Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0F02640gsingletonON1161166019e-82
SAKL0F02684gna 1ON1381114842e-63
Kwal_55.21247na 1ON1341163201e-38
KLTH0F14916gna 1ON1511112977e-35
Kwal_23.2807singletonON1291132871e-33
ZYRO0C18436gsingletonON1291122852e-33
KLLA0E04005gna 1ON1371112852e-33
KLLA0B14817gsingletonON1311132843e-33
SAKL0F16654gsingletonON1311052774e-32
TDEL0D00210singletonON1301102557e-29
KLTH0C11880gsingletonON1311112541e-28
ZYRO0D09856gna 1ON1561182422e-26
KLTH0E03168gsingletonON1481091984e-20
Kwal_47.16590singletonON126961922e-19
KAFR0L008607.238ON128961165e-08
YER057C (HMF1)7.238ON129981141e-07
ZYRO0C08074g7.238ON143861141e-07
Suva_5.1657.238ON129861113e-07
Skud_5.1717.238ON129981096e-07
Smik_5.1877.238ON129981043e-06
TBLA0D040907.238ON155931036e-06
ADL077C7.238ON142801011e-05
Smik_9.1397.238ON145801001e-05
KAFR0I018307.238ON14384983e-05
YIL051C (MMF1)7.238ON14580983e-05
NDAI0A025507.238ON14480965e-05
NCAS0A134907.238ON14880966e-05
Skud_9.1187.238ON14584957e-05
TDEL0H020607.238ON177102959e-05
Kpol_1009.257.238ON12790931e-04
CAGL0M12386g7.238ON142106931e-04
KNAG0L014507.238ON13196903e-04
NCAS0E032407.238ON12896886e-04
Kwal_23.58047.238ON14180886e-04
NDAI0E047507.238ON128100860.001
TPHA0C011007.238ON142102860.001
TBLA0J014207.238ON12693840.002
Kpol_1033.127.238ON14386840.002
Suva_9.1487.238ON14584840.003
KLLA0C08349g7.238ON14084800.008
SAKL0F08558g7.238ON14484780.016
TPHA0K009207.238ON128101780.017
KLTH0A04224g7.238ON14180760.032
KNAG0D016207.238ON14286730.093
TPHA0G011308.790ON27980700.32
Ecym_62578.751ON27959651.4
TDEL0B046308.148ON16268641.9
KNAG0B045705.355ON95920624.4
Smik_15.4338.690ON44546599.1
Kwal_47.174574.105ON94747599.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0F02640g
         (116 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0F02640g Chr6 complement(227067..227417) [351 bp, 116 aa] {O...   236   9e-82
SAKL0F02684g Chr6 complement(228156..228572) [417 bp, 138 aa] {O...   191   2e-63
Kwal_55.21247 s55 (747831..748235) [405 bp, 134 aa] {ON} YER057C...   127   1e-38
KLTH0F14916g Chr6 (1220286..1220741) [456 bp, 151 aa] {ON} weakl...   119   7e-35
Kwal_23.2807 s23 (20785..21174) [390 bp, 129 aa] {ON} YER057C (H...   115   1e-33
ZYRO0C18436g Chr3 complement(1444072..1444461) [390 bp, 129 aa] ...   114   2e-33
KLLA0E04005g Chr5 complement(364475..364888) [414 bp, 137 aa] {O...   114   2e-33
KLLA0B14817g Chr2 (1301705..1302100) [396 bp, 131 aa] {ON} weakl...   114   3e-33
SAKL0F16654g Chr6 (1378394..1378789) [396 bp, 131 aa] {ON} weakl...   111   4e-32
TDEL0D00210 Chr4 (34669..35061) [393 bp, 130 aa] {ON}                 102   7e-29
KLTH0C11880g Chr3 complement(982966..983361) [396 bp, 131 aa] {O...   102   1e-28
ZYRO0D09856g Chr4 complement(834023..834493) [471 bp, 156 aa] {O...    98   2e-26
KLTH0E03168g Chr5 complement(285658..286104) [447 bp, 148 aa] {O...    81   4e-20
Kwal_47.16590 s47 complement(15715..16095) [381 bp, 126 aa] {ON}...    79   2e-19
KAFR0L00860 Chr12 complement(161978..162364) [387 bp, 128 aa] {O...    49   5e-08
YER057C Chr5 complement(270737..271126) [390 bp, 129 aa] {ON}  H...    49   1e-07
ZYRO0C08074g Chr3 complement(619866..620297) [432 bp, 143 aa] {O...    49   1e-07
Suva_5.165 Chr5 complement(246850..247239) [390 bp, 129 aa] {ON}...    47   3e-07
Skud_5.171 Chr5 complement(266894..267283) [390 bp, 129 aa] {ON}...    47   6e-07
Smik_5.187 Chr5 complement(274856..275245) [390 bp, 129 aa] {ON}...    45   3e-06
TBLA0D04090 Chr4 (1016159..1016626) [468 bp, 155 aa] {ON} Anc_7....    44   6e-06
ADL077C Chr4 complement(549523..549951) [429 bp, 142 aa] {ON} Sy...    44   1e-05
Smik_9.139 Chr9 complement(231954..232391) [438 bp, 145 aa] {ON}...    43   1e-05
KAFR0I01830 Chr9 complement(375688..376119) [432 bp, 143 aa] {ON...    42   3e-05
YIL051C Chr9 complement(257843..258280) [438 bp, 145 aa] {ON}  M...    42   3e-05
NDAI0A02550 Chr1 complement(570003..570437) [435 bp, 144 aa] {ON...    42   5e-05
NCAS0A13490 Chr1 (2655822..2656268) [447 bp, 148 aa] {ON} Anc_7....    42   6e-05
Skud_9.118 Chr9 complement(226723..227160) [438 bp, 145 aa] {ON}...    41   7e-05
TDEL0H02060 Chr8 (350315..350848) [534 bp, 177 aa] {ON} Anc_7.23...    41   9e-05
Kpol_1009.25 s1009 complement(58847..59230) [384 bp, 127 aa] {ON...    40   1e-04
CAGL0M12386g Chr13 (1236543..1236971) [429 bp, 142 aa] {ON} simi...    40   1e-04
KNAG0L01450 Chr12 complement(258500..258895) [396 bp, 131 aa] {O...    39   3e-04
NCAS0E03240 Chr5 (641701..642087) [387 bp, 128 aa] {ON} Anc_7.238      39   6e-04
Kwal_23.5804 s23 complement(1324907..1325332) [426 bp, 141 aa] {...    39   6e-04
NDAI0E04750 Chr5 complement(1071393..1071779) [387 bp, 128 aa] {...    38   0.001
TPHA0C01100 Chr3 (250318..250746) [429 bp, 142 aa] {ON} Anc_7.23...    38   0.001
TBLA0J01420 Chr10 (325885..326265) [381 bp, 126 aa] {ON} Anc_7.2...    37   0.002
Kpol_1033.12 s1033 complement(28172..28603) [432 bp, 143 aa] {ON...    37   0.002
Suva_9.148 Chr9 complement(246539..246976) [438 bp, 145 aa] {ON}...    37   0.003
KLLA0C08349g Chr3 (731629..732051) [423 bp, 140 aa] {ON} similar...    35   0.008
SAKL0F08558g Chr6 complement(654765..655199) [435 bp, 144 aa] {O...    35   0.016
TPHA0K00920 Chr11 (190389..190775) [387 bp, 128 aa] {ON} Anc_7.2...    35   0.017
KLTH0A04224g Chr1 complement(356660..357085) [426 bp, 141 aa] {O...    34   0.032
KNAG0D01620 Chr4 complement(272653..273081) [429 bp, 142 aa] {ON...    33   0.093
TPHA0G01130 Chr7 (229626..230465) [840 bp, 279 aa] {ON} Anc_8.79...    32   0.32 
Ecym_6257 Chr6 (478865..479704) [840 bp, 279 aa] {ON} similar to...    30   1.4  
TDEL0B04630 Chr2 complement(824601..825089) [489 bp, 162 aa] {ON...    29   1.9  
KNAG0B04570 Chr2 complement(881733..884612) [2880 bp, 959 aa] {O...    28   4.4  
Smik_15.433 Chr15 complement(750651..751988) [1338 bp, 445 aa] {...    27   9.1  
Kwal_47.17457 s47 (410267..413110) [2844 bp, 947 aa] {ON} YGL016...    27   9.3  

>SAKL0F02640g Chr6 complement(227067..227417) [351 bp, 116 aa] {ON}
           some similarities with uniprot|P40037 Saccharomyces
           cerevisiae YER057C HMF1 Member of the p14.5 protein
           family with similarity to Mmf1p, functionally
           complements Mmf1p function when targeted to mitochondria
          Length = 116

 Score =  236 bits (601), Expect = 9e-82,   Method: Compositional matrix adjust.
 Identities = 116/116 (100%), Positives = 116/116 (100%)

Query: 1   MFSSAFISTSNTPLVYTSGCVGTDPKTGELPEDLEQQTRNAIENLRIVLSKSGCSSLDQV 60
           MFSSAFISTSNTPLVYTSGCVGTDPKTGELPEDLEQQTRNAIENLRIVLSKSGCSSLDQV
Sbjct: 1   MFSSAFISTSNTPLVYTSGCVGTDPKTGELPEDLEQQTRNAIENLRIVLSKSGCSSLDQV 60

Query: 61  VKVLLFVADGKYVPVANKVYKDYFTNRSCKSSAVVGFTNEGIKIEPGSVAKSSEAE 116
           VKVLLFVADGKYVPVANKVYKDYFTNRSCKSSAVVGFTNEGIKIEPGSVAKSSEAE
Sbjct: 61  VKVLLFVADGKYVPVANKVYKDYFTNRSCKSSAVVGFTNEGIKIEPGSVAKSSEAE 116

>SAKL0F02684g Chr6 complement(228156..228572) [417 bp, 138 aa] {ON}
           conserved hypothetical protein
          Length = 138

 Score =  191 bits (484), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 91/111 (81%), Positives = 99/111 (89%)

Query: 1   MFSSAFISTSNTPLVYTSGCVGTDPKTGELPEDLEQQTRNAIENLRIVLSKSGCSSLDQV 60
           + S AF++TSNTPLVYTSGCVGTDPKTGELPEDLEQQTRNAIENLRIVLSKSGCSSLDQV
Sbjct: 18  LLSPAFVTTSNTPLVYTSGCVGTDPKTGELPEDLEQQTRNAIENLRIVLSKSGCSSLDQV 77

Query: 61  VKVLLFVADGKYVPVANKVYKDYFTNRSCKSSAVVGFTNEGIKIEPGSVAK 111
           VKVLLFVADGKY PV NKVYK+YFTN+ C+S  VVGF NE IK+E   VA+
Sbjct: 78  VKVLLFVADGKYAPVVNKVYKEYFTNQPCRSCVVVGFPNEKIKVELECVAE 128

>Kwal_55.21247 s55 (747831..748235) [405 bp, 134 aa] {ON} YER057C
           (HMF1) - heat-regulated protein [contig 130] FULL
          Length = 134

 Score =  127 bits (320), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 65/116 (56%), Positives = 84/116 (72%), Gaps = 2/116 (1%)

Query: 1   MFSSAFISTSNTPLVYTSGCVGTDPKTGELPEDLEQQTRNAIENLRIVLSKSGCSSLDQV 60
           + + A++ TSN+ LV+TSGCVGTDP TGELP DLEQQ RNA+ENL+ VL  SG SSL+QV
Sbjct: 18  ILAPAYV-TSNSDLVFTSGCVGTDPVTGELPTDLEQQVRNALENLKNVLRASG-SSLEQV 75

Query: 61  VKVLLFVADGKYVPVANKVYKDYFTNRSCKSSAVVGFTNEGIKIEPGSVAKSSEAE 116
           +KVLLFV+DG Y P  NKVY +YF     +S  VV F N  +K+E   +A++  A+
Sbjct: 76  IKVLLFVSDGSYAPAVNKVYSEYFPGAPARSCIVVSFPNASLKVELECIAEAGPAK 131

>KLTH0F14916g Chr6 (1220286..1220741) [456 bp, 151 aa] {ON} weakly
           similar to uniprot|P40185 Saccharomyces cerevisiae
           YIL051C MMF1 Mitochondrial protein involved in
           maintenance of the mitochondrial genome and weakly
           similar to YER057C uniprot|P40037 Saccharomyces
           cerevisiae YER057C HMF1 Member of the p14.5 protein
           family with similarity to Mmf1p, functionally
           complements Mmf1p function when targeted to
           mitochondria; heat shock inducible; high- dosage growth
           inhibitor; forms a homotrimer in vitro
          Length = 151

 Score =  119 bits (297), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 79/111 (71%), Gaps = 2/111 (1%)

Query: 1   MFSSAFISTSNTPLVYTSGCVGTDPKTGELPEDLEQQTRNAIENLRIVLSKSGCSSLDQV 60
           + S AF+ TS + LV+TSGC+G+DP T ELPEDLEQQ RNA++NLR VL  SG +S D+V
Sbjct: 33  LLSPAFV-TSGSKLVFTSGCIGSDPVTDELPEDLEQQARNALQNLRNVLEASGSNS-DRV 90

Query: 61  VKVLLFVADGKYVPVANKVYKDYFTNRSCKSSAVVGFTNEGIKIEPGSVAK 111
           +KVLLFVADG Y    N++Y++ F N   +S  VV F N  IK+E   +A+
Sbjct: 91  LKVLLFVADGAYSQTVNRIYREQFPNSPARSCVVVSFPNPKIKVELECIAE 141

>Kwal_23.2807 s23 (20785..21174) [390 bp, 129 aa] {ON} YER057C
           (HMF1) - heat-regulated protein [contig 246] FULL
          Length = 129

 Score =  115 bits (287), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 58/113 (51%), Positives = 78/113 (69%), Gaps = 1/113 (0%)

Query: 1   MFSSAFISTSNTPLVYTSGCVGTDPKTGELPEDLEQQTRNAIENLRIVLSKSGCSSLDQV 60
           + S A++++ +  LV+TSGCVGTDP TG LPEDLEQQ  NA+ENL+ VL  SG SSL++V
Sbjct: 18  ILSPAYVASKSNDLVFTSGCVGTDPVTGNLPEDLEQQIINALENLKNVLHASG-SSLERV 76

Query: 61  VKVLLFVADGKYVPVANKVYKDYFTNRSCKSSAVVGFTNEGIKIEPGSVAKSS 113
           +KVLLFV+D  Y    N+VY  YF N   +S  VV F    +K+E   +A++S
Sbjct: 77  LKVLLFVSDASYASTVNEVYSRYFPNAPARSCIVVAFPAPALKVELECIAEAS 129

>ZYRO0C18436g Chr3 complement(1444072..1444461) [390 bp, 129 aa]
           {ON} similar to uniprot|P40037 Saccharomyces cerevisiae
           YER057C
          Length = 129

 Score =  114 bits (285), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 56/112 (50%), Positives = 78/112 (69%), Gaps = 1/112 (0%)

Query: 1   MFSSAFISTSNTPLVYTSGCVGTDPKTGELPEDLEQQTRNAIENLRIVLSKSGCSSLDQV 60
           + S A+++     LV+TSGCVGTDPKTG L E+L+QQ RNA+ENL+ VL  SG SS+D V
Sbjct: 18  LLSPAYVTADAKKLVFTSGCVGTDPKTGTLAEELDQQVRNALENLKNVLKASG-SSIDNV 76

Query: 61  VKVLLFVADGKYVPVANKVYKDYFTNRSCKSSAVVGFTNEGIKIEPGSVAKS 112
           +KVLLFVADG +    NK+Y++YF     +S  VV F +  +K+E   +A++
Sbjct: 77  LKVLLFVADGSFAAPVNKIYQEYFPGAPARSCIVVSFPDPKLKVELECIAQT 128

>KLLA0E04005g Chr5 complement(364475..364888) [414 bp, 137 aa] {ON}
           weakly similar to uniprot|P40185 Saccharomyces
           cerevisiae YIL051C MMF1 Mitochondrial protein involved
           in maintenance of the mitochondrial genome and weakly
           similar to YER057C uniprot|P40037 Saccharomyces
           cerevisiae YER057C HMF1 Member of the p14.5 protein
           family with similarity to Mmf1p, functionally
           complements Mmf1p function when targeted to
           mitochondria; heat shock inducible; high- dosage growth
           inhibitor; forms a homotrimer in vitro
          Length = 137

 Score =  114 bits (285), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 56/111 (50%), Positives = 78/111 (70%), Gaps = 1/111 (0%)

Query: 1   MFSSAFISTSNTPLVYTSGCVGTDPKTGELPEDLEQQTRNAIENLRIVLSKSGCSSLDQV 60
           + S  F + S   L+++SGCVGTDP T ELPEDLEQQ RN++ NL+ VL  SG SS+D V
Sbjct: 18  LISPGFATESGNQLLFSSGCVGTDPVTNELPEDLEQQARNSMINLKKVLEVSG-SSVDSV 76

Query: 61  VKVLLFVADGKYVPVANKVYKDYFTNRSCKSSAVVGFTNEGIKIEPGSVAK 111
           +K+LLFV+DG Y  + NKV+K++F N+  +S  VV F N  +K+E   +A+
Sbjct: 77  LKILLFVSDGSYAGIVNKVFKEFFPNQPARSCIVVAFPNNKLKVELECIAE 127

>KLLA0B14817g Chr2 (1301705..1302100) [396 bp, 131 aa] {ON} weakly
           similar to uniprot|P40185 Saccharomyces cerevisiae
           YIL051C MMF1 Mitochondrial protein involved in
           maintenance of the mitochondrial genome and weakly
           similar to YER057C uniprot|P40037 Saccharomyces
           cerevisiae YER057C HMF1 Member of the p14.5 protein
           family with similarity to Mmf1p, functionally
           complements Mmf1p function when targeted to
           mitochondria; heat shock inducible; high- dosage growth
           inhibitor; forms a homotrimer in vitro
          Length = 131

 Score =  114 bits (284), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 58/113 (51%), Positives = 77/113 (68%), Gaps = 1/113 (0%)

Query: 1   MFSSAFISTSNTPLVYTSGCVGTDPKTGELPEDLEQQTRNAIENLRIVLSKSGCSSLDQV 60
             + A++++ +T LVYTSGCVG+D  TGE+PEDLE+Q RNA++NL  VL K+  SS D V
Sbjct: 18  FLAPAYVTSKDTELVYTSGCVGSDLLTGEIPEDLEKQVRNALDNLGRVL-KASNSSFDDV 76

Query: 61  VKVLLFVADGKYVPVANKVYKDYFTNRSCKSSAVVGFTNEGIKIEPGSVAKSS 113
           +K+LLFVADG Y    N VYK+YF  R  +S  VV F +  +K+E   VA  S
Sbjct: 77  LKILLFVADGSYASTVNAVYKEYFPERPARSCIVVSFPDPTLKVELECVAAVS 129

>SAKL0F16654g Chr6 (1378394..1378789) [396 bp, 131 aa] {ON} weakly
           similar to uniprot|P40037 Saccharomyces cerevisiae
           YER057C HMF1
          Length = 131

 Score =  111 bits (277), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 74/105 (70%), Gaps = 1/105 (0%)

Query: 1   MFSSAFISTSNTPLVYTSGCVGTDPKTGELPEDLEQQTRNAIENLRIVLSKSGCSSLDQV 60
           + S  FI + +  +++TSG VGTDPK+GE+PEDL  QT+NA+ENL+  L ++G SSLD V
Sbjct: 18  LLSPGFICSKDEDILFTSGNVGTDPKSGEVPEDLRAQTKNALENLKTTL-EAGGSSLDNV 76

Query: 61  VKVLLFVADGKYVPVANKVYKDYFTNRSCKSSAVVGFTNEGIKIE 105
           +KVLLFVADG Y    N+VYK+YF     +S  VV F +  +K+E
Sbjct: 77  LKVLLFVADGSYAATVNEVYKEYFPGSPARSCIVVSFPDPKLKLE 121

>TDEL0D00210 Chr4 (34669..35061) [393 bp, 130 aa] {ON} 
          Length = 130

 Score =  102 bits (255), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 75/110 (68%), Gaps = 2/110 (1%)

Query: 1   MFSSAFISTSNTPLVYTSGCVGTDPKTGELPEDLEQQTRNAIENLRIVLSKSGCSSLDQV 60
           + S  +++  N+ L++TSGCVGTD K+G+L E +E QT+ A+ENL++VL ++G SSL  V
Sbjct: 17  LLSPGYVTAKNSQLLFTSGCVGTD-KSGKLAEGVEAQTKLALENLKVVL-EAGGSSLSNV 74

Query: 61  VKVLLFVADGKYVPVANKVYKDYFTNRSCKSSAVVGFTNEGIKIEPGSVA 110
           +KVLLFV DG Y    N VY++YF  R  +S  VV F +  IK+E   VA
Sbjct: 75  LKVLLFVGDGSYASAVNSVYQEYFPGRPGRSCVVVAFPDPAIKVELECVA 124

>KLTH0C11880g Chr3 complement(982966..983361) [396 bp, 131 aa] {ON}
           conserved hypothetical protein
          Length = 131

 Score =  102 bits (254), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 51/111 (45%), Positives = 71/111 (63%), Gaps = 1/111 (0%)

Query: 1   MFSSAFISTSNTPLVYTSGCVGTDPKTGELPEDLEQQTRNAIENLRIVLSKSGCSSLDQV 60
             S   +S+ N  L++TSGCVG DP TGE PED+E Q RNA+EN++ VL +S  S+ D V
Sbjct: 18  FLSPGCVSSKNCDLLFTSGCVGNDPITGEYPEDVESQARNAMENMKRVL-ESASSNFDYV 76

Query: 61  VKVLLFVADGKYVPVANKVYKDYFTNRSCKSSAVVGFTNEGIKIEPGSVAK 111
           +K LLF++D  Y    NKVY+++F  R  +S  VV F +  +K E   VA+
Sbjct: 77  LKALLFISDPSYASAVNKVYQEFFPGRPSRSCIVVSFPDPKLKFEMECVAE 127

>ZYRO0D09856g Chr4 complement(834023..834493) [471 bp, 156 aa] {ON}
           some similarities with uniprot|P40185 Saccharomyces
           cerevisiae YIL051C MMF1
          Length = 156

 Score = 97.8 bits (242), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 56/118 (47%), Positives = 76/118 (64%), Gaps = 4/118 (3%)

Query: 1   MFSSAFISTSNTPLVYTSGCVGTDPKTGELPEDLEQQTRNAIENLRIVLSKSGCSSLDQV 60
           + S AF+ +S   LV+TSGC+GTD +  +LPE   +QT+NA ENL  VL  SG SSL  V
Sbjct: 40  LLSPAFVVSSAHHLVFTSGCLGTDDQ-DQLPECPAEQTKNAFENLSKVLEASG-SSLSSV 97

Query: 61  VKVLLFVADGKYVPVANKVYKDYFTNRSCKSSAVVGFTNEGIKIEPGSVA--KSSEAE 116
           +KVLLFV D   VPV N++Y+ YF  +  +S  VV F N  +++E   VA  KS E++
Sbjct: 98  IKVLLFVKDPALVPVVNRIYQKYFPEKPARSCIVVAFPNPKVQVELECVAVTKSRESK 155

>KLTH0E03168g Chr5 complement(285658..286104) [447 bp, 148 aa] {ON}
           conserved hypothetical protein
          Length = 148

 Score = 80.9 bits (198), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 44/109 (40%), Positives = 66/109 (60%), Gaps = 4/109 (3%)

Query: 2   FSSAFISTSNTPLVYTSGCVGTDPKTGELPEDLEQQTRNAIENLRIVLSKSGCSSLDQVV 61
            S AF+S  +   V+TSG +G+   TGE+ + +E Q   AI+NL  VL+ +G SSL+QV 
Sbjct: 41  LSPAFVSNGH---VFTSGIIGSKYGTGEVSQQIEDQVHLAIQNLENVLAVAG-SSLEQVF 96

Query: 62  KVLLFVADGKYVPVANKVYKDYFTNRSCKSSAVVGFTNEGIKIEPGSVA 110
           KV +F++  +Y  V N++Y  YF  +  +S  VV F +  IK E  +VA
Sbjct: 97  KVTMFISHAEYSKVVNEIYGQYFPQKPARSCVVVAFMDAAIKYELEAVA 145

>Kwal_47.16590 s47 complement(15715..16095) [381 bp, 126 aa] {ON}
           YER057C (HMF1) - heat-regulated protein [contig 376]
           FULL
          Length = 126

 Score = 78.6 bits (192), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 39/96 (40%), Positives = 59/96 (61%), Gaps = 1/96 (1%)

Query: 15  VYTSGCVGTDPKTGELPEDLEQQTRNAIENLRIVLSKSGCSSLDQVVKVLLFVADGKYVP 74
           V+TSG +G +  TGE+P ++E Q   AI+NL  VL  +G SSL +V KV +F++   Y  
Sbjct: 29  VFTSGIIGANYGTGEVPHEIEDQVHLAIKNLETVLV-AGGSSLSKVFKVTMFISHADYSK 87

Query: 75  VANKVYKDYFTNRSCKSSAVVGFTNEGIKIEPGSVA 110
           V N++Y  YF ++  +S  VV F +  IK E  ++A
Sbjct: 88  VVNEIYGHYFPHKPARSCVVVAFMDAAIKYELEAIA 123

>KAFR0L00860 Chr12 complement(161978..162364) [387 bp, 128 aa] {ON}
           Anc_7.238 YIL051C
          Length = 128

 Score = 49.3 bits (116), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 33/96 (34%), Positives = 51/96 (53%), Gaps = 6/96 (6%)

Query: 14  LVYTSGCVGTDPKTGELPEDLEQQTRNAIENLRIVLSKSGCSSLDQVVKVLLFVADGKYV 73
           ++Y SG +   P    +   +  +T   +EN++ VL K+  SSL+ +VKV +F+AD KY 
Sbjct: 28  MIYLSGQIPLTPDGKPVEGSIADKTTQVLENIKTVL-KASNSSLENIVKVNIFLADIKYF 86

Query: 74  PVANKVYKDYFT----NRSCKSSAVVGFTNEGIKIE 105
              N VY  YF      RSC + A +   N  ++IE
Sbjct: 87  SELNVVYAKYFKAHKPARSCVAVAALPL-NADLEIE 121

>YER057C Chr5 complement(270737..271126) [390 bp, 129 aa] {ON}
           HMF1Member of the p14.5 protein family with similarity
           to Mmf1p, functionally complements Mmf1p function when
           targeted to mitochondria; heat shock inducible;
           high-dosage growth inhibitor; forms a homotrimer in
           vitro
          Length = 129

 Score = 48.5 bits (114), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 31/98 (31%), Positives = 51/98 (52%), Gaps = 2/98 (2%)

Query: 14  LVYTSGCVGTDPKTGELPEDLEQQTRNAIENLRIVLSKSGCSSLDQVVKVLLFVADGKYV 73
           L++ SG +   P    +   +  +    I+N++ VL  S  SSLD+VVKV +F+AD  + 
Sbjct: 29  LIFLSGQIPVTPDNKLVEGSIADKAEQVIQNIKNVLEASN-SSLDRVVKVNIFLADINHF 87

Query: 74  PVANKVYKDYF-TNRSCKSSAVVGFTNEGIKIEPGSVA 110
              N VY  YF T++  +S   V     G+ +E  ++A
Sbjct: 88  AEFNSVYAKYFNTHKPARSCVAVAALPLGVDMEMEAIA 125

>ZYRO0C08074g Chr3 complement(619866..620297) [432 bp, 143 aa] {ON}
           similar to uniprot|P40185 Saccharomyces cerevisiae
           YIL051C MMF1 Mitochondrial protein involved in
           maintenance of the mitochondrial genome and similar to
           YER057C uniprot|P40037 Saccharomyces cerevisiae YER057C
           HMF1 Member of the p14.5 protein family with similarity
           to Mmf1p, functionally complements Mmf1p function when
           targeted to mitochondria; heat shock inducible; high-
           dosage growth inhibitor; forms a homotrimer in vitro
          Length = 143

 Score = 48.5 bits (114), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 30/86 (34%), Positives = 47/86 (54%), Gaps = 5/86 (5%)

Query: 14  LVYTSGCVGTDPKTGELPEDLEQQTRNAIENLRIVLSKSGCSSLDQVVKVLLFVADGKYV 73
           L++ SG +   P    +   +  +T     N++ +L ++G SSL++VVKV +F+AD KY 
Sbjct: 43  LLFVSGQIPYTPDNKPVEGSISDKTEQVFSNVKSIL-QAGNSSLERVVKVNVFLADIKYF 101

Query: 74  PVANKVYKDYFTN----RSCKSSAVV 95
              NKVY  YF      RSC + A +
Sbjct: 102 EEFNKVYAKYFNEHQPARSCVAVAAL 127

>Suva_5.165 Chr5 complement(246850..247239) [390 bp, 129 aa] {ON}
           YER057C (REAL)
          Length = 129

 Score = 47.4 bits (111), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 29/86 (33%), Positives = 46/86 (53%), Gaps = 5/86 (5%)

Query: 14  LVYTSGCVGTDPKTGELPEDLEQQTRNAIENLRIVLSKSGCSSLDQVVKVLLFVADGKYV 73
           L++ SG +        +   +  +    I+N++ VL+ S  SSLD+++KV +F+AD KY 
Sbjct: 29  LIFLSGQIPMTSDNKLVEGSIADKAEQVIQNIKDVLAASN-SSLDRIIKVNIFLADIKYF 87

Query: 74  PVANKVYKDYFTN----RSCKSSAVV 95
              N VY  YFT     RSC + A +
Sbjct: 88  AEFNSVYAKYFTTHKPARSCVAVAAL 113

>Skud_5.171 Chr5 complement(266894..267283) [390 bp, 129 aa] {ON}
           YER057C (REAL)
          Length = 129

 Score = 46.6 bits (109), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 30/98 (30%), Positives = 52/98 (53%), Gaps = 2/98 (2%)

Query: 14  LVYTSGCVGTDPKTGELPEDLEQQTRNAIENLRIVLSKSGCSSLDQVVKVLLFVADGKYV 73
           L++ SG +        +   + ++    ++N++ VL  S  SSLD+VVKV +F+AD K+ 
Sbjct: 29  LIFLSGQIPVTQDNKLVEGSIAEKAEQVLQNVKNVLESSN-SSLDRVVKVNIFLADIKHF 87

Query: 74  PVANKVYKDYF-TNRSCKSSAVVGFTNEGIKIEPGSVA 110
              N VY  YF T++  +S   V     G+ +E  ++A
Sbjct: 88  AEFNSVYAKYFHTHKPARSCVAVAALPLGVDMEMEAIA 125

>Smik_5.187 Chr5 complement(274856..275245) [390 bp, 129 aa] {ON}
           YER057C (REAL)
          Length = 129

 Score = 44.7 bits (104), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 30/98 (30%), Positives = 50/98 (51%), Gaps = 2/98 (2%)

Query: 14  LVYTSGCVGTDPKTGELPEDLEQQTRNAIENLRIVLSKSGCSSLDQVVKVLLFVADGKYV 73
           L++ SG +        +   +  +    I+N++ VL  S  SSLD+VVKV +F+AD  + 
Sbjct: 29  LIFLSGQIPVTSDNKLVEGSIADKAEQVIQNIKNVLESSN-SSLDRVVKVNIFLADINHF 87

Query: 74  PVANKVYKDYF-TNRSCKSSAVVGFTNEGIKIEPGSVA 110
              N VY  YF T++  +S   V     G+ +E  ++A
Sbjct: 88  AEFNTVYAKYFSTHKPARSCVAVAALPLGVDMEMEAIA 125

>TBLA0D04090 Chr4 (1016159..1016626) [468 bp, 155 aa] {ON} Anc_7.238
           YIL051C
          Length = 155

 Score = 44.3 bits (103), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 47/93 (50%), Gaps = 5/93 (5%)

Query: 7   ISTSNTPLVYTSGCVGTDPKTGELPEDLEQQTRNAIENLRIVLSKSGCSSLDQVVKVLLF 66
           ++T    L+Y SG +   P    +   +  +     +N+  +L KSG SSL++VVKV +F
Sbjct: 46  VNTQFNELLYVSGQIPFTPDNKPVEGSISDKAEQVFQNVENIL-KSGNSSLNEVVKVNVF 104

Query: 67  VADGKYVPVANKVYKDYFT----NRSCKSSAVV 95
           + D       NKVY  YFT     RSC + A +
Sbjct: 105 LKDIDNFAEFNKVYAKYFTVHKPARSCVAVAAL 137

>ADL077C Chr4 complement(549523..549951) [429 bp, 142 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL051C
           (MMF1) and YER057C (HMF1)
          Length = 142

 Score = 43.5 bits (101), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 39/80 (48%), Gaps = 5/80 (6%)

Query: 14  LVYTSGCVGTDPKTGELPEDLEQQTRNAIENLRIVLSKSGCSSLDQVVKVLLFVADGKYV 73
           +V+ SG +   P    +   +  +T   I N+R VL  S  S LD+V KV +F+AD  Y 
Sbjct: 42  MVFVSGQIPYTPDNKPVEGSVADKTEQVIANVRNVLEASN-SGLDRVAKVNVFLADMAYF 100

Query: 74  PVANKVYKDYFTN----RSC 89
              N VY  YF      RSC
Sbjct: 101 AEFNSVYAKYFGEHKPARSC 120

>Smik_9.139 Chr9 complement(231954..232391) [438 bp, 145 aa] {ON}
           YIL051C (REAL)
          Length = 145

 Score = 43.1 bits (100), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 41/80 (51%), Gaps = 5/80 (6%)

Query: 14  LVYTSGCVGTDPKTGELPEDLEQQTRNAIENLRIVLSKSGCSSLDQVVKVLLFVADGKYV 73
            VY SG +   P+   +   +  +     +N++ +L++S  SSLD +VKV +F+AD K  
Sbjct: 45  FVYVSGQIPYTPENKPVQGSISDKAEQVFQNVKNILAESN-SSLDNIVKVNVFLADMKNF 103

Query: 74  PVANKVYKDYFTN----RSC 89
              N VY  YF      RSC
Sbjct: 104 GEFNSVYAKYFHTHKPARSC 123

>KAFR0I01830 Chr9 complement(375688..376119) [432 bp, 143 aa] {ON}
           Anc_7.238 YIL051C
          Length = 143

 Score = 42.4 bits (98), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 42/84 (50%), Gaps = 5/84 (5%)

Query: 14  LVYTSGCVGTDPKTGELPEDLEQQTRNAIENLRIVLSKSGCSSLDQVVKVLLFVADGKYV 73
            VY SG +   P    +   L  +     +N++ +L  S  SS++++VKV +F+AD K+ 
Sbjct: 43  FVYVSGQIPYTPDNKPVEGTLSDKANQVFQNVKNILEASN-SSMNKIVKVNVFLADMKFF 101

Query: 74  PVANKVYKDYFT----NRSCKSSA 93
              N VY  YF      RSC + A
Sbjct: 102 QEFNSVYAKYFNVHKPARSCVAVA 125

>YIL051C Chr9 complement(257843..258280) [438 bp, 145 aa] {ON}
           MMF1Mitochondrial protein required for transamination of
           isoleucine but not of valine or leucine; may regulate
           specificity of branched-chain transaminases Bat1p and
           Bat2p; interacts genetically with mitochondrial
           ribosomal protein genes
          Length = 145

 Score = 42.4 bits (98), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 41/80 (51%), Gaps = 5/80 (6%)

Query: 14  LVYTSGCVGTDPKTGELPEDLEQQTRNAIENLRIVLSKSGCSSLDQVVKVLLFVADGKYV 73
            VY SG +   P    +   + ++     +N++ +L++S  SSLD +VKV +F+AD K  
Sbjct: 45  FVYVSGQIPYTPDNKPVQGSISEKAEQVFQNVKNILAESN-SSLDNIVKVNVFLADMKNF 103

Query: 74  PVANKVYKDYFTN----RSC 89
              N VY  +F      RSC
Sbjct: 104 AEFNSVYAKHFHTHKPARSC 123

>NDAI0A02550 Chr1 complement(570003..570437) [435 bp, 144 aa] {ON}
           Anc_7.238
          Length = 144

 Score = 41.6 bits (96), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 39/80 (48%), Gaps = 5/80 (6%)

Query: 14  LVYTSGCVGTDPKTGELPEDLEQQTRNAIENLRIVLSKSGCSSLDQVVKVLLFVADGKYV 73
            VY SG +   P+   +   +  +     +N+R +L  S  SSLD++VKV +F+AD    
Sbjct: 45  FVYVSGQIPYTPENKPVEGSISDKAEQVFQNVRNILEASN-SSLDKIVKVNVFLADINNF 103

Query: 74  PVANKVYKDYFTN----RSC 89
              N VY  YF      RSC
Sbjct: 104 KEFNGVYAKYFNTHKPARSC 123

>NCAS0A13490 Chr1 (2655822..2656268) [447 bp, 148 aa] {ON} Anc_7.238
          Length = 148

 Score = 41.6 bits (96), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 41/80 (51%), Gaps = 5/80 (6%)

Query: 14  LVYTSGCVGTDPKTGELPEDLEQQTRNAIENLRIVLSKSGCSSLDQVVKVLLFVADGKYV 73
            VY SG +   P+   +   +  +     +N++ +L +SG SS+D++VKV +F+AD    
Sbjct: 45  FVYVSGQIPYTPENKPVEGTISDKAEQVFQNIKNILKESG-SSMDKIVKVNVFLADINNF 103

Query: 74  PVANKVYKDYFT----NRSC 89
              N VY  YF      RSC
Sbjct: 104 KEFNGVYAKYFNVHKPARSC 123

>Skud_9.118 Chr9 complement(226723..227160) [438 bp, 145 aa] {ON}
           YIL051C (REAL)
          Length = 145

 Score = 41.2 bits (95), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 30/84 (35%), Positives = 42/84 (50%), Gaps = 13/84 (15%)

Query: 14  LVYTSGCV----GTDPKTGELPEDLEQQTRNAIENLRIVLSKSGCSSLDQVVKVLLFVAD 69
            VY SG +       P  G + +  EQ      +N++ +L++S  SSLD +VKV +F+AD
Sbjct: 45  FVYVSGQIPYTAANKPVQGSISDKAEQ----VFQNVKNILAESN-SSLDNIVKVNVFLAD 99

Query: 70  GKYVPVANKVYKDYFTN----RSC 89
            K     N VY  YF      RSC
Sbjct: 100 MKNFAEFNSVYAKYFHTHKPARSC 123

>TDEL0H02060 Chr8 (350315..350848) [534 bp, 177 aa] {ON} Anc_7.238
           YIL051C
          Length = 177

 Score = 41.2 bits (95), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 28/102 (27%), Positives = 50/102 (49%), Gaps = 2/102 (1%)

Query: 14  LVYTSGCVGTDPKTGELPEDLEQQTRNAIENLRIVLSKSGCSSLDQVVKVLLFVADGKYV 73
           L++ SG +   P+   +   +  +     +N+R +L  S  SS ++V+KV +F+AD    
Sbjct: 71  LIFVSGQIPYTPENKPVEGSIADKAEQVFKNVRNILEASD-SSFERVIKVNVFLADINNF 129

Query: 74  PVANKVYKDYF-TNRSCKSSAVVGFTNEGIKIEPGSVAKSSE 114
              NKVY  YF T++  +S   V      + +E   +A  +E
Sbjct: 130 AEFNKVYAKYFSTHKPARSCVAVAALPLNVDLEMEVIATENE 171

>Kpol_1009.25 s1009 complement(58847..59230) [384 bp, 127 aa] {ON}
           complement(58847..59230) [384 nt, 128 aa]
          Length = 127

 Score = 40.4 bits (93), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/90 (28%), Positives = 46/90 (51%), Gaps = 5/90 (5%)

Query: 14  LVYTSGCVGTDPKTGELPEDLEQQTRNAIENLRIVLSKSGCSSLDQVVKVLLFVADGKYV 73
           ++Y SG +    +   +   +  Q    I+N++ +L +S  SSL+++VKV +F+ D  + 
Sbjct: 28  MIYVSGQIPYTKENKPIGGTVSDQAEQMIQNVKNIL-ESANSSLNKIVKVNVFLTDMNHF 86

Query: 74  PVANKVYKDYFTN----RSCKSSAVVGFTN 99
              N VY  YF+     RSC + A +   N
Sbjct: 87  QEFNVVYAKYFSEHKPARSCVAVAALPLDN 116

>CAGL0M12386g Chr13 (1236543..1236971) [429 bp, 142 aa] {ON} similar
           to uniprot|P40037 Saccharomyces cerevisiae YER057c HIG1
           Heat-shock induceable Inhibiter of cell Growth
          Length = 142

 Score = 40.4 bits (93), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 51/106 (48%), Gaps = 10/106 (9%)

Query: 14  LVYTSGCV----GTDPKTGELPEDLEQQTRNAIENLRIVLSKSGCSSLDQVVKVLLFVAD 69
           L+Y SG +       P  G + +  EQ     I+N++ +L  S  S L+++VKV +F+AD
Sbjct: 42  LIYVSGQIPYTKDNKPVEGSISDKAEQ----VIQNVQNILKDSN-SDLNRIVKVNIFLAD 96

Query: 70  GKYVPVANKVYKDYF-TNRSCKSSAVVGFTNEGIKIEPGSVAKSSE 114
                  NKVY  YF  ++  +S   V     G+ +E   +A   E
Sbjct: 97  MNNFAEFNKVYAKYFNVHKPARSCVAVAALPLGVDLEMEVIATEVE 142

>KNAG0L01450 Chr12 complement(258500..258895) [396 bp, 131 aa] {ON}
           Anc_7.238 YIL051C
          Length = 131

 Score = 39.3 bits (90), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 48/96 (50%), Gaps = 6/96 (6%)

Query: 14  LVYTSGCVGTDPKTGELPEDLEQQTRNAIENLRIVLSKSGCSSLDQVVKVLLFVADGKYV 73
           LV+ SG V        L   + ++    I N++ +L+ S  S+LD+VVK  +F+AD    
Sbjct: 30  LVFVSGQVPLTADNKMLEGSIAEKAEQVITNIKTILAASN-SALDRVVKCNIFLADINNF 88

Query: 74  PVANKVYKDYFTN----RSCKSSAVVGFTNEGIKIE 105
              N VY  +F +    RSC + A +   N  +++E
Sbjct: 89  AEFNTVYAKHFHDHKPARSCVAVAALPL-NADLEME 123

>NCAS0E03240 Chr5 (641701..642087) [387 bp, 128 aa] {ON} Anc_7.238
          Length = 128

 Score = 38.5 bits (88), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 48/96 (50%), Gaps = 6/96 (6%)

Query: 14  LVYTSGCVGTDPKTGELPEDLEQQTRNAIENLRIVLSKSGCSSLDQVVKVLLFVADGKYV 73
           L++ SG +    +   +   +  +    I+N++ VL  S  SSL+++VKV +F+AD    
Sbjct: 28  LIFLSGQIPMTAENKPVEGSIADKAEQVIQNIKNVLEASN-SSLEKIVKVNIFLADINSF 86

Query: 74  PVANKVYKDYFT----NRSCKSSAVVGFTNEGIKIE 105
              N VY  YF      RSC + A +   N  +++E
Sbjct: 87  AEFNTVYAKYFNVHKPARSCVAVAALPL-NADLEME 121

>Kwal_23.5804 s23 complement(1324907..1325332) [426 bp, 141 aa] {ON}
           YIL051C (MMF1) - Maintenance of Mitochondrial DNA 1
           [contig 11] FULL
          Length = 141

 Score = 38.5 bits (88), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 41/80 (51%), Gaps = 5/80 (6%)

Query: 14  LVYTSGCVGTDPKTGELPEDLEQQTRNAIENLRIVLSKSGCSSLDQVVKVLLFVADGKYV 73
           +V+ SG +    +   +   +  +    I+N+R +L ++  S LD++VKV +F+AD K  
Sbjct: 41  MVFVSGQIPYTAENKRVEGTIADKAEQVIQNVRNILEEAN-SGLDKIVKVNIFLADIKDF 99

Query: 74  PVANKVYKDYFTN----RSC 89
              N VY  YF      RSC
Sbjct: 100 AEFNGVYGKYFNEHKPARSC 119

>NDAI0E04750 Chr5 complement(1071393..1071779) [387 bp, 128 aa] {ON}
           Anc_7.238
          Length = 128

 Score = 37.7 bits (86), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 50/100 (50%), Gaps = 14/100 (14%)

Query: 14  LVYTSGCV----GTDPKTGELPEDLEQQTRNAIENLRIVLSKSGCSSLDQVVKVLLFVAD 69
           L++ SG +       P  G + +  EQ     I+N++ VL  S  SSL++++KV +F+AD
Sbjct: 28  LIFLSGQIPLTSDNKPVEGSIADKAEQ----VIQNVKKVLEASN-SSLERIIKVNIFLAD 82

Query: 70  GKYVPVANKVYKDYFT----NRSCKSSAVVGFTNEGIKIE 105
                  N VY  YF      RSC + A +   N  +++E
Sbjct: 83  INSFAEFNTVYAKYFNVHKPARSCVAVAALPL-NADLEME 121

>TPHA0C01100 Chr3 (250318..250746) [429 bp, 142 aa] {ON} Anc_7.238
           YIL051C
          Length = 142

 Score = 37.7 bits (86), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 28/102 (27%), Positives = 49/102 (48%), Gaps = 2/102 (1%)

Query: 14  LVYTSGCVGTDPKTGELPEDLEQQTRNAIENLRIVLSKSGCSSLDQVVKVLLFVADGKYV 73
           LV+ SG +        +   +  +T    +N++ +L  S  SS D+V+KV +F+AD    
Sbjct: 42  LVFVSGQIPYTKDNVPVKGSISDKTEQVFQNVKNILDASN-SSFDKVIKVNVFLADINNF 100

Query: 74  PVANKVYKDYF-TNRSCKSSAVVGFTNEGIKIEPGSVAKSSE 114
              N+VY  YF T++  +S   V     G  +E   +A  ++
Sbjct: 101 KEFNEVYAKYFNTHKPARSCVAVAALPLGCDLEMEVIAAEND 142

>TBLA0J01420 Chr10 (325885..326265) [381 bp, 126 aa] {ON} Anc_7.238
           YIL051C
          Length = 126

 Score = 37.0 bits (84), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/93 (25%), Positives = 44/93 (47%), Gaps = 2/93 (2%)

Query: 14  LVYTSGCVGTDPKTGELPEDLEQQTRNAIENLRIVLSKSGCSSLDQVVKVLLFVADGKYV 73
            +Y SG +   P    +   +  +     +N+  +L  +G SSL++++KV +F+A+ K  
Sbjct: 28  FIYVSGQIALLPDGTRVEGSISDKAHQIFKNISAILETAG-SSLNKIIKVNIFLANIKDF 86

Query: 74  PVANKVYKDYF-TNRSCKSSAVVGFTNEGIKIE 105
              N  Y  YF T++  +S   V     G  +E
Sbjct: 87  EEFNATYIKYFNTHKPARSCVAVAALPLGADVE 119

>Kpol_1033.12 s1033 complement(28172..28603) [432 bp, 143 aa] {ON}
           complement(28172..28603) [432 nt, 144 aa]
          Length = 143

 Score = 37.0 bits (84), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 41/86 (47%), Gaps = 5/86 (5%)

Query: 14  LVYTSGCVGTDPKTGELPEDLEQQTRNAIENLRIVLSKSGCSSLDQVVKVLLFVADGKYV 73
           L++ SG +   P+   +   +  +      N+  +L  S  SSLD+V+KV +F+ D K  
Sbjct: 42  LIFVSGQIPYTPENKPVEGSISDKAEQVFSNVTNILEASN-SSLDRVIKVNVFLKDIKNF 100

Query: 74  PVANKVYKDYFT----NRSCKSSAVV 95
              N VY  YF      RSC + A +
Sbjct: 101 QEFNSVYAKYFNVHKPARSCVAVAAL 126

>Suva_9.148 Chr9 complement(246539..246976) [438 bp, 145 aa] {ON}
           YIL051C (REAL)
          Length = 145

 Score = 37.0 bits (84), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 29/84 (34%), Positives = 42/84 (50%), Gaps = 13/84 (15%)

Query: 14  LVYTSGCVG----TDPKTGELPEDLEQQTRNAIENLRIVLSKSGCSSLDQVVKVLLFVAD 69
            VY SG +       P  G + +  EQ      +N++ +L++S  SSL+ VVKV +F+AD
Sbjct: 45  FVYVSGQIPYTAENKPVQGSISDKAEQ----VFQNVKNILAESN-SSLNSVVKVNVFLAD 99

Query: 70  GKYVPVANKVYKDYFTN----RSC 89
            K     N VY  +F      RSC
Sbjct: 100 MKNFAEFNSVYAKHFHTHKPARSC 123

>KLLA0C08349g Chr3 (731629..732051) [423 bp, 140 aa] {ON} similar to
           uniprot|P40185 Saccharomyces cerevisiae YIL051C MMF1
           Mitochondrial protein involved in maintenance of the
           mitochondrial genome and similar to YER057C
           uniprot|P40037 Saccharomyces cerevisiae YER057C HMF1
           Member of the p14.5 protein family with similarity to
           Mmf1p, functionally complements Mmf1p function when
           targeted to mitochondria; heat shock inducible; high-
           dosage growth inhibitor; forms a homotrimer in vitro
          Length = 140

 Score = 35.4 bits (80), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 42/84 (50%), Gaps = 13/84 (15%)

Query: 14  LVYTSGCVG----TDPKTGELPEDLEQQTRNAIENLRIVLSKSGCSSLDQVVKVLLFVAD 69
           L++ SG +       P  G + +  EQ     I+N++ +L ++  S LD++VKV +F+AD
Sbjct: 40  LIFVSGQIPYTAENKPVEGSIADKAEQ----VIQNVKNILVEAN-SDLDKIVKVNIFLAD 94

Query: 70  GKYVPVANKVYKDYFT----NRSC 89
                  N VY  YF      RSC
Sbjct: 95  INSFAEFNSVYAKYFNVHKPARSC 118

>SAKL0F08558g Chr6 complement(654765..655199) [435 bp, 144 aa] {ON}
           highly similar to uniprot|P40185 Saccharomyces
           cerevisiae YIL051C MMF1 Mitochondrial protein involved
           in maintenance of the mitochondrial genome and similar
           to YER057C uniprot|P40037 Saccharomyces cerevisiae
           YER057C HMF1 Member of the p14.5 protein family with
           similarity to Mmf1p, functionally complements Mmf1p
           function when targeted to mitochondria; heat shock
           inducible; high- dosage growth inhibitor; forms a
           homotrimer in vitro
          Length = 144

 Score = 34.7 bits (78), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 43/84 (51%), Gaps = 13/84 (15%)

Query: 14  LVYTSGCVG----TDPKTGELPEDLEQQTRNAIENLRIVLSKSGCSSLDQVVKVLLFVAD 69
           +V+ SG +       P  G + +  EQ     I+N++ +L ++  SSL+++VKV +F+AD
Sbjct: 44  MVFVSGQIPYTHENKPVEGSIADKAEQ----VIQNVKNILEEAN-SSLNKIVKVNVFLAD 98

Query: 70  GKYVPVANKVYKDYFTN----RSC 89
                  N VY  YF      RSC
Sbjct: 99  INDFAEFNGVYAKYFNEHKPARSC 122

>TPHA0K00920 Chr11 (190389..190775) [387 bp, 128 aa] {ON} Anc_7.238
           YIL051C
          Length = 128

 Score = 34.7 bits (78), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 29/101 (28%), Positives = 48/101 (47%), Gaps = 6/101 (5%)

Query: 15  VYTSGCVGTDPKTGELPEDLEQQTRNAIENLRIVLSKSGCSSLDQVVKVLLFVADGKYVP 74
           +Y SG +  +     +   +  +     EN++ VL+ +  S LD VVK  +F+ D K   
Sbjct: 29  IYLSGQIHLNEDNKLVGGSIADKAEQIFENVQKVLAAAN-SDLDHVVKCNVFLKDIKDFA 87

Query: 75  VANKVYKDYFTN----RSCKSSAVVGFTNEGIKIEPGSVAK 111
             N VY  YF +    RSC + A +   N  +++E  +V K
Sbjct: 88  EFNTVYAKYFNSHKPARSCVAVAALPL-NADVEMECIAVEK 127

>KLTH0A04224g Chr1 complement(356660..357085) [426 bp, 141 aa] {ON}
           highly similar to uniprot|P40185 Saccharomyces
           cerevisiae YIL051C MMF1 Mitochondrial protein involved
           in maintenance of the mitochondrial genome and similar
           to YER057C uniprot|P40037 Saccharomyces cerevisiae
           YER057C HMF1 Member of the p14.5 protein family with
           similarity to Mmf1p, functionally complements Mmf1p
           function when targeted to mitochondria; heat shock
           inducible; high- dosage growth inhibitor; forms a
           homotrimer in vitro
          Length = 141

 Score = 33.9 bits (76), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 41/80 (51%), Gaps = 5/80 (6%)

Query: 14  LVYTSGCVGTDPKTGELPEDLEQQTRNAIENLRIVLSKSGCSSLDQVVKVLLFVADGKYV 73
           +V+ SG +    +   +   +  +    I+N++ +L ++  S+L+++VKV +F+AD    
Sbjct: 41  MVFVSGQIPYTAENKRVEGTMTDKAEQVIQNVKNILEEAN-SALNKIVKVNIFLADINDF 99

Query: 74  PVANKVYKDYFTN----RSC 89
              N VY  YF      RSC
Sbjct: 100 AEFNGVYGKYFNEHKPARSC 119

>KNAG0D01620 Chr4 complement(272653..273081) [429 bp, 142 aa] {ON}
           Anc_7.238 YIL051C
          Length = 142

 Score = 32.7 bits (73), Expect = 0.093,   Method: Compositional matrix adjust.
 Identities = 23/86 (26%), Positives = 41/86 (47%), Gaps = 5/86 (5%)

Query: 14  LVYTSGCVGTDPKTGELPEDLEQQTRNAIENLRIVLSKSGCSSLDQVVKVLLFVADGKYV 73
           +V+ SG +        +   + ++     +N++ +L  S  SSLD+++KV +F+ D    
Sbjct: 42  MVFVSGQIPYTHDNKPVEGSISKKADQVFQNIKNILDASN-SSLDKIIKVNVFLKDINNF 100

Query: 74  PVANKVYKDYFT----NRSCKSSAVV 95
              N VY  YF      RSC + A +
Sbjct: 101 KEFNGVYAKYFNVHKPARSCVAVAAL 126

>TPHA0G01130 Chr7 (229626..230465) [840 bp, 279 aa] {ON} Anc_8.790
           YOR313C
          Length = 279

 Score = 31.6 bits (70), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 21/80 (26%), Positives = 40/80 (50%), Gaps = 6/80 (7%)

Query: 1   MFSSAFISTSNTPLVYTSGCVGT-DPKTGELPEDLEQQTRNAIENLRIVLSKSGCSSLDQ 59
           ++ + +++T+N PL+      GT DP   +L + LE+    A+EN   +   S C   D+
Sbjct: 161 VYYNQYVNTNNKPLIR-----GTFDPLFSKLNKHLEKSWTKALENDNFINKNSYCCEFDK 215

Query: 60  VVKVLLFVADGKYVPVANKV 79
            + + + +   K   V NK+
Sbjct: 216 SIVLTINIIAQKTKDVNNKI 235

>Ecym_6257 Chr6 (478865..479704) [840 bp, 279 aa] {ON} similar to
           Ashbya gossypii AFR560W
          Length = 279

 Score = 29.6 bits (65), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 29/59 (49%), Gaps = 9/59 (15%)

Query: 23  TDPKTGE------LPEDLEQQTRNAIENLRIVLSKSGCSSLDQVVKVLLFVADGKYVPV 75
           T PKTG+      LPE +E+     IE    ++ K+GC    Q V+ ++   D  ++ V
Sbjct: 202 THPKTGKTCSATFLPEVMEEHNWTQIETFENLIEKAGCW---QYVEQIMENYDQYFIEV 257

>TDEL0B04630 Chr2 complement(824601..825089) [489 bp, 162 aa] {ON}
          Anc_8.148 YGL187C
          Length = 162

 Score = 29.3 bits (64), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 31/68 (45%), Gaps = 12/68 (17%)

Query: 2  FSSAFISTSNTPLVYTSG----------CVGTDPKTGELPEDLEQQTRNAIENLRIVLSK 51
          F++A +   + P+V T+            +G   K GE+P DLEQ T   +E L ++   
Sbjct: 25 FTTARVVLQSKPVVKTAQTLSEVDGPETLIGPGAKQGEVPTDLEQAT--GLERLELLGKL 82

Query: 52 SGCSSLDQ 59
           G    DQ
Sbjct: 83 EGIEIFDQ 90

>KNAG0B04570 Chr2 complement(881733..884612) [2880 bp, 959 aa] {ON}
           Anc_5.355 YHR073W
          Length = 959

 Score = 28.5 bits (62), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 9/20 (45%), Positives = 14/20 (70%)

Query: 67  VADGKYVPVANKVYKDYFTN 86
           + D  YVP+ N+ Y+D+F N
Sbjct: 350 IDDDSYVPLPNEAYEDFFAN 369

>Smik_15.433 Chr15 complement(750651..751988) [1338 bp, 445 aa] {ON}
           YOR250C (REAL)
          Length = 445

 Score = 27.3 bits (59), Expect = 9.1,   Method: Composition-based stats.
 Identities = 17/46 (36%), Positives = 23/46 (50%), Gaps = 1/46 (2%)

Query: 13  PLVYTSGCVGTDPKTGELPEDLEQQTRNAIENLRIVLSKSGCSSLD 58
           P V  SGC+   P T +L E+L  +  + IE L I +    CS  D
Sbjct: 241 PQVRRSGCIVDTPATTQLDENL-NELHHIIEKLNINIMLILCSEAD 285

>Kwal_47.17457 s47 (410267..413110) [2844 bp, 947 aa] {ON} YGL016W
           (KAP122) - karyopherin-beta family protein [contig 207]
           FULL
          Length = 947

 Score = 27.3 bits (59), Expect = 9.3,   Method: Composition-based stats.
 Identities = 15/47 (31%), Positives = 24/47 (51%)

Query: 34  LEQQTRNAIENLRIVLSKSGCSSLDQVVKVLLFVADGKYVPVANKVY 80
           L+    +    L  V S +G  +LDQ +KVLL + +   VPV  + +
Sbjct: 268 LQVSNLDVCNKLFTVASDTGSGNLDQYIKVLLQMTNFTLVPVLEEFF 314

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.129    0.356 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 11,591,396
Number of extensions: 428180
Number of successful extensions: 1039
Number of sequences better than 10.0: 57
Number of HSP's gapped: 1022
Number of HSP's successfully gapped: 57
Length of query: 116
Length of database: 53,481,399
Length adjustment: 86
Effective length of query: 30
Effective length of database: 43,620,123
Effective search space: 1308603690
Effective search space used: 1308603690
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 59 (27.3 bits)