Anc_6.187 YGL087C
          Length = 138

 Score = 42.0 bits (97), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 39/65 (60%), Gaps = 6/65 (9%)

Query: 33 DTGNMYHWIADISGPPETPYASAVFALDVELPIQYPLEPPRVKFLPGSRNNI-CHCNVDF 91
          D   M +W   I GPP + + + +++L++     YP EPP+VKF+  S+ N+ C   +D 
Sbjct: 34 DDITMTNWNGTILGPPHSNHENRIYSLEIVCGPNYPDEPPKVKFV--SKVNLPC---IDD 88

Query: 92 KTGEI 96
          KTGEI
Sbjct: 89 KTGEI 93

>TPHA0K00820 Chr11 complement(172380..173153) [774 bp, 257 aa] {ON}
           Anc_7.392 YER100W
          Length = 257

 Score = 42.7 bits (99), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 30/124 (24%), Positives = 58/124 (46%), Gaps = 20/124 (16%)

Query: 4   QRITKEFKSVRKTLAEDPSYNHILKLEPKDTGNMYHWIADISGPPETPYASAVFALDVEL 63
           +R+TKE+K     + E+P+    +   P +  N+  W   I+GPP++PY    +   +  
Sbjct: 8   KRLTKEYK----MMNENPT--PFIMARPNE-ANILEWHYIINGPPDSPYFEGQYHGTLTF 60

Query: 64  PIQYPLEPPRVKFL-PGSRNNICHCNVDFKTG-EICLDILTR--EHWSPVWDLVHVIHAI 119
           P  YP +PP ++ + P  R         FK    +CL +     + W+P W +  +++ +
Sbjct: 61  PSDYPYKPPAIRMITPNGR---------FKENTRLCLSMSDYHPDTWNPGWSVATILNGL 111

Query: 120 WILL 123
              +
Sbjct: 112 LSFM 115

>KLTH0C06688g Chr3 complement(581697..582437) [741 bp, 246 aa] {ON}
           similar to uniprot|P33296 Saccharomyces cerevisiae
           YER100W UBC6 Ubiquitin-conjugating enzyme involved in
           ER- associated protein degradation located at the
           cytosolic side of the ER membrane tail region contains a
           transmembrane segment at the C-terminus substrate of the
           ubiquitin-proteasome pathway
          Length = 246

 Score = 42.7 bits (99), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 59/127 (46%), Gaps = 20/127 (15%)

Query: 1   MSLQRITKEFKSVRKTLAEDPSYNHILKLEPKDTGNMYHWIADISGPPETPYASAVFALD 60
            + +R+TKE+KS    + E+P     +  +P +  N+  W   I+GPP+TPY    +   
Sbjct: 5   QAQKRLTKEYKS----MVENPP--PFIIAQPNE-DNILEWHYVITGPPDTPYEGGQYHGT 57

Query: 61  VELPIQYPLEPPRVKFL-PGSRNNICHCNVDFKTG-EICLDILTR--EHWSPVWDLVHVI 116
           +  P  YP +PP ++ + P  R         FK    +CL +     + W+P W +  ++
Sbjct: 58  LVFPSDYPFKPPAIRMVTPSGR---------FKEDTRLCLSMSDYHPDTWNPSWSVSTIL 108

Query: 117 HAIWILL 123
             +   +
Sbjct: 109 TGLLSFM 115

>AGR372W Chr7 (1420314..1421042) [729 bp, 242 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YER100W (UBC6)
          Length = 242

 Score = 42.7 bits (99), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 30/126 (23%), Positives = 59/126 (46%), Gaps = 18/126 (14%)

Query: 1   MSLQRITKEFKSVRKTLAEDPSYNHILKLEPKDTGNMYHWIADISGPPETPYASAVFALD 60
            + +R++KE+K     + E+P   +I+    +D   ++H++  I+GPPETPY    +   
Sbjct: 5   QAYKRLSKEYK----MMTENPP-PYIVAAPKEDNILVWHYV--ITGPPETPYEDGQYHGT 57

Query: 61  VELPIQYPLEPPRVKFL-PGSRNNICHCNVDFKTGEICLDILTR--EHWSPVWDLVHVIH 117
           +  P  YP  PP ++ L P  R          +   +CL +     + W+P W +  ++ 
Sbjct: 58  LVFPNDYPFNPPAIRMLTPNGRFR--------ENTRLCLSMSDYHPDTWNPSWSVATILT 109

Query: 118 AIWILL 123
            +   +
Sbjct: 110 GLLSFM 115

>NCAS0A14390 Chr1 (2833944..2834666) [723 bp, 240 aa] {ON} Anc_7.392
           YER100W
          Length = 240

 Score = 42.7 bits (99), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 32/129 (24%), Positives = 62/129 (48%), Gaps = 30/129 (23%)

Query: 4   QRITKEFKSVRKT----LAEDPSYNHILKLEPKDTGNMYHWIADISGPPETPYASAVFAL 59
           +R++KE+K + +     +   P+ N+IL+         +H+I  I+GPP+TPY    +  
Sbjct: 8   KRLSKEYKLIIENPTPYILARPNENNILE---------WHYI--ITGPPDTPYVGGQYHG 56

Query: 60  DVELPIQYPLEPPRVKFL-PGSRNNICHCNVDFK-TGEICLDILTREH---WSPVWDLVH 114
            +  P  YP +PP ++ + P  R         FK    +CL  ++  H   W+P W +  
Sbjct: 57  TLTFPSDYPFKPPAIRMITPNGR---------FKENTRLCLS-MSDYHPDLWNPGWSVAT 106

Query: 115 VIHAIWILL 123
           +++ +   +
Sbjct: 107 ILNGLLSFM 115

>ZYRO0G08228g Chr7 complement(670807..671212,671271..671281) [417
           bp, 138 aa] {ON} similar to uniprot|P28263 Saccharomyces
           cerevisiae YEL012W UBC8 Ubiquitin-conjugating enzyme
           that negatively regulates gluconeogenesis by mediating
           the glucose-induced ubiquitination of fructose-1
           6-bisphosphatase (FBPase) cytoplasmic enzyme that
           catalyzes the ubiquitination of histones in vitro
          Length = 138

 Score = 41.6 bits (96), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 34/126 (26%), Positives = 58/126 (46%), Gaps = 12/126 (9%)

Query: 5   RITKEFKSVRKTLA-EDPSYNHILKLEPKDTGNMYHWIADISGPPETPYASAVFALDVEL 63
           R+ +E +   K L  E  SY     L   D  +M  W   I GPP + + + +++L +E 
Sbjct: 9   RLLEELEKGEKGLGPESCSYG----LADSDDISMTTWNGTILGPPHSNHENRIYSLSIEC 64

Query: 64  PIQYPLEPPRVKFLPGSRNNI-CHCNVDFKTGEICLDIL-TREHWSPVWDLVHVIHAIWI 121
              YP  PP +KF+  S+ N+ C   VD KTG++      T   W   +++  ++  +  
Sbjct: 65  GPNYPDHPPTIKFI--SKINLPC---VDSKTGQVTPSTFHTLRDWKRAYNMETILLELRK 119

Query: 122 LLGEPV 127
            +  P 
Sbjct: 120 EMATPA 125

>Kpol_1045.39 s1045 complement(92062..92823) [762 bp, 253 aa] {ON}
           complement(92064..92825) [762 nt, 254 aa]
          Length = 253

 Score = 42.4 bits (98), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 30/124 (24%), Positives = 58/124 (46%), Gaps = 20/124 (16%)

Query: 4   QRITKEFKSVRKTLAEDPSYNHILKLEPKDTGNMYHWIADISGPPETPYASAVFALDVEL 63
           +R+TKE+K     + E+P+   I +    +  N+  W   I+GPP++PY    +   +  
Sbjct: 8   KRLTKEYK----MMMENPTPYIIAR---PNESNILEWHYVITGPPDSPYHDGQYHGTLTF 60

Query: 64  PIQYPLEPPRVKFL-PGSRNNICHCNVDFKTG-EICLDILTR--EHWSPVWDLVHVIHAI 119
           P  YP +PP ++ + P  R         FK    +CL +     + W+P W +  +++ +
Sbjct: 61  PSDYPYKPPAIRMVTPNGR---------FKENTRLCLSMSDYHPDTWNPGWSVATILNGL 111

Query: 120 WILL 123
              +
Sbjct: 112 LSFM 115

>Smik_7.196 Chr7 complement(340809..341111) [303 bp, 100 aa] {ON}
           YGL087C (REAL)
          Length = 100

 Score = 40.8 bits (94), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 39/77 (50%), Gaps = 6/77 (7%)

Query: 37  MYHWIADISGPPETPYASAVFALDVELPIQYPLEPPRVKFLPGSRNNI-CHCNVDFKTGE 95
           M  W   I GPP + + + +++L +E    YP  PP+V F+  S+ N+ C   V+  TGE
Sbjct: 1   MTKWNGTILGPPHSNHENRIYSLSIECGPNYPDSPPKVTFI--SKINLPC---VNPTTGE 55

Query: 96  ICLDILTREHWSPVWDL 112
           +  D  T   W   + +
Sbjct: 56  VQTDFHTLRGWKRAYTM 72

>NDAI0A01650 Chr1 complement(365515..366270) [756 bp, 251 aa] {ON}
           Anc_7.392
          Length = 251

 Score = 42.0 bits (97), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 33/124 (26%), Positives = 57/124 (45%), Gaps = 20/124 (16%)

Query: 4   QRITKEFKSVRKTLAEDPSYNHILKLEPKDTGNMYHWIADISGPPETPYASAVFALDVEL 63
           +R+TKE+K     L  + S   IL    +D  N+  W   I+GPP+TPY    +   +  
Sbjct: 8   KRLTKEYK-----LLVESSPPFILARPNED--NILEWHYIITGPPDTPYDGGQYHGTLTF 60

Query: 64  PIQYPLEPPRVKFL-PGSRNNICHCNVDFKTG-EICLDILTR--EHWSPVWDLVHVIHAI 119
           P  YP +PP ++ + P  R         FK    +CL +     + W+P W +  +++ +
Sbjct: 61  PNDYPYKPPAIRMITPNGR---------FKENTRLCLSMSDYHPDTWNPGWSVSTILNGL 111

Query: 120 WILL 123
              +
Sbjct: 112 LSFM 115

>Skud_5.225 Chr5 (355576..356328) [753 bp, 250 aa] {ON} YER100W
           (REAL)
          Length = 250

 Score = 41.6 bits (96), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 33/124 (26%), Positives = 58/124 (46%), Gaps = 20/124 (16%)

Query: 4   QRITKEFKSVRKTLAEDPSYNHILKLEPKDTGNMYHWIADISGPPETPYASAVFALDVEL 63
           +R+TKE+K     + E+P   +IL    +D  N+  W   I+GP ETPY    +   +  
Sbjct: 8   KRLTKEYK----LMVENPP-PYILARPNED--NILEWHYIITGPAETPYKGGQYHGTLTF 60

Query: 64  PIQYPLEPPRVKFL-PGSRNNICHCNVDFK-TGEICLDILTR--EHWSPVWDLVHVIHAI 119
           P  YP +PP ++ + P  R         FK    +CL +     + W+P W +  +++ +
Sbjct: 61  PSDYPYKPPAIRMVTPNGR---------FKPNTRLCLSMSDYHPDTWNPGWSVSTILNGL 111

Query: 120 WILL 123
              +
Sbjct: 112 LSFM 115

>KAFR0L01750 Chr12 (320295..321050) [756 bp, 251 aa] {ON} Anc_7.392
           YER100W
          Length = 251

 Score = 41.6 bits (96), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 33/127 (25%), Positives = 61/127 (48%), Gaps = 20/127 (15%)

Query: 1   MSLQRITKEFKSVRKTLAEDPSYNHILKLEPKDTGNMYHWIADISGPPETPYASAVFALD 60
            +L+R+TKE+K +     E+P   +I+    +D  N+  W   I+GP +TPY+S  +   
Sbjct: 5   QALKRLTKEYKLI----VENPP-PYIVARPNED--NILEWHYVITGPSDTPYSSGQYHGT 57

Query: 61  VELPIQYPLEPPRVKFL-PGSRNNICHCNVDFKTG-EICLDILTR--EHWSPVWDLVHVI 116
           +  P  YP +PP ++ + P  R         FK    +CL +     + W+P W +  ++
Sbjct: 58  LTFPSDYPYKPPAIRMITPNGR---------FKENTRLCLSMSDYHPDLWNPGWSVSTIL 108

Query: 117 HAIWILL 123
             +   +
Sbjct: 109 TGLLSFM 115

>CAGL0H03157g Chr8 complement(297272..297680,297881..297891) [420
           bp, 139 aa] {ON} highly similar to uniprot|P53152
           Saccharomyces cerevisiae YGL087c MMS2 part of the
           error-free postreplication repair pathway
          Length = 139

 Score = 40.4 bits (93), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 33/126 (26%), Positives = 60/126 (47%), Gaps = 12/126 (9%)

Query: 5   RITKEFKSVRKTLA-EDPSYNHILKLEPKDTGNMYHWIADISGPPETPYASAVFALDVEL 63
           R+ +E +   K L  E  SY     L   D   M  W   I GPP + + + ++++ +E 
Sbjct: 9   RLLEELEKGEKGLGPESCSYG----LADADDITMTRWNGTILGPPHSNHENRIYSVSIEC 64

Query: 64  PIQYPLEPPRVKFLPGSRNNI-CHCNVDFKTGEICLDIL-TREHWSPVWDLVHVIHAIWI 121
             +YP EPP + F+  S+ N+ C   VD  TGE+  +   T + W  ++++  ++  +  
Sbjct: 65  GPKYPDEPPTITFI--SKINLPC---VDQSTGEVNKEKFNTLKDWKRLYNMETILLDLRK 119

Query: 122 LLGEPV 127
            +  P 
Sbjct: 120 EMASPA 125

>KLLA0E19119g Chr5 complement(1702717..1703125,1703226..1703236)
           [420 bp, 139 aa] {ON} highly similar to uniprot|P53152
           Saccharomyces cerevisiae YGL087C MMS2 Protein involved
           in error-free postreplication DNA repair forms a
           heteromeric complex with Ubc13p that has a
           ubiquitin-conjugating activity cooperates with
           chromatin-associated RING finger proteins Rad18p and
           Rad5p
          Length = 139

 Score = 40.0 bits (92), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 35/125 (28%), Positives = 59/125 (47%), Gaps = 12/125 (9%)

Query: 5   RITKEFKSVRKTLA-EDPSYNHILKLEPKDTGNMYHWIADISGPPETPYASAVFALDVEL 63
           R+ +E +   K L  E  SY     L   D   M  W   I GPP + + + ++++ +E 
Sbjct: 9   RLLEELEKGEKGLGPESCSYG----LSDSDDITMTKWNGTILGPPHSNHENRIYSVLIEC 64

Query: 64  PIQYPLEPPRVKFLPGSRNNI-CHCNVDFKTGEICLDIL-TREHWSPVWDLVHVIHAIWI 121
              YP EPP+VKF+  S+ N+ C   V+  TGE+  +   T + W   + +  V+  +  
Sbjct: 65  GPSYPDEPPKVKFV--SKINLPC---VNSTTGEVVKEKFHTLKEWKRSYTMETVLLELRK 119

Query: 122 LLGEP 126
            +  P
Sbjct: 120 EMATP 124

>Suva_5.219 Chr5 (333753..334502) [750 bp, 249 aa] {ON} YER100W
           (REAL)
          Length = 249

 Score = 40.8 bits (94), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 32/124 (25%), Positives = 59/124 (47%), Gaps = 20/124 (16%)

Query: 4   QRITKEFKSVRKTLAEDPSYNHILKLEPKDTGNMYHWIADISGPPETPYASAVFALDVEL 63
           +R+TKE+K     + E+P   +IL    +D  N+  W   I+GP +TPY +  +   +  
Sbjct: 8   KRLTKEYK----LMVENPP-PYILARPNED--NILEWHYIITGPADTPYKAGQYHGTLTF 60

Query: 64  PIQYPLEPPRVKFL-PGSRNNICHCNVDFK-TGEICLDILTR--EHWSPVWDLVHVIHAI 119
           P  YP +PP ++ + P  R         FK    +CL +     + W+P W +  +++ +
Sbjct: 61  PSDYPYKPPAIRMITPNGR---------FKPNTRLCLSMSDYHPDTWNPGWSVSTILNGL 111

Query: 120 WILL 123
              +
Sbjct: 112 LSFM 115

>Kwal_27.10837 s27 complement(519750..520490) [741 bp, 246 aa] {ON}
           YER100W (UBC6) - ubiquitin-conjugating enzyme [contig
           33] FULL
          Length = 246

 Score = 40.8 bits (94), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 31/120 (25%), Positives = 57/120 (47%), Gaps = 20/120 (16%)

Query: 4   QRITKEFKSVRKTLAEDPSYNHILKLEPKDTGNMYHWIADISGPPETPYASAVFALDVEL 63
           +R++KE+KS    + E+P     +  +P +  N+  W   I+GPP+TPY    +   +  
Sbjct: 8   KRLSKEYKS----MVENPP--PFIIAQPNE-DNVLEWHYVITGPPDTPYMGGQYHGTLVF 60

Query: 64  PIQYPLEPPRVKFL-PGSRNNICHCNVDFKTG-EICLDILTR--EHWSPVWDLVHVIHAI 119
           P  YP +PP ++ + P  R         FK    +CL +     + W+P W +  ++  +
Sbjct: 61  PSDYPFKPPAIRMVTPSGR---------FKEDTRLCLSMSDYHPDTWNPSWSVSTILTGL 111

>YGL087C Chr7 complement(346406..346808,346894..346904) [414 bp, 137
           aa] {ON}  MMS2Ubiquitin-conjugating enzyme variant
           involved in error-free postreplication repair; forms a
           heteromeric complex with Ubc13p, an active
           ubiquitin-conjugating enzyme; cooperates with
           chromatin-associated RING finger proteins, Rad18p and
           Rad5p
          Length = 137

 Score = 39.7 bits (91), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 26/100 (26%), Positives = 46/100 (46%), Gaps = 6/100 (6%)

Query: 29  LEPKDTGNMYHWIADISGPPETPYASAVFALDVELPIQYPLEPPRVKFLPGSRNNI-CHC 87
           L   D   M  W   I GPP + + + +++L ++    YP  PP+V F+  S+ N+ C  
Sbjct: 30  LADSDDITMTKWNGTILGPPHSNHENRIYSLSIDCGPNYPDSPPKVTFI--SKINLPC-- 85

Query: 88  NVDFKTGEICLDILTREHWSPVWDLVHVIHAIWILLGEPV 127
            V+  TGE+  D  T   W   + +  ++  +   +  P 
Sbjct: 86  -VNPTTGEVQTDFHTLRDWKRAYTMETLLLDLRKEMATPA 124

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.140    0.446 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 19,162,158
Number of extensions: 838733
Number of successful extensions: 2046
Number of sequences better than 10.0: 265
Number of HSP's gapped: 1761
Number of HSP's successfully gapped: 265
Length of query: 161
Length of database: 53,481,399
Length adjustment: 101
Effective length of query: 60
Effective length of database: 41,900,133
Effective search space: 2514007980
Effective search space used: 2514007980
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 61 (28.1 bits)