Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0F02684gna 1ON1381387241e-100
SAKL0F02640gsingletonON1161114842e-63
KLLA0E04005gna 1ON1371384697e-61
KLTH0F14916gna 1ON1511384663e-60
Kwal_55.21247na 1ON1341284351e-55
ZYRO0C18436gsingletonON1291284228e-54
SAKL0F16654gsingletonON1311293975e-50
KLLA0B14817gsingletonON1311293976e-50
Kwal_23.2807singletonON1291283863e-48
TDEL0D00210singletonON1301323766e-47
KLTH0C11880gsingletonON1311293654e-45
ZYRO0D09856gna 1ON1561253283e-39
KLTH0E03168gsingletonON1481272762e-31
Kwal_47.16590singletonON1261272724e-31
ZYRO0C08074g7.238ON1431321631e-14
TBLA0D040907.238ON1551251562e-13
KAFR0L008607.238ON1281281543e-13
Suva_5.1657.238ON129981455e-12
YER057C (HMF1)7.238ON129981449e-12
Smik_9.1397.238ON1451181431e-11
Skud_9.1187.238ON1451211431e-11
TDEL0H020607.238ON1771341432e-11
YIL051C (MMF1)7.238ON1451171413e-11
Skud_5.1717.238ON129981394e-11
ADL077C7.238ON1421281395e-11
KAFR0I018307.238ON1431171396e-11
NDAI0A025507.238ON1441171387e-11
Smik_5.1877.238ON129981351e-10
NCAS0A134907.238ON1481171343e-10
TBLA0J014207.238ON1261281282e-09
Suva_9.1487.238ON1451211282e-09
Kpol_1033.127.238ON1431181283e-09
NCAS0E032407.238ON1281181263e-09
CAGL0M12386g7.238ON1421021256e-09
NDAI0E047507.238ON1281211247e-09
TPHA0K009207.238ON1281211238e-09
Kwal_23.58047.238ON141981249e-09
Kpol_1009.257.238ON127991212e-08
TPHA0C011007.238ON1421171203e-08
KNAG0L014507.238ON131981184e-08
KNAG0D016207.238ON1421201179e-08
KLLA0C08349g7.238ON1401321151e-07
SAKL0F08558g7.238ON1441321152e-07
KLTH0A04224g7.238ON141981117e-07
TDEL0F047308.349ON69485880.003
AGL164W8.349ON68688790.040
Kpol_1036.868.349ON69770750.12
TPHA0G011308.790ON27975671.4
ZYRO0F14014g8.349ON66966661.7
SAKL0H14938g8.349ON69194643.3
KAFR0H021508.349ON70244625.9
TDEL0B046308.148ON16264616.6
KLTH0B09064g5.37ON24483618.2
Smik_15.4338.690ON44546619.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0F02684g
         (138 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0F02684g Chr6 complement(228156..228572) [417 bp, 138 aa] {O...   283   e-100
SAKL0F02640g Chr6 complement(227067..227417) [351 bp, 116 aa] {O...   191   2e-63
KLLA0E04005g Chr5 complement(364475..364888) [414 bp, 137 aa] {O...   185   7e-61
KLTH0F14916g Chr6 (1220286..1220741) [456 bp, 151 aa] {ON} weakl...   184   3e-60
Kwal_55.21247 s55 (747831..748235) [405 bp, 134 aa] {ON} YER057C...   172   1e-55
ZYRO0C18436g Chr3 complement(1444072..1444461) [390 bp, 129 aa] ...   167   8e-54
SAKL0F16654g Chr6 (1378394..1378789) [396 bp, 131 aa] {ON} weakl...   157   5e-50
KLLA0B14817g Chr2 (1301705..1302100) [396 bp, 131 aa] {ON} weakl...   157   6e-50
Kwal_23.2807 s23 (20785..21174) [390 bp, 129 aa] {ON} YER057C (H...   153   3e-48
TDEL0D00210 Chr4 (34669..35061) [393 bp, 130 aa] {ON}                 149   6e-47
KLTH0C11880g Chr3 complement(982966..983361) [396 bp, 131 aa] {O...   145   4e-45
ZYRO0D09856g Chr4 complement(834023..834493) [471 bp, 156 aa] {O...   130   3e-39
KLTH0E03168g Chr5 complement(285658..286104) [447 bp, 148 aa] {O...   110   2e-31
Kwal_47.16590 s47 complement(15715..16095) [381 bp, 126 aa] {ON}...   109   4e-31
ZYRO0C08074g Chr3 complement(619866..620297) [432 bp, 143 aa] {O...    67   1e-14
TBLA0D04090 Chr4 (1016159..1016626) [468 bp, 155 aa] {ON} Anc_7....    65   2e-13
KAFR0L00860 Chr12 complement(161978..162364) [387 bp, 128 aa] {O...    64   3e-13
Suva_5.165 Chr5 complement(246850..247239) [390 bp, 129 aa] {ON}...    60   5e-12
YER057C Chr5 complement(270737..271126) [390 bp, 129 aa] {ON}  H...    60   9e-12
Smik_9.139 Chr9 complement(231954..232391) [438 bp, 145 aa] {ON}...    60   1e-11
Skud_9.118 Chr9 complement(226723..227160) [438 bp, 145 aa] {ON}...    60   1e-11
TDEL0H02060 Chr8 (350315..350848) [534 bp, 177 aa] {ON} Anc_7.23...    60   2e-11
YIL051C Chr9 complement(257843..258280) [438 bp, 145 aa] {ON}  M...    59   3e-11
Skud_5.171 Chr5 complement(266894..267283) [390 bp, 129 aa] {ON}...    58   4e-11
ADL077C Chr4 complement(549523..549951) [429 bp, 142 aa] {ON} Sy...    58   5e-11
KAFR0I01830 Chr9 complement(375688..376119) [432 bp, 143 aa] {ON...    58   6e-11
NDAI0A02550 Chr1 complement(570003..570437) [435 bp, 144 aa] {ON...    58   7e-11
Smik_5.187 Chr5 complement(274856..275245) [390 bp, 129 aa] {ON}...    57   1e-10
NCAS0A13490 Chr1 (2655822..2656268) [447 bp, 148 aa] {ON} Anc_7....    56   3e-10
TBLA0J01420 Chr10 (325885..326265) [381 bp, 126 aa] {ON} Anc_7.2...    54   2e-09
Suva_9.148 Chr9 complement(246539..246976) [438 bp, 145 aa] {ON}...    54   2e-09
Kpol_1033.12 s1033 complement(28172..28603) [432 bp, 143 aa] {ON...    54   3e-09
NCAS0E03240 Chr5 (641701..642087) [387 bp, 128 aa] {ON} Anc_7.238      53   3e-09
CAGL0M12386g Chr13 (1236543..1236971) [429 bp, 142 aa] {ON} simi...    53   6e-09
NDAI0E04750 Chr5 complement(1071393..1071779) [387 bp, 128 aa] {...    52   7e-09
TPHA0K00920 Chr11 (190389..190775) [387 bp, 128 aa] {ON} Anc_7.2...    52   8e-09
Kwal_23.5804 s23 complement(1324907..1325332) [426 bp, 141 aa] {...    52   9e-09
Kpol_1009.25 s1009 complement(58847..59230) [384 bp, 127 aa] {ON...    51   2e-08
TPHA0C01100 Chr3 (250318..250746) [429 bp, 142 aa] {ON} Anc_7.23...    51   3e-08
KNAG0L01450 Chr12 complement(258500..258895) [396 bp, 131 aa] {O...    50   4e-08
KNAG0D01620 Chr4 complement(272653..273081) [429 bp, 142 aa] {ON...    50   9e-08
KLLA0C08349g Chr3 (731629..732051) [423 bp, 140 aa] {ON} similar...    49   1e-07
SAKL0F08558g Chr6 complement(654765..655199) [435 bp, 144 aa] {O...    49   2e-07
KLTH0A04224g Chr1 complement(356660..357085) [426 bp, 141 aa] {O...    47   7e-07
TDEL0F04730 Chr6 (889641..891725) [2085 bp, 694 aa] {ON} Anc_8.3...    39   0.003
AGL164W Chr7 (388842..390902) [2061 bp, 686 aa] {ON} Syntenic ho...    35   0.040
Kpol_1036.86 s1036 (225185..227278) [2094 bp, 697 aa] {ON} (2251...    33   0.12 
TPHA0G01130 Chr7 (229626..230465) [840 bp, 279 aa] {ON} Anc_8.79...    30   1.4  
ZYRO0F14014g Chr6 (1151774..1153783) [2010 bp, 669 aa] {ON} simi...    30   1.7  
SAKL0H14938g Chr8 complement(1295178..1297253) [2076 bp, 691 aa]...    29   3.3  
KAFR0H02150 Chr8 complement(406617..408725) [2109 bp, 702 aa] {O...    28   5.9  
TDEL0B04630 Chr2 complement(824601..825089) [489 bp, 162 aa] {ON...    28   6.6  
KLTH0B09064g Chr2 complement(738472..739206) [735 bp, 244 aa] {O...    28   8.2  
Smik_15.433 Chr15 complement(750651..751988) [1338 bp, 445 aa] {...    28   9.4  

>SAKL0F02684g Chr6 complement(228156..228572) [417 bp, 138 aa] {ON}
           conserved hypothetical protein
          Length = 138

 Score =  283 bits (724), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 138/138 (100%), Positives = 138/138 (100%)

Query: 1   MPTKTTWKDIGAPEASALLSPAFVTTSNTPLVYTSGCVGTDPKTGELPEDLEQQTRNAIE 60
           MPTKTTWKDIGAPEASALLSPAFVTTSNTPLVYTSGCVGTDPKTGELPEDLEQQTRNAIE
Sbjct: 1   MPTKTTWKDIGAPEASALLSPAFVTTSNTPLVYTSGCVGTDPKTGELPEDLEQQTRNAIE 60

Query: 61  NLRIVLSKSGCSSLDQVVKVLLFVADGKYAPVVNKVYKEYFTNQPCRSCVVVGFPNEKIK 120
           NLRIVLSKSGCSSLDQVVKVLLFVADGKYAPVVNKVYKEYFTNQPCRSCVVVGFPNEKIK
Sbjct: 61  NLRIVLSKSGCSSLDQVVKVLLFVADGKYAPVVNKVYKEYFTNQPCRSCVVVGFPNEKIK 120

Query: 121 VELECVAEIDKKTRWFKL 138
           VELECVAEIDKKTRWFKL
Sbjct: 121 VELECVAEIDKKTRWFKL 138

>SAKL0F02640g Chr6 complement(227067..227417) [351 bp, 116 aa] {ON}
           some similarities with uniprot|P40037 Saccharomyces
           cerevisiae YER057C HMF1 Member of the p14.5 protein
           family with similarity to Mmf1p, functionally
           complements Mmf1p function when targeted to mitochondria
          Length = 116

 Score =  191 bits (484), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 91/111 (81%), Positives = 99/111 (89%)

Query: 18  LLSPAFVTTSNTPLVYTSGCVGTDPKTGELPEDLEQQTRNAIENLRIVLSKSGCSSLDQV 77
           + S AF++TSNTPLVYTSGCVGTDPKTGELPEDLEQQTRNAIENLRIVLSKSGCSSLDQV
Sbjct: 1   MFSSAFISTSNTPLVYTSGCVGTDPKTGELPEDLEQQTRNAIENLRIVLSKSGCSSLDQV 60

Query: 78  VKVLLFVADGKYAPVVNKVYKEYFTNQPCRSCVVVGFPNEKIKVELECVAE 128
           VKVLLFVADGKY PV NKVYK+YFTN+ C+S  VVGF NE IK+E   VA+
Sbjct: 61  VKVLLFVADGKYVPVANKVYKDYFTNRSCKSSAVVGFTNEGIKIEPGSVAK 111

>KLLA0E04005g Chr5 complement(364475..364888) [414 bp, 137 aa] {ON}
           weakly similar to uniprot|P40185 Saccharomyces
           cerevisiae YIL051C MMF1 Mitochondrial protein involved
           in maintenance of the mitochondrial genome and weakly
           similar to YER057C uniprot|P40037 Saccharomyces
           cerevisiae YER057C HMF1 Member of the p14.5 protein
           family with similarity to Mmf1p, functionally
           complements Mmf1p function when targeted to
           mitochondria; heat shock inducible; high- dosage growth
           inhibitor; forms a homotrimer in vitro
          Length = 137

 Score =  185 bits (469), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 87/138 (63%), Positives = 106/138 (76%), Gaps = 1/138 (0%)

Query: 1   MPTKTTWKDIGAPEASALLSPAFVTTSNTPLVYTSGCVGTDPKTGELPEDLEQQTRNAIE 60
           M  K TWKD+G  +   L+SP F T S   L+++SGCVGTDP T ELPEDLEQQ RN++ 
Sbjct: 1   MARKITWKDVGVKDGFPLISPGFATESGNQLLFSSGCVGTDPVTNELPEDLEQQARNSMI 60

Query: 61  NLRIVLSKSGCSSLDQVVKVLLFVADGKYAPVVNKVYKEYFTNQPCRSCVVVGFPNEKIK 120
           NL+ VL  SG SS+D V+K+LLFV+DG YA +VNKV+KE+F NQP RSC+VV FPN K+K
Sbjct: 61  NLKKVLEVSG-SSVDSVLKILLFVSDGSYAGIVNKVFKEFFPNQPARSCIVVAFPNNKLK 119

Query: 121 VELECVAEIDKKTRWFKL 138
           VELEC+AEI  K RWFKL
Sbjct: 120 VELECIAEIPSKKRWFKL 137

>KLTH0F14916g Chr6 (1220286..1220741) [456 bp, 151 aa] {ON} weakly
           similar to uniprot|P40185 Saccharomyces cerevisiae
           YIL051C MMF1 Mitochondrial protein involved in
           maintenance of the mitochondrial genome and weakly
           similar to YER057C uniprot|P40037 Saccharomyces
           cerevisiae YER057C HMF1 Member of the p14.5 protein
           family with similarity to Mmf1p, functionally
           complements Mmf1p function when targeted to
           mitochondria; heat shock inducible; high- dosage growth
           inhibitor; forms a homotrimer in vitro
          Length = 151

 Score =  184 bits (466), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 89/138 (64%), Positives = 108/138 (78%), Gaps = 2/138 (1%)

Query: 1   MPTKTTWKDIGAPEASALLSPAFVTTSNTPLVYTSGCVGTDPKTGELPEDLEQQTRNAIE 60
           M  K TW+++GA +   LLSPAFVT S + LV+TSGC+G+DP T ELPEDLEQQ RNA++
Sbjct: 16  MAKKVTWQEVGATKGIDLLSPAFVT-SGSKLVFTSGCIGSDPVTDELPEDLEQQARNALQ 74

Query: 61  NLRIVLSKSGCSSLDQVVKVLLFVADGKYAPVVNKVYKEYFTNQPCRSCVVVGFPNEKIK 120
           NLR VL  SG +S D+V+KVLLFVADG Y+  VN++Y+E F N P RSCVVV FPN KIK
Sbjct: 75  NLRNVLEASGSNS-DRVLKVLLFVADGAYSQTVNRIYREQFPNSPARSCVVVSFPNPKIK 133

Query: 121 VELECVAEIDKKTRWFKL 138
           VELEC+AE+  K RWFKL
Sbjct: 134 VELECIAEVQPKARWFKL 151

>Kwal_55.21247 s55 (747831..748235) [405 bp, 134 aa] {ON} YER057C
           (HMF1) - heat-regulated protein [contig 130] FULL
          Length = 134

 Score =  172 bits (435), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 84/128 (65%), Positives = 101/128 (78%), Gaps = 2/128 (1%)

Query: 1   MPTKTTWKDIGAPEASALLSPAFVTTSNTPLVYTSGCVGTDPKTGELPEDLEQQTRNAIE 60
           M  + TWK++G  +   +L+PA+VT SN+ LV+TSGCVGTDP TGELP DLEQQ RNA+E
Sbjct: 1   MARQVTWKEVGPGKGYPILAPAYVT-SNSDLVFTSGCVGTDPVTGELPTDLEQQVRNALE 59

Query: 61  NLRIVLSKSGCSSLDQVVKVLLFVADGKYAPVVNKVYKEYFTNQPCRSCVVVGFPNEKIK 120
           NL+ VL  SG SSL+QV+KVLLFV+DG YAP VNKVY EYF   P RSC+VV FPN  +K
Sbjct: 60  NLKNVLRASG-SSLEQVIKVLLFVSDGSYAPAVNKVYSEYFPGAPARSCIVVSFPNASLK 118

Query: 121 VELECVAE 128
           VELEC+AE
Sbjct: 119 VELECIAE 126

>ZYRO0C18436g Chr3 complement(1444072..1444461) [390 bp, 129 aa]
           {ON} similar to uniprot|P40037 Saccharomyces cerevisiae
           YER057C
          Length = 129

 Score =  167 bits (422), Expect = 8e-54,   Method: Compositional matrix adjust.
 Identities = 80/128 (62%), Positives = 99/128 (77%), Gaps = 1/128 (0%)

Query: 1   MPTKTTWKDIGAPEASALLSPAFVTTSNTPLVYTSGCVGTDPKTGELPEDLEQQTRNAIE 60
           MPT+ TW  +G    S+LLSPA+VT     LV+TSGCVGTDPKTG L E+L+QQ RNA+E
Sbjct: 1   MPTQITWNQVGPLGGSSLLSPAYVTADAKKLVFTSGCVGTDPKTGTLAEELDQQVRNALE 60

Query: 61  NLRIVLSKSGCSSLDQVVKVLLFVADGKYAPVVNKVYKEYFTNQPCRSCVVVGFPNEKIK 120
           NL+ VL  SG SS+D V+KVLLFVADG +A  VNK+Y+EYF   P RSC+VV FP+ K+K
Sbjct: 61  NLKNVLKASG-SSIDNVLKVLLFVADGSFAAPVNKIYQEYFPGAPARSCIVVSFPDPKLK 119

Query: 121 VELECVAE 128
           VELEC+A+
Sbjct: 120 VELECIAQ 127

>SAKL0F16654g Chr6 (1378394..1378789) [396 bp, 131 aa] {ON} weakly
           similar to uniprot|P40037 Saccharomyces cerevisiae
           YER057C HMF1
          Length = 131

 Score =  157 bits (397), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 73/129 (56%), Positives = 95/129 (73%), Gaps = 1/129 (0%)

Query: 1   MPTKTTWKDIGAPEASALLSPAFVTTSNTPLVYTSGCVGTDPKTGELPEDLEQQTRNAIE 60
           M  K  W  +G     ALLSP F+ + +  +++TSG VGTDPK+GE+PEDL  QT+NA+E
Sbjct: 1   MARKIEWNQVGVTSGHALLSPGFICSKDEDILFTSGNVGTDPKSGEVPEDLRAQTKNALE 60

Query: 61  NLRIVLSKSGCSSLDQVVKVLLFVADGKYAPVVNKVYKEYFTNQPCRSCVVVGFPNEKIK 120
           NL+  L ++G SSLD V+KVLLFVADG YA  VN+VYKEYF   P RSC+VV FP+ K+K
Sbjct: 61  NLKTTL-EAGGSSLDNVLKVLLFVADGSYAATVNEVYKEYFPGSPARSCIVVSFPDPKLK 119

Query: 121 VELECVAEI 129
           +ELEC+A +
Sbjct: 120 LELECIAAV 128

>KLLA0B14817g Chr2 (1301705..1302100) [396 bp, 131 aa] {ON} weakly
           similar to uniprot|P40185 Saccharomyces cerevisiae
           YIL051C MMF1 Mitochondrial protein involved in
           maintenance of the mitochondrial genome and weakly
           similar to YER057C uniprot|P40037 Saccharomyces
           cerevisiae YER057C HMF1 Member of the p14.5 protein
           family with similarity to Mmf1p, functionally
           complements Mmf1p function when targeted to
           mitochondria; heat shock inducible; high- dosage growth
           inhibitor; forms a homotrimer in vitro
          Length = 131

 Score =  157 bits (397), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 75/129 (58%), Positives = 95/129 (73%), Gaps = 1/129 (0%)

Query: 1   MPTKTTWKDIGAPEASALLSPAFVTTSNTPLVYTSGCVGTDPKTGELPEDLEQQTRNAIE 60
           M  +  WK++G       L+PA+VT+ +T LVYTSGCVG+D  TGE+PEDLE+Q RNA++
Sbjct: 1   MVRRVEWKEVGVESGPTFLAPAYVTSKDTELVYTSGCVGSDLLTGEIPEDLEKQVRNALD 60

Query: 61  NLRIVLSKSGCSSLDQVVKVLLFVADGKYAPVVNKVYKEYFTNQPCRSCVVVGFPNEKIK 120
           NL  VL K+  SS D V+K+LLFVADG YA  VN VYKEYF  +P RSC+VV FP+  +K
Sbjct: 61  NLGRVL-KASNSSFDDVLKILLFVADGSYASTVNAVYKEYFPERPARSCIVVSFPDPTLK 119

Query: 121 VELECVAEI 129
           VELECVA +
Sbjct: 120 VELECVAAV 128

>Kwal_23.2807 s23 (20785..21174) [390 bp, 129 aa] {ON} YER057C
           (HMF1) - heat-regulated protein [contig 246] FULL
          Length = 129

 Score =  153 bits (386), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 74/128 (57%), Positives = 92/128 (71%), Gaps = 1/128 (0%)

Query: 1   MPTKTTWKDIGAPEASALLSPAFVTTSNTPLVYTSGCVGTDPKTGELPEDLEQQTRNAIE 60
           M  +  W  +G  +   +LSPA+V + +  LV+TSGCVGTDP TG LPEDLEQQ  NA+E
Sbjct: 1   MAKQVQWSAVGPGKGYDILSPAYVASKSNDLVFTSGCVGTDPVTGNLPEDLEQQIINALE 60

Query: 61  NLRIVLSKSGCSSLDQVVKVLLFVADGKYAPVVNKVYKEYFTNQPCRSCVVVGFPNEKIK 120
           NL+ VL  SG SSL++V+KVLLFV+D  YA  VN+VY  YF N P RSC+VV FP   +K
Sbjct: 61  NLKNVLHASG-SSLERVLKVLLFVSDASYASTVNEVYSRYFPNAPARSCIVVAFPAPALK 119

Query: 121 VELECVAE 128
           VELEC+AE
Sbjct: 120 VELECIAE 127

>TDEL0D00210 Chr4 (34669..35061) [393 bp, 130 aa] {ON} 
          Length = 130

 Score =  149 bits (376), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 76/132 (57%), Positives = 98/132 (74%), Gaps = 3/132 (2%)

Query: 1   MPTKTTWKDIGAPEASALLSPAFVTTSNTPLVYTSGCVGTDPKTGELPEDLEQQTRNAIE 60
           M T+  W+D+  P  S LLSP +VT  N+ L++TSGCVGTD K+G+L E +E QT+ A+E
Sbjct: 1   MATQIQWEDVNGPSHS-LLSPGYVTAKNSQLLFTSGCVGTD-KSGKLAEGVEAQTKLALE 58

Query: 61  NLRIVLSKSGCSSLDQVVKVLLFVADGKYAPVVNKVYKEYFTNQPCRSCVVVGFPNEKIK 120
           NL++VL ++G SSL  V+KVLLFV DG YA  VN VY+EYF  +P RSCVVV FP+  IK
Sbjct: 59  NLKVVL-EAGGSSLSNVLKVLLFVGDGSYASAVNSVYQEYFPGRPGRSCVVVAFPDPAIK 117

Query: 121 VELECVAEIDKK 132
           VELECVA + +K
Sbjct: 118 VELECVAVVPEK 129

>KLTH0C11880g Chr3 complement(982966..983361) [396 bp, 131 aa] {ON}
           conserved hypothetical protein
          Length = 131

 Score =  145 bits (365), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 67/129 (51%), Positives = 92/129 (71%), Gaps = 1/129 (0%)

Query: 1   MPTKTTWKDIGAPEASALLSPAFVTTSNTPLVYTSGCVGTDPKTGELPEDLEQQTRNAIE 60
           M  K  W+++G     + LSP  V++ N  L++TSGCVG DP TGE PED+E Q RNA+E
Sbjct: 1   MVRKLKWEEVGVSNGPSFLSPGCVSSKNCDLLFTSGCVGNDPITGEYPEDVESQARNAME 60

Query: 61  NLRIVLSKSGCSSLDQVVKVLLFVADGKYAPVVNKVYKEYFTNQPCRSCVVVGFPNEKIK 120
           N++ VL +S  S+ D V+K LLF++D  YA  VNKVY+E+F  +P RSC+VV FP+ K+K
Sbjct: 61  NMKRVL-ESASSNFDYVLKALLFISDPSYASAVNKVYQEFFPGRPSRSCIVVSFPDPKLK 119

Query: 121 VELECVAEI 129
            E+ECVAE+
Sbjct: 120 FEMECVAEV 128

>ZYRO0D09856g Chr4 complement(834023..834493) [471 bp, 156 aa] {ON}
           some similarities with uniprot|P40185 Saccharomyces
           cerevisiae YIL051C MMF1
          Length = 156

 Score =  130 bits (328), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 68/125 (54%), Positives = 89/125 (71%), Gaps = 4/125 (3%)

Query: 3   TKTTWKDIGAPEASALLSPAFVTTSNTPLVYTSGCVGTDPKTGELPEDLEQQTRNAIENL 62
           ++  W  +G   ++ LLSPAFV +S   LV+TSGC+GTD +  +LPE   +QT+NA ENL
Sbjct: 27  SRVDWNQLGT--SNPLLSPAFVVSSAHHLVFTSGCLGTDDQ-DQLPECPAEQTKNAFENL 83

Query: 63  RIVLSKSGCSSLDQVVKVLLFVADGKYAPVVNKVYKEYFTNQPCRSCVVVGFPNEKIKVE 122
             VL  SG SSL  V+KVLLFV D    PVVN++Y++YF  +P RSC+VV FPN K++VE
Sbjct: 84  SKVLEASG-SSLSSVIKVLLFVKDPALVPVVNRIYQKYFPEKPARSCIVVAFPNPKVQVE 142

Query: 123 LECVA 127
           LECVA
Sbjct: 143 LECVA 147

>KLTH0E03168g Chr5 complement(285658..286104) [447 bp, 148 aa] {ON}
           conserved hypothetical protein
          Length = 148

 Score =  110 bits (276), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 58/127 (45%), Positives = 83/127 (65%), Gaps = 5/127 (3%)

Query: 4   KTTWKDIGAPEASALLSPAFVTTSNTPLVYTSGCVGTDPKTGELPEDLEQQTRNAIENLR 63
           K TW+ I   E   L SPAFV+  +   V+TSG +G+   TGE+ + +E Q   AI+NL 
Sbjct: 27  KITWESIEGKEHPTL-SPAFVSNGH---VFTSGIIGSKYGTGEVSQQIEDQVHLAIQNLE 82

Query: 64  IVLSKSGCSSLDQVVKVLLFVADGKYAPVVNKVYKEYFTNQPCRSCVVVGFPNEKIKVEL 123
            VL+ +G SSL+QV KV +F++  +Y+ VVN++Y +YF  +P RSCVVV F +  IK EL
Sbjct: 83  NVLAVAG-SSLEQVFKVTMFISHAEYSKVVNEIYGQYFPQKPARSCVVVAFMDAAIKYEL 141

Query: 124 ECVAEID 130
           E VA ++
Sbjct: 142 EAVATLE 148

>Kwal_47.16590 s47 complement(15715..16095) [381 bp, 126 aa] {ON}
           YER057C (HMF1) - heat-regulated protein [contig 376]
           FULL
          Length = 126

 Score =  109 bits (272), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 56/127 (44%), Positives = 80/127 (62%), Gaps = 5/127 (3%)

Query: 4   KTTWKDIGAPEASALLSPAFVTTSNTPLVYTSGCVGTDPKTGELPEDLEQQTRNAIENLR 63
           K TW+ I   E    LSP +V+  +   V+TSG +G +  TGE+P ++E Q   AI+NL 
Sbjct: 5   KITWEAIKGKE-HPTLSPGYVSNGH---VFTSGIIGANYGTGEVPHEIEDQVHLAIKNLE 60

Query: 64  IVLSKSGCSSLDQVVKVLLFVADGKYAPVVNKVYKEYFTNQPCRSCVVVGFPNEKIKVEL 123
            VL  +G SSL +V KV +F++   Y+ VVN++Y  YF ++P RSCVVV F +  IK EL
Sbjct: 61  TVLV-AGGSSLSKVFKVTMFISHADYSKVVNEIYGHYFPHKPARSCVVVAFMDAAIKYEL 119

Query: 124 ECVAEID 130
           E +A +D
Sbjct: 120 EAIATLD 126

>ZYRO0C08074g Chr3 complement(619866..620297) [432 bp, 143 aa] {ON}
           similar to uniprot|P40185 Saccharomyces cerevisiae
           YIL051C MMF1 Mitochondrial protein involved in
           maintenance of the mitochondrial genome and similar to
           YER057C uniprot|P40037 Saccharomyces cerevisiae YER057C
           HMF1 Member of the p14.5 protein family with similarity
           to Mmf1p, functionally complements Mmf1p function when
           targeted to mitochondria; heat shock inducible; high-
           dosage growth inhibitor; forms a homotrimer in vitro
          Length = 143

 Score = 67.4 bits (163), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 47/132 (35%), Positives = 72/132 (54%), Gaps = 6/132 (4%)

Query: 1   MPTKTTWKDIGAPEASALLSPAFVTTSNTPLVYTSGCVGTDPKTGELPEDLEQQTRNAIE 60
           M T T      AP A+A  S A   ++   L++ SG +   P    +   +  +T     
Sbjct: 16  MATLTPVATKSAPPAAASYSQAMKASN---LLFVSGQIPYTPDNKPVEGSISDKTEQVFS 72

Query: 61  NLRIVLSKSGCSSLDQVVKVLLFVADGKYAPVVNKVYKEYFT-NQPCRSCVVVGFPNEKI 119
           N++ +L ++G SSL++VVKV +F+AD KY    NKVY +YF  +QP RSCV V    +  
Sbjct: 73  NVKSIL-QAGNSSLERVVKVNVFLADIKYFEEFNKVYAKYFNEHQPARSCVAVAALPKNC 131

Query: 120 KVELECV-AEID 130
            +E+E + AE+D
Sbjct: 132 DLEMEVIAAEVD 143

>TBLA0D04090 Chr4 (1016159..1016626) [468 bp, 155 aa] {ON} Anc_7.238
           YIL051C
          Length = 155

 Score = 64.7 bits (156), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 44/125 (35%), Positives = 66/125 (52%), Gaps = 3/125 (2%)

Query: 11  GAPEASALLSPAF-VTTSNTPLVYTSGCVGTDPKTGELPEDLEQQTRNAIENLRIVLSKS 69
            AP A+A  S A  V T    L+Y SG +   P    +   +  +     +N+  +L KS
Sbjct: 32  NAPPAAASYSQALKVNTQFNELLYVSGQIPFTPDNKPVEGSISDKAEQVFQNVENIL-KS 90

Query: 70  GCSSLDQVVKVLLFVADGKYAPVVNKVYKEYFT-NQPCRSCVVVGFPNEKIKVELECVAE 128
           G SSL++VVKV +F+ D       NKVY +YFT ++P RSCV V      + +E+E +A 
Sbjct: 91  GNSSLNEVVKVNVFLKDIDNFAEFNKVYAKYFTVHKPARSCVAVAALPLNVDLEMEVIAA 150

Query: 129 IDKKT 133
           + K+ 
Sbjct: 151 VKKEN 155

>KAFR0L00860 Chr12 complement(161978..162364) [387 bp, 128 aa] {ON}
           Anc_7.238 YIL051C
          Length = 128

 Score = 63.9 bits (154), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 67/128 (52%), Gaps = 5/128 (3%)

Query: 1   MPTKTTWKDIGAPEASALLSPAFVTTSNTPLVYTSGCVGTDPKTGELPEDLEQQTRNAIE 60
           M   TT    GAP  +A  S A    +   ++Y SG +   P    +   +  +T   +E
Sbjct: 1   MSNVTTINAPGAPAQAASYSHAAKVGN---MIYLSGQIPLTPDGKPVEGSIADKTTQVLE 57

Query: 61  NLRIVLSKSGCSSLDQVVKVLLFVADGKYAPVVNKVYKEYF-TNQPCRSCVVVGFPNEKI 119
           N++ VL K+  SSL+ +VKV +F+AD KY   +N VY +YF  ++P RSCV V       
Sbjct: 58  NIKTVL-KASNSSLENIVKVNIFLADIKYFSELNVVYAKYFKAHKPARSCVAVAALPLNA 116

Query: 120 KVELECVA 127
            +E+E VA
Sbjct: 117 DLEIEVVA 124

>Suva_5.165 Chr5 complement(246850..247239) [390 bp, 129 aa] {ON}
           YER057C (REAL)
          Length = 129

 Score = 60.5 bits (145), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 34/98 (34%), Positives = 56/98 (57%), Gaps = 2/98 (2%)

Query: 31  LVYTSGCVGTDPKTGELPEDLEQQTRNAIENLRIVLSKSGCSSLDQVVKVLLFVADGKYA 90
           L++ SG +        +   +  +    I+N++ VL+ S  SSLD+++KV +F+AD KY 
Sbjct: 29  LIFLSGQIPMTSDNKLVEGSIADKAEQVIQNIKDVLAASN-SSLDRIIKVNIFLADIKYF 87

Query: 91  PVVNKVYKEYF-TNQPCRSCVVVGFPNEKIKVELECVA 127
              N VY +YF T++P RSCV V      + +E+E +A
Sbjct: 88  AEFNSVYAKYFTTHKPARSCVAVAALPLNVDMEVEIIA 125

>YER057C Chr5 complement(270737..271126) [390 bp, 129 aa] {ON}
           HMF1Member of the p14.5 protein family with similarity
           to Mmf1p, functionally complements Mmf1p function when
           targeted to mitochondria; heat shock inducible;
           high-dosage growth inhibitor; forms a homotrimer in
           vitro
          Length = 129

 Score = 60.1 bits (144), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 35/98 (35%), Positives = 55/98 (56%), Gaps = 2/98 (2%)

Query: 31  LVYTSGCVGTDPKTGELPEDLEQQTRNAIENLRIVLSKSGCSSLDQVVKVLLFVADGKYA 90
           L++ SG +   P    +   +  +    I+N++ VL  S  SSLD+VVKV +F+AD  + 
Sbjct: 29  LIFLSGQIPVTPDNKLVEGSIADKAEQVIQNIKNVLEASN-SSLDRVVKVNIFLADINHF 87

Query: 91  PVVNKVYKEYF-TNQPCRSCVVVGFPNEKIKVELECVA 127
              N VY +YF T++P RSCV V      + +E+E +A
Sbjct: 88  AEFNSVYAKYFNTHKPARSCVAVAALPLGVDMEMEAIA 125

>Smik_9.139 Chr9 complement(231954..232391) [438 bp, 145 aa] {ON}
           YIL051C (REAL)
          Length = 145

 Score = 59.7 bits (143), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 40/118 (33%), Positives = 63/118 (53%), Gaps = 5/118 (4%)

Query: 11  GAPEASALLSPAFVTTSNTPLVYTSGCVGTDPKTGELPEDLEQQTRNAIENLRIVLSKSG 70
            AP A+A  S A    +    VY SG +   P+   +   +  +     +N++ +L++S 
Sbjct: 28  SAPPAAASYSQAMKANN---FVYVSGQIPYTPENKPVQGSISDKAEQVFQNVKNILAESN 84

Query: 71  CSSLDQVVKVLLFVADGKYAPVVNKVYKEYF-TNQPCRSCVVVGFPNEKIKVELECVA 127
            SSLD +VKV +F+AD K     N VY +YF T++P RSCV V      + +E+E +A
Sbjct: 85  -SSLDNIVKVNVFLADMKNFGEFNSVYAKYFHTHKPARSCVGVASLPLNVDLEMEVIA 141

>Skud_9.118 Chr9 complement(226723..227160) [438 bp, 145 aa] {ON}
           YIL051C (REAL)
          Length = 145

 Score = 59.7 bits (143), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 64/121 (52%), Gaps = 13/121 (10%)

Query: 12  APEASALLSPAFVTTSNTPLVYTSGCV----GTDPKTGELPEDLEQQTRNAIENLRIVLS 67
           AP A+A  S A    S    VY SG +       P  G + +  EQ      +N++ +L+
Sbjct: 29  APPAAASYSQAMKANS---FVYVSGQIPYTAANKPVQGSISDKAEQ----VFQNVKNILA 81

Query: 68  KSGCSSLDQVVKVLLFVADGKYAPVVNKVYKEYF-TNQPCRSCVVVGFPNEKIKVELECV 126
           +S  SSLD +VKV +F+AD K     N VY +YF T++P RSCV V      + +E+E +
Sbjct: 82  ESN-SSLDNIVKVNVFLADMKNFAEFNSVYAKYFHTHKPARSCVGVASLPLNVDLEMEVI 140

Query: 127 A 127
           A
Sbjct: 141 A 141

>TDEL0H02060 Chr8 (350315..350848) [534 bp, 177 aa] {ON} Anc_7.238
           YIL051C
          Length = 177

 Score = 59.7 bits (143), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 42/134 (31%), Positives = 69/134 (51%), Gaps = 5/134 (3%)

Query: 1   MPTKTTWKDIGAPEASALLSPAFVTTSNTPLVYTSGCVGTDPKTGELPEDLEQQTRNAIE 60
           M T T      AP A+A  S A    +   L++ SG +   P+   +   +  +     +
Sbjct: 44  MATLTPVATKNAPPAAASYSQAMKANN---LIFVSGQIPYTPENKPVEGSIADKAEQVFK 100

Query: 61  NLRIVLSKSGCSSLDQVVKVLLFVADGKYAPVVNKVYKEYF-TNQPCRSCVVVGFPNEKI 119
           N+R +L  S  SS ++V+KV +F+AD       NKVY +YF T++P RSCV V      +
Sbjct: 101 NVRNILEASD-SSFERVIKVNVFLADINNFAEFNKVYAKYFSTHKPARSCVAVAALPLNV 159

Query: 120 KVELECVAEIDKKT 133
            +E+E +A  ++K+
Sbjct: 160 DLEMEVIATENEKS 173

>YIL051C Chr9 complement(257843..258280) [438 bp, 145 aa] {ON}
           MMF1Mitochondrial protein required for transamination of
           isoleucine but not of valine or leucine; may regulate
           specificity of branched-chain transaminases Bat1p and
           Bat2p; interacts genetically with mitochondrial
           ribosomal protein genes
          Length = 145

 Score = 58.9 bits (141), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 39/117 (33%), Positives = 63/117 (53%), Gaps = 5/117 (4%)

Query: 12  APEASALLSPAFVTTSNTPLVYTSGCVGTDPKTGELPEDLEQQTRNAIENLRIVLSKSGC 71
           AP A+A  S A    +    VY SG +   P    +   + ++     +N++ +L++S  
Sbjct: 29  APPAAASYSQAMKANN---FVYVSGQIPYTPDNKPVQGSISEKAEQVFQNVKNILAESN- 84

Query: 72  SSLDQVVKVLLFVADGKYAPVVNKVYKEYF-TNQPCRSCVVVGFPNEKIKVELECVA 127
           SSLD +VKV +F+AD K     N VY ++F T++P RSCV V      + +E+E +A
Sbjct: 85  SSLDNIVKVNVFLADMKNFAEFNSVYAKHFHTHKPARSCVGVASLPLNVDLEMEVIA 141

>Skud_5.171 Chr5 complement(266894..267283) [390 bp, 129 aa] {ON}
           YER057C (REAL)
          Length = 129

 Score = 58.2 bits (139), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 34/98 (34%), Positives = 56/98 (57%), Gaps = 2/98 (2%)

Query: 31  LVYTSGCVGTDPKTGELPEDLEQQTRNAIENLRIVLSKSGCSSLDQVVKVLLFVADGKYA 90
           L++ SG +        +   + ++    ++N++ VL  S  SSLD+VVKV +F+AD K+ 
Sbjct: 29  LIFLSGQIPVTQDNKLVEGSIAEKAEQVLQNVKNVLESSN-SSLDRVVKVNIFLADIKHF 87

Query: 91  PVVNKVYKEYF-TNQPCRSCVVVGFPNEKIKVELECVA 127
              N VY +YF T++P RSCV V      + +E+E +A
Sbjct: 88  AEFNSVYAKYFHTHKPARSCVAVAALPLGVDMEMEAIA 125

>ADL077C Chr4 complement(549523..549951) [429 bp, 142 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL051C
           (MMF1) and YER057C (HMF1)
          Length = 142

 Score = 58.2 bits (139), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 42/128 (32%), Positives = 62/128 (48%), Gaps = 5/128 (3%)

Query: 1   MPTKTTWKDIGAPEASALLSPAFVTTSNTPLVYTSGCVGTDPKTGELPEDLEQQTRNAIE 60
           M + T  +   AP  +A  S A        +V+ SG +   P    +   +  +T   I 
Sbjct: 15  MSSLTPVRTTAAPPPAASYSQAMRANG---MVFVSGQIPYTPDNKPVEGSVADKTEQVIA 71

Query: 61  NLRIVLSKSGCSSLDQVVKVLLFVADGKYAPVVNKVYKEYF-TNQPCRSCVVVGFPNEKI 119
           N+R VL  S  S LD+V KV +F+AD  Y    N VY +YF  ++P RSCV V      +
Sbjct: 72  NVRNVLEASN-SGLDRVAKVNVFLADMAYFAEFNSVYAKYFGEHKPARSCVAVRALPLNV 130

Query: 120 KVELECVA 127
            +E+E +A
Sbjct: 131 DLEMEVIA 138

>KAFR0I01830 Chr9 complement(375688..376119) [432 bp, 143 aa] {ON}
           Anc_7.238 YIL051C
          Length = 143

 Score = 58.2 bits (139), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 39/117 (33%), Positives = 61/117 (52%), Gaps = 5/117 (4%)

Query: 12  APEASALLSPAFVTTSNTPLVYTSGCVGTDPKTGELPEDLEQQTRNAIENLRIVLSKSGC 71
           AP A+A  S A    +    VY SG +   P    +   L  +     +N++ +L  S  
Sbjct: 27  APPAAASYSQAMKANN---FVYVSGQIPYTPDNKPVEGTLSDKANQVFQNVKNILEASN- 82

Query: 72  SSLDQVVKVLLFVADGKYAPVVNKVYKEYFT-NQPCRSCVVVGFPNEKIKVELECVA 127
           SS++++VKV +F+AD K+    N VY +YF  ++P RSCV V      + +E+E VA
Sbjct: 83  SSMNKIVKVNVFLADMKFFQEFNSVYAKYFNVHKPARSCVAVASLPLNVDLEVEVVA 139

>NDAI0A02550 Chr1 complement(570003..570437) [435 bp, 144 aa] {ON}
           Anc_7.238
          Length = 144

 Score = 57.8 bits (138), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 61/117 (52%), Gaps = 5/117 (4%)

Query: 12  APEASALLSPAFVTTSNTPLVYTSGCVGTDPKTGELPEDLEQQTRNAIENLRIVLSKSGC 71
           AP A+A  S A    +    VY SG +   P+   +   +  +     +N+R +L  S  
Sbjct: 29  APPAAASYSQAMKANN---FVYVSGQIPYTPENKPVEGSISDKAEQVFQNVRNILEASN- 84

Query: 72  SSLDQVVKVLLFVADGKYAPVVNKVYKEYF-TNQPCRSCVVVGFPNEKIKVELECVA 127
           SSLD++VKV +F+AD       N VY +YF T++P RSCV V      + +E+E +A
Sbjct: 85  SSLDKIVKVNVFLADINNFKEFNGVYAKYFNTHKPARSCVAVKALPLNVDLEVEVIA 141

>Smik_5.187 Chr5 complement(274856..275245) [390 bp, 129 aa] {ON}
           YER057C (REAL)
          Length = 129

 Score = 56.6 bits (135), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 34/98 (34%), Positives = 54/98 (55%), Gaps = 2/98 (2%)

Query: 31  LVYTSGCVGTDPKTGELPEDLEQQTRNAIENLRIVLSKSGCSSLDQVVKVLLFVADGKYA 90
           L++ SG +        +   +  +    I+N++ VL  S  SSLD+VVKV +F+AD  + 
Sbjct: 29  LIFLSGQIPVTSDNKLVEGSIADKAEQVIQNIKNVLESSN-SSLDRVVKVNIFLADINHF 87

Query: 91  PVVNKVYKEYF-TNQPCRSCVVVGFPNEKIKVELECVA 127
              N VY +YF T++P RSCV V      + +E+E +A
Sbjct: 88  AEFNTVYAKYFSTHKPARSCVAVAALPLGVDMEMEAIA 125

>NCAS0A13490 Chr1 (2655822..2656268) [447 bp, 148 aa] {ON} Anc_7.238
          Length = 148

 Score = 56.2 bits (134), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 38/117 (32%), Positives = 62/117 (52%), Gaps = 5/117 (4%)

Query: 12  APEASALLSPAFVTTSNTPLVYTSGCVGTDPKTGELPEDLEQQTRNAIENLRIVLSKSGC 71
           AP A+A  S A    +    VY SG +   P+   +   +  +     +N++ +L +SG 
Sbjct: 29  APPAAASYSQAMKANN---FVYVSGQIPYTPENKPVEGTISDKAEQVFQNIKNILKESG- 84

Query: 72  SSLDQVVKVLLFVADGKYAPVVNKVYKEYFT-NQPCRSCVVVGFPNEKIKVELECVA 127
           SS+D++VKV +F+AD       N VY +YF  ++P RSCV V      + +E+E +A
Sbjct: 85  SSMDKIVKVNVFLADINNFKEFNGVYAKYFNVHKPARSCVAVKDLPLNVDLEVEVIA 141

>TBLA0J01420 Chr10 (325885..326265) [381 bp, 126 aa] {ON} Anc_7.238
           YIL051C
          Length = 126

 Score = 53.9 bits (128), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 61/128 (47%), Gaps = 5/128 (3%)

Query: 1   MPTKTTWKDIGAPEASALLSPAFVTTSNTPLVYTSGCVGTDPKTGELPEDLEQQTRNAIE 60
           MP  T      AP A+A  S A         +Y SG +   P    +   +  +     +
Sbjct: 1   MPGLTPINCSNAPPAAASYSHAM---KGNGFIYVSGQIALLPDGTRVEGSISDKAHQIFK 57

Query: 61  NLRIVLSKSGCSSLDQVVKVLLFVADGKYAPVVNKVYKEYF-TNQPCRSCVVVGFPNEKI 119
           N+  +L  +G SSL++++KV +F+A+ K     N  Y +YF T++P RSCV V       
Sbjct: 58  NISAILETAG-SSLNKIIKVNIFLANIKDFEEFNATYIKYFNTHKPARSCVAVAALPLGA 116

Query: 120 KVELECVA 127
            VE+E VA
Sbjct: 117 DVEVEVVA 124

>Suva_9.148 Chr9 complement(246539..246976) [438 bp, 145 aa] {ON}
           YIL051C (REAL)
          Length = 145

 Score = 53.9 bits (128), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 42/121 (34%), Positives = 64/121 (52%), Gaps = 13/121 (10%)

Query: 12  APEASALLSPAFVTTSNTPLVYTSGCV----GTDPKTGELPEDLEQQTRNAIENLRIVLS 67
           AP A+A  S A    +    VY SG +       P  G + +  EQ      +N++ +L+
Sbjct: 29  APPAAASYSQAIKANN---FVYVSGQIPYTAENKPVQGSISDKAEQ----VFQNVKNILA 81

Query: 68  KSGCSSLDQVVKVLLFVADGKYAPVVNKVYKEYF-TNQPCRSCVVVGFPNEKIKVELECV 126
           +S  SSL+ VVKV +F+AD K     N VY ++F T++P RSCV V      + +E+E +
Sbjct: 82  ESN-SSLNSVVKVNVFLADMKNFAEFNSVYAKHFHTHKPARSCVGVASLPLNVDLEMEVI 140

Query: 127 A 127
           A
Sbjct: 141 A 141

>Kpol_1033.12 s1033 complement(28172..28603) [432 bp, 143 aa] {ON}
           complement(28172..28603) [432 nt, 144 aa]
          Length = 143

 Score = 53.9 bits (128), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 37/118 (31%), Positives = 59/118 (50%), Gaps = 5/118 (4%)

Query: 11  GAPEASALLSPAFVTTSNTPLVYTSGCVGTDPKTGELPEDLEQQTRNAIENLRIVLSKSG 70
            AP A+A  S A    +   L++ SG +   P+   +   +  +      N+  +L  S 
Sbjct: 25  SAPPAAASYSQAMKANN---LIFVSGQIPYTPENKPVEGSISDKAEQVFSNVTNILEASN 81

Query: 71  CSSLDQVVKVLLFVADGKYAPVVNKVYKEYFT-NQPCRSCVVVGFPNEKIKVELECVA 127
            SSLD+V+KV +F+ D K     N VY +YF  ++P RSCV V      + +E+E +A
Sbjct: 82  -SSLDRVIKVNVFLKDIKNFQEFNSVYAKYFNVHKPARSCVAVAALPLNVDLEMEVIA 138

>NCAS0E03240 Chr5 (641701..642087) [387 bp, 128 aa] {ON} Anc_7.238
          Length = 128

 Score = 53.1 bits (126), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 37/118 (31%), Positives = 60/118 (50%), Gaps = 5/118 (4%)

Query: 11  GAPEASALLSPAFVTTSNTPLVYTSGCVGTDPKTGELPEDLEQQTRNAIENLRIVLSKSG 70
            AP A+A  S A    +   L++ SG +    +   +   +  +    I+N++ VL  S 
Sbjct: 11  NAPSAAASYSHAMKANN---LIFLSGQIPMTAENKPVEGSIADKAEQVIQNIKNVLEASN 67

Query: 71  CSSLDQVVKVLLFVADGKYAPVVNKVYKEYFT-NQPCRSCVVVGFPNEKIKVELECVA 127
            SSL+++VKV +F+AD       N VY +YF  ++P RSCV V        +E+E +A
Sbjct: 68  -SSLEKIVKVNIFLADINSFAEFNTVYAKYFNVHKPARSCVAVAALPLNADLEMEVIA 124

>CAGL0M12386g Chr13 (1236543..1236971) [429 bp, 142 aa] {ON} similar
           to uniprot|P40037 Saccharomyces cerevisiae YER057c HIG1
           Heat-shock induceable Inhibiter of cell Growth
          Length = 142

 Score = 52.8 bits (125), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 55/102 (53%), Gaps = 10/102 (9%)

Query: 31  LVYTSGCV----GTDPKTGELPEDLEQQTRNAIENLRIVLSKSGCSSLDQVVKVLLFVAD 86
           L+Y SG +       P  G + +  EQ     I+N++ +L  S  S L+++VKV +F+AD
Sbjct: 42  LIYVSGQIPYTKDNKPVEGSISDKAEQ----VIQNVQNILKDSN-SDLNRIVKVNIFLAD 96

Query: 87  GKYAPVVNKVYKEYFT-NQPCRSCVVVGFPNEKIKVELECVA 127
                  NKVY +YF  ++P RSCV V      + +E+E +A
Sbjct: 97  MNNFAEFNKVYAKYFNVHKPARSCVAVAALPLGVDLEMEVIA 138

>NDAI0E04750 Chr5 complement(1071393..1071779) [387 bp, 128 aa] {ON}
           Anc_7.238
          Length = 128

 Score = 52.4 bits (124), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 62/121 (51%), Gaps = 13/121 (10%)

Query: 12  APEASALLSPAFVTTSNTPLVYTSGCV----GTDPKTGELPEDLEQQTRNAIENLRIVLS 67
           AP A+A  S A    +   L++ SG +       P  G + +  EQ     I+N++ VL 
Sbjct: 12  APSAAASYSHAMKANN---LIFLSGQIPLTSDNKPVEGSIADKAEQ----VIQNVKKVLE 64

Query: 68  KSGCSSLDQVVKVLLFVADGKYAPVVNKVYKEYFT-NQPCRSCVVVGFPNEKIKVELECV 126
            S  SSL++++KV +F+AD       N VY +YF  ++P RSCV V        +E+E +
Sbjct: 65  ASN-SSLERIIKVNIFLADINSFAEFNTVYAKYFNVHKPARSCVAVAALPLNADLEMEVI 123

Query: 127 A 127
           A
Sbjct: 124 A 124

>TPHA0K00920 Chr11 (190389..190775) [387 bp, 128 aa] {ON} Anc_7.238
           YIL051C
          Length = 128

 Score = 52.0 bits (123), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 60/121 (49%), Gaps = 6/121 (4%)

Query: 13  PEASALLSPAFVTTSNTPLVYTSGCVGTDPKTGELPEDLEQQTRNAIENLRIVLSKSGCS 72
           P  +A  SPA         +Y SG +  +     +   +  +     EN++ VL+ +  S
Sbjct: 13  PSPAASYSPAMKAGDT---IYLSGQIHLNEDNKLVGGSIADKAEQIFENVQKVLAAAN-S 68

Query: 73  SLDQVVKVLLFVADGKYAPVVNKVYKEYF-TNQPCRSCVVVGFPNEKIKVELECVAEIDK 131
            LD VVK  +F+ D K     N VY +YF +++P RSCV V        VE+EC+A ++K
Sbjct: 69  DLDHVVKCNVFLKDIKDFAEFNTVYAKYFNSHKPARSCVAVAALPLNADVEMECIA-VEK 127

Query: 132 K 132
           K
Sbjct: 128 K 128

>Kwal_23.5804 s23 complement(1324907..1325332) [426 bp, 141 aa] {ON}
           YIL051C (MMF1) - Maintenance of Mitochondrial DNA 1
           [contig 11] FULL
          Length = 141

 Score = 52.4 bits (124), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 32/98 (32%), Positives = 54/98 (55%), Gaps = 2/98 (2%)

Query: 31  LVYTSGCVGTDPKTGELPEDLEQQTRNAIENLRIVLSKSGCSSLDQVVKVLLFVADGKYA 90
           +V+ SG +    +   +   +  +    I+N+R +L ++  S LD++VKV +F+AD K  
Sbjct: 41  MVFVSGQIPYTAENKRVEGTIADKAEQVIQNVRNILEEAN-SGLDKIVKVNIFLADIKDF 99

Query: 91  PVVNKVYKEYFT-NQPCRSCVVVGFPNEKIKVELECVA 127
              N VY +YF  ++P RSCV V      + +E+E VA
Sbjct: 100 AEFNGVYGKYFNEHKPARSCVAVKALPLDVDLEMEVVA 137

>Kpol_1009.25 s1009 complement(58847..59230) [384 bp, 127 aa] {ON}
           complement(58847..59230) [384 nt, 128 aa]
          Length = 127

 Score = 51.2 bits (121), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 33/99 (33%), Positives = 57/99 (57%), Gaps = 4/99 (4%)

Query: 31  LVYTSGCVGTDPKTGELPEDLEQQTRNAIENLRIVLSKSGCSSLDQVVKVLLFVADGKYA 90
           ++Y SG +    +   +   +  Q    I+N++ +L +S  SSL+++VKV +F+ D  + 
Sbjct: 28  MIYVSGQIPYTKENKPIGGTVSDQAEQMIQNVKNIL-ESANSSLNKIVKVNVFLTDMNHF 86

Query: 91  PVVNKVYKEYFT-NQPCRSCV-VVGFPNEKIKVELECVA 127
              N VY +YF+ ++P RSCV V   P + I +E+E VA
Sbjct: 87  QEFNVVYAKYFSEHKPARSCVAVAALPLDNI-MEMEVVA 124

>TPHA0C01100 Chr3 (250318..250746) [429 bp, 142 aa] {ON} Anc_7.238
           YIL051C
          Length = 142

 Score = 50.8 bits (120), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 37/117 (31%), Positives = 60/117 (51%), Gaps = 5/117 (4%)

Query: 12  APEASALLSPAFVTTSNTPLVYTSGCVGTDPKTGELPEDLEQQTRNAIENLRIVLSKSGC 71
           +P A+A  S A    +   LV+ SG +        +   +  +T    +N++ +L  S  
Sbjct: 26  SPPAAASYSQAMKANN---LVFVSGQIPYTKDNVPVKGSISDKTEQVFQNVKNILDASN- 81

Query: 72  SSLDQVVKVLLFVADGKYAPVVNKVYKEYF-TNQPCRSCVVVGFPNEKIKVELECVA 127
           SS D+V+KV +F+AD       N+VY +YF T++P RSCV V        +E+E +A
Sbjct: 82  SSFDKVIKVNVFLADINNFKEFNEVYAKYFNTHKPARSCVAVAALPLGCDLEMEVIA 138

>KNAG0L01450 Chr12 complement(258500..258895) [396 bp, 131 aa] {ON}
           Anc_7.238 YIL051C
          Length = 131

 Score = 50.1 bits (118), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 32/98 (32%), Positives = 50/98 (51%), Gaps = 2/98 (2%)

Query: 31  LVYTSGCVGTDPKTGELPEDLEQQTRNAIENLRIVLSKSGCSSLDQVVKVLLFVADGKYA 90
           LV+ SG V        L   + ++    I N++ +L+ S  S+LD+VVK  +F+AD    
Sbjct: 30  LVFVSGQVPLTADNKMLEGSIAEKAEQVITNIKTILAASN-SALDRVVKCNIFLADINNF 88

Query: 91  PVVNKVYKEYFTNQ-PCRSCVVVGFPNEKIKVELECVA 127
              N VY ++F +  P RSCV V        +E+E +A
Sbjct: 89  AEFNTVYAKHFHDHKPARSCVAVAALPLNADLEMEVIA 126

>KNAG0D01620 Chr4 complement(272653..273081) [429 bp, 142 aa] {ON}
           Anc_7.238 YIL051C
          Length = 142

 Score = 49.7 bits (117), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 59/120 (49%), Gaps = 6/120 (5%)

Query: 13  PEASALLSPAFVTTSN----TPLVYTSGCVGTDPKTGELPEDLEQQTRNAIENLRIVLSK 68
           P A+ L  PA  + S       +V+ SG +        +   + ++     +N++ +L  
Sbjct: 20  PVATKLAPPAAASYSQAMKFNKMVFVSGQIPYTHDNKPVEGSISKKADQVFQNIKNILDA 79

Query: 69  SGCSSLDQVVKVLLFVADGKYAPVVNKVYKEYFT-NQPCRSCVVVGFPNEKIKVELECVA 127
           S  SSLD+++KV +F+ D       N VY +YF  ++P RSCV V      + VE+E +A
Sbjct: 80  SN-SSLDKIIKVNVFLKDINNFKEFNGVYAKYFNVHKPARSCVAVAALPLDVDVEVEVIA 138

>KLLA0C08349g Chr3 (731629..732051) [423 bp, 140 aa] {ON} similar to
           uniprot|P40185 Saccharomyces cerevisiae YIL051C MMF1
           Mitochondrial protein involved in maintenance of the
           mitochondrial genome and similar to YER057C
           uniprot|P40037 Saccharomyces cerevisiae YER057C HMF1
           Member of the p14.5 protein family with similarity to
           Mmf1p, functionally complements Mmf1p function when
           targeted to mitochondria; heat shock inducible; high-
           dosage growth inhibitor; forms a homotrimer in vitro
          Length = 140

 Score = 48.9 bits (115), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 41/132 (31%), Positives = 65/132 (49%), Gaps = 13/132 (9%)

Query: 1   MPTKTTWKDIGAPEASALLSPAFVTTSNTPLVYTSGCV----GTDPKTGELPEDLEQQTR 56
           M T T  K   AP  +A  S A    +   L++ SG +       P  G + +  EQ   
Sbjct: 13  MNTLTPVKTQLAPPPAASYSQAIKVNN---LIFVSGQIPYTAENKPVEGSIADKAEQ--- 66

Query: 57  NAIENLRIVLSKSGCSSLDQVVKVLLFVADGKYAPVVNKVYKEYFT-NQPCRSCVVVGFP 115
             I+N++ +L ++  S LD++VKV +F+AD       N VY +YF  ++P RSCV     
Sbjct: 67  -VIQNVKNILVEAN-SDLDKIVKVNIFLADINSFAEFNSVYAKYFNVHKPARSCVAAKAL 124

Query: 116 NEKIKVELECVA 127
              + +E+E +A
Sbjct: 125 PLNVDLEMEVIA 136

>SAKL0F08558g Chr6 complement(654765..655199) [435 bp, 144 aa] {ON}
           highly similar to uniprot|P40185 Saccharomyces
           cerevisiae YIL051C MMF1 Mitochondrial protein involved
           in maintenance of the mitochondrial genome and similar
           to YER057C uniprot|P40037 Saccharomyces cerevisiae
           YER057C HMF1 Member of the p14.5 protein family with
           similarity to Mmf1p, functionally complements Mmf1p
           function when targeted to mitochondria; heat shock
           inducible; high- dosage growth inhibitor; forms a
           homotrimer in vitro
          Length = 144

 Score = 48.9 bits (115), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 41/132 (31%), Positives = 67/132 (50%), Gaps = 13/132 (9%)

Query: 1   MPTKTTWKDIGAPEASALLSPAFVTTSNTPLVYTSGCV----GTDPKTGELPEDLEQQTR 56
           M T T  +   AP  +A  S A    +   +V+ SG +       P  G + +  EQ   
Sbjct: 17  MSTLTPVRTQLAPPPAASYSQAIKVNN---MVFVSGQIPYTHENKPVEGSIADKAEQ--- 70

Query: 57  NAIENLRIVLSKSGCSSLDQVVKVLLFVADGKYAPVVNKVYKEYFT-NQPCRSCVVVGFP 115
             I+N++ +L ++  SSL+++VKV +F+AD       N VY +YF  ++P RSCV V   
Sbjct: 71  -VIQNVKNILEEAN-SSLNKIVKVNVFLADINDFAEFNGVYAKYFNEHKPARSCVAVKSL 128

Query: 116 NEKIKVELECVA 127
              + +E+E +A
Sbjct: 129 PLNVDLEMEVIA 140

>KLTH0A04224g Chr1 complement(356660..357085) [426 bp, 141 aa] {ON}
           highly similar to uniprot|P40185 Saccharomyces
           cerevisiae YIL051C MMF1 Mitochondrial protein involved
           in maintenance of the mitochondrial genome and similar
           to YER057C uniprot|P40037 Saccharomyces cerevisiae
           YER057C HMF1 Member of the p14.5 protein family with
           similarity to Mmf1p, functionally complements Mmf1p
           function when targeted to mitochondria; heat shock
           inducible; high- dosage growth inhibitor; forms a
           homotrimer in vitro
          Length = 141

 Score = 47.4 bits (111), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 29/98 (29%), Positives = 54/98 (55%), Gaps = 2/98 (2%)

Query: 31  LVYTSGCVGTDPKTGELPEDLEQQTRNAIENLRIVLSKSGCSSLDQVVKVLLFVADGKYA 90
           +V+ SG +    +   +   +  +    I+N++ +L ++  S+L+++VKV +F+AD    
Sbjct: 41  MVFVSGQIPYTAENKRVEGTMTDKAEQVIQNVKNILEEAN-SALNKIVKVNIFLADINDF 99

Query: 91  PVVNKVYKEYFT-NQPCRSCVVVGFPNEKIKVELECVA 127
              N VY +YF  ++P RSCV V      + +E+E VA
Sbjct: 100 AEFNGVYGKYFNEHKPARSCVAVKDLPLNVDLEMEVVA 137

>TDEL0F04730 Chr6 (889641..891725) [2085 bp, 694 aa] {ON} Anc_8.349
           YLR143W
          Length = 694

 Score = 38.5 bits (88), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 39/85 (45%), Gaps = 12/85 (14%)

Query: 32  VYTSGCVGTDPKTGELPEDLEQQTRNAIENLRIVLSKSGCSSLDQVVKVLLFVADGKYAP 91
           +Y S    T P +      LE QTR  ++ L +++ K G S   Q +   L ++      
Sbjct: 323 LYVSNLRATTPSSS-----LENQTRQVLDALNVIIEKWGISP-SQAINCTLVLSSMSNFA 376

Query: 92  VVNKVYKEYFTNQ------PCRSCV 110
           VVN++Y EYF         P R+C+
Sbjct: 377 VVNEIYSEYFDISKYGPLPPSRACI 401

>AGL164W Chr7 (388842..390902) [2061 bp, 686 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR143W
          Length = 686

 Score = 35.0 bits (79), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 39/88 (44%), Gaps = 7/88 (7%)

Query: 51  LEQQTRNAIENLRIVLSKSGCSSLDQVVKVLLFVADGKYAPVVNKVYKEYFTNQ------ 104
           LE+Q R+  + L   L++ G      +  VLL    G +A  +N  Y  YF+ Q      
Sbjct: 329 LEKQARDVFDQLNESLTRHGVVKAQVLSSVLLLADMGTFAE-INTAYNGYFSIQEIGPLP 387

Query: 105 PCRSCVVVGFPNEKIKVELECVAEIDKK 132
           P R+C+        I ++L  V + D K
Sbjct: 388 PSRACIESKSLAPGIGLQLSVVIQHDIK 415

>Kpol_1036.86 s1036 (225185..227278) [2094 bp, 697 aa] {ON}
           (225185..227278) [2094 nt, 698 aa]
          Length = 697

 Score = 33.5 bits (75), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 33/70 (47%), Gaps = 7/70 (10%)

Query: 47  LPEDLEQQTRNAIENLRIVLSKSGCSSLDQVVKVLLFVADGKYAPVVNKVYKEYFTNQ-- 104
           + ED+E+Q  N    L  +L +   S   QV+   L++ +      VNK+Y  YF  Q  
Sbjct: 334 IEEDIERQVENVFNQLDSILGEKTYSRA-QVLNSSLYLFNMSDFSKVNKIYNNYFDIQKF 392

Query: 105 ----PCRSCV 110
               P R+CV
Sbjct: 393 GPLPPSRACV 402

>TPHA0G01130 Chr7 (229626..230465) [840 bp, 279 aa] {ON} Anc_8.790
           YOR313C
          Length = 279

 Score = 30.4 bits (67), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 36/75 (48%), Gaps = 6/75 (8%)

Query: 23  FVTTSNTPLVYTSGCVGT-DPKTGELPEDLEQQTRNAIENLRIVLSKSGCSSLDQVVKVL 81
           +V T+N PL+      GT DP   +L + LE+    A+EN   +   S C   D+ + + 
Sbjct: 166 YVNTNNKPLIR-----GTFDPLFSKLNKHLEKSWTKALENDNFINKNSYCCEFDKSIVLT 220

Query: 82  LFVADGKYAPVVNKV 96
           + +   K   V NK+
Sbjct: 221 INIIAQKTKDVNNKI 235

>ZYRO0F14014g Chr6 (1151774..1153783) [2010 bp, 669 aa] {ON} similar
           to uniprot|Q07261 Saccharomyces cerevisiae YLR143W
           Hypothetical ORF
          Length = 669

 Score = 30.0 bits (66), Expect = 1.7,   Method: Composition-based stats.
 Identities = 19/66 (28%), Positives = 32/66 (48%), Gaps = 7/66 (10%)

Query: 51  LEQQTRNAIENLRIVLSKSGCSSLDQVVKVLLFVADGKYAPVVNKVYKEYFTN------Q 104
           LE+Q ++  + L  +L K+  +   QV+   L + D    P VN++Y  YF         
Sbjct: 329 LEEQMQDIFKQLDDILKKNR-TKPSQVLHCTLILDDMSLFPQVNQIYSSYFDVIKNGPLP 387

Query: 105 PCRSCV 110
           P R+C+
Sbjct: 388 PARACI 393

>SAKL0H14938g Chr8 complement(1295178..1297253) [2076 bp, 691 aa]
           {ON} similar to uniprot|Q07261 Saccharomyces cerevisiae
           YLR143W Hypothetical ORF
          Length = 691

 Score = 29.3 bits (64), Expect = 3.3,   Method: Composition-based stats.
 Identities = 22/94 (23%), Positives = 39/94 (41%), Gaps = 7/94 (7%)

Query: 47  LPEDLEQQTRNAIENLRIVLSKSGCSSLDQVVKVLLFVADGKYAPVVNKVYKEYFTN--- 103
            P    +Q  +  + L  +L++ G     QV+   L ++D     +VN VY ++F     
Sbjct: 327 FPGSTVEQASDVFKQLDTILNERGLYP-SQVLSCALILSDISAFALVNDVYNKFFNIWKI 385

Query: 104 ---QPCRSCVVVGFPNEKIKVELECVAEIDKKTR 134
               P RSCV      + + ++L  V +     R
Sbjct: 386 GPLPPSRSCVGSKLLGKDVALQLSVVVDTTALVR 419

>KAFR0H02150 Chr8 complement(406617..408725) [2109 bp, 702 aa] {ON}
           Anc_8.349 YLR143W
          Length = 702

 Score = 28.5 bits (62), Expect = 5.9,   Method: Composition-based stats.
 Identities = 14/44 (31%), Positives = 23/44 (52%), Gaps = 6/44 (13%)

Query: 93  VNKVYKEYFTNQ------PCRSCVVVGFPNEKIKVELECVAEID 130
           VNK+Y E+F         P RSCV      + ++++L  V +I+
Sbjct: 374 VNKIYNEFFNISKWGPLPPSRSCVGSNLLGDNVQLQLSVVIDIN 417

>TDEL0B04630 Chr2 complement(824601..825089) [489 bp, 162 aa] {ON}
           Anc_8.148 YGL187C
          Length = 162

 Score = 28.1 bits (61), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 30/64 (46%), Gaps = 5/64 (7%)

Query: 38  VGTDPKTGELPEDLEQQTRNAIENLRIVLSKSGCSSLDQVVKVLLFVADGKYA-PVVNKV 96
           +G   K GE+P DLEQ T   +E L ++    G    DQ  K L     G    P+V + 
Sbjct: 54  IGPGAKQGEVPTDLEQAT--GLERLELLGKLEGIEIFDQ--KPLDSSRKGTMENPIVVES 109

Query: 97  YKEY 100
           Y +Y
Sbjct: 110 YDDY 113

>KLTH0B09064g Chr2 complement(738472..739206) [735 bp, 244 aa] {ON}
           highly similar to uniprot|P51601 YGR267C Saccharomyces
           cerevisiae FOL2 GTP-cyclohydrolase I
          Length = 244

 Score = 28.1 bits (61), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 17/83 (20%), Positives = 38/83 (45%), Gaps = 8/83 (9%)

Query: 38  VGTDPKTGELPEDLEQQTRNAIENLRIVLSKSG--------CSSLDQVVKVLLFVADGKY 89
           +G+  ++ E PE+ +Q+T    E ++++LS+ G          +  +  K +++   G  
Sbjct: 41  LGSRVRSEESPEETQQRTDRIAEAVKVILSELGEDVSREGLLETPQRYAKAMMYFTKGYQ 100

Query: 90  APVVNKVYKEYFTNQPCRSCVVV 112
             ++N V K     +     V+V
Sbjct: 101 HNIINDVIKNAVFEEDHDEMVIV 123

>Smik_15.433 Chr15 complement(750651..751988) [1338 bp, 445 aa] {ON}
           YOR250C (REAL)
          Length = 445

 Score = 28.1 bits (61), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 23/46 (50%), Gaps = 1/46 (2%)

Query: 30  PLVYTSGCVGTDPKTGELPEDLEQQTRNAIENLRIVLSKSGCSSLD 75
           P V  SGC+   P T +L E+L  +  + IE L I +    CS  D
Sbjct: 241 PQVRRSGCIVDTPATTQLDENL-NELHHIIEKLNINIMLILCSEAD 285

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.133    0.396 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 14,903,763
Number of extensions: 589977
Number of successful extensions: 1619
Number of sequences better than 10.0: 63
Number of HSP's gapped: 1569
Number of HSP's successfully gapped: 63
Length of query: 138
Length of database: 53,481,399
Length adjustment: 98
Effective length of query: 40
Effective length of database: 42,244,131
Effective search space: 1689765240
Effective search space used: 1689765240
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 59 (27.3 bits)