Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0F02618g3.496ON25325311461e-160
KLTH0F14938g3.496ON2292524636e-57
Kwal_55.212483.496ON2222524532e-55
ZYRO0D09812g3.496ON1851663581e-41
Kpol_1017.43.496ON1841673451e-39
Smik_16.4033.496ON2031403424e-39
Suva_16.4793.496ON2121373392e-38
YPR151C (SUE1)3.496ON2061373382e-38
Skud_16.4453.496ON2151373296e-37
KLLA0E03983g3.496ON1911453014e-33
TPHA0D033003.496ON1961413006e-33
KNAG0A079603.496ON1771462971e-32
NDAI0B058903.496ON2781402822e-29
TDEL0D056403.496ON1241562493e-26
NCAS0F035703.496ON2301531945e-17
CAGL0L08426g3.496ON1401481683e-14
Ecym_12333.496ON87491643e-14
TBLA0D029403.496ON71561546e-13
KAFR0G037103.496ON79371274e-09
AFR315C3.496ON77391205e-08
KNAG0J017608.682ON2581371224e-07
Kpol_1013.98.682ON2611391031e-04
NCAS0C013108.682ON2571481031e-04
ZYRO0F07480g8.682ON23630994e-04
Kpol_1072.128.682ON222148975e-04
YPL159C (PET20)8.682ON25338976e-04
Smik_6.3568.682ON25337968e-04
TBLA0B038008.682ON32465950.001
NDAI0K013208.682ON25858930.002
SAKL0H06380g8.682ON21938920.002
KLLA0D06061g8.682ON24962920.003
TDEL0A062708.682ON24237920.003
Suva_16.1518.682ON25337900.005
CAGL0M02101g8.682ON26733900.005
TPHA0G015708.682ON25544880.008
KLTH0D11396g8.682ON22540870.010
Skud_16.1238.682ON25537860.016
TPHA0D012908.682ON21830850.017
Kwal_26.88288.682ON22358840.026
KAFR0H023808.682ON22034780.13
KLLA0A07447g3.62ON486174800.13
TDEL0E007103.62ON47628770.25
Skud_14.423.62ON52433760.35
Kpol_1066.443.62ON47928760.38
YNL295W3.62ON52433740.66
NCAS0A099403.62ON49428740.68
Ecym_23908.682ON22738720.91
Suva_14.443.62ON52533721.1
Smik_14.363.62ON52428711.3
TBLA0B027208.798ON50254702.0
ZYRO0C02244g3.62ON46028692.3
TPHA0P012603.62ON49428683.9
Kpol_1013.232.604ON324134666.0
Skud_10.1021.247ON70879666.3
SAKL0C12342g3.62ON55228667.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0F02618g
         (253 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0F02618g Chr6 (225795..226556) [762 bp, 253 aa] {ON} similar...   446   e-160
KLTH0F14938g Chr6 complement(1220898..1221587) [690 bp, 229 aa] ...   182   6e-57
Kwal_55.21248 s55 complement(748370..749038) [669 bp, 222 aa] {O...   179   2e-55
ZYRO0D09812g Chr4 (833123..833680) [558 bp, 185 aa] {ON} similar...   142   1e-41
Kpol_1017.4 s1017 (17411..17965) [555 bp, 184 aa] {ON} (17411..1...   137   1e-39
Smik_16.403 Chr16 complement(702998..703609) [612 bp, 203 aa] {O...   136   4e-39
Suva_16.479 Chr16 complement(827450..828088) [639 bp, 212 aa] {O...   135   2e-38
YPR151C Chr16 complement(831055..831675) [621 bp, 206 aa] {ON}  ...   134   2e-38
Skud_16.445 Chr16 complement(784636..785283) [648 bp, 215 aa] {O...   131   6e-37
KLLA0E03983g Chr5 (363400..363975) [576 bp, 191 aa] {ON} similar...   120   4e-33
TPHA0D03300 Chr4 complement(678395..678985) [591 bp, 196 aa] {ON...   120   6e-33
KNAG0A07960 Chr1 complement(1270134..1270667) [534 bp, 177 aa] {...   119   1e-32
NDAI0B05890 Chr2 complement(1423733..1424569) [837 bp, 278 aa] {...   113   2e-29
TDEL0D05640 Chr4 complement(1013767..1014141) [375 bp, 124 aa] {...   100   3e-26
NCAS0F03570 Chr6 complement(711238..711930) [693 bp, 230 aa] {ON...    79   5e-17
CAGL0L08426g Chr12 (926880..927302) [423 bp, 140 aa] {ON} simila...    69   3e-14
Ecym_1233 Chr1 (481548..481811) [264 bp, 87 aa] {ON} similar to ...    68   3e-14
TBLA0D02940 Chr4 (720446..720661) [216 bp, 71 aa] {ON} Anc_3.496...    64   6e-13
KAFR0G03710 Chr7 complement(764660..764899) [240 bp, 79 aa] {ON}...    54   4e-09
AFR315C Chr6 complement(1006937..1007170) [234 bp, 77 aa] {ON} S...    51   5e-08
KNAG0J01760 Chr10 (320758..321534) [777 bp, 258 aa] {ON} Anc_8.6...    52   4e-07
Kpol_1013.9 s1013 (15300..16085) [786 bp, 261 aa] {ON} (15300..1...    44   1e-04
NCAS0C01310 Chr3 complement(241103..241876) [774 bp, 257 aa] {ON...    44   1e-04
ZYRO0F07480g Chr6 (607194..607904) [711 bp, 236 aa] {ON} similar...    43   4e-04
Kpol_1072.12 s1072 complement(24362..25030) [669 bp, 222 aa] {ON...    42   5e-04
YPL159C Chr16 complement(250907..251668) [762 bp, 253 aa] {ON}  ...    42   6e-04
Smik_6.356 Chr6 (572523..573284) [762 bp, 253 aa] {ON} YPL159C (...    42   8e-04
TBLA0B03800 Chr2 complement(873861..874835) [975 bp, 324 aa] {ON...    41   0.001
NDAI0K01320 Chr11 complement(297117..297893) [777 bp, 258 aa] {O...    40   0.002
SAKL0H06380g Chr8 complement(563753..564412) [660 bp, 219 aa] {O...    40   0.002
KLLA0D06061g Chr4 (520082..520831) [750 bp, 249 aa] {ON} weakly ...    40   0.003
TDEL0A06270 Chr1 (1098704..1099432) [729 bp, 242 aa] {ON} Anc_8....    40   0.003
Suva_16.151 Chr16 complement(260210..260971) [762 bp, 253 aa] {O...    39   0.005
CAGL0M02101g Chr13 complement(254024..254827) [804 bp, 267 aa] {...    39   0.005
TPHA0G01570 Chr7 complement(319949..320716) [768 bp, 255 aa] {ON...    39   0.008
KLTH0D11396g Chr4 (931339..932016) [678 bp, 225 aa] {ON} similar...    38   0.010
Skud_16.123 Chr16 complement(222359..223126) [768 bp, 255 aa] {O...    38   0.016
TPHA0D01290 Chr4 (268062..268718) [657 bp, 218 aa] {ON} Anc_8.68...    37   0.017
Kwal_26.8828 s26 (960466..961137) [672 bp, 223 aa] {ON} YPL159C ...    37   0.026
KAFR0H02380 Chr8 complement(455996..456658) [663 bp, 220 aa] {ON...    35   0.13 
KLLA0A07447g Chr1 (669272..670732) [1461 bp, 486 aa] {ON} simila...    35   0.13 
TDEL0E00710 Chr5 (152143..153573) [1431 bp, 476 aa] {ON} Anc_3.6...    34   0.25 
Skud_14.42 Chr14 (70507..72081) [1575 bp, 524 aa] {ON} YNL295W (...    34   0.35 
Kpol_1066.44 s1066 complement(74670..76109) [1440 bp, 479 aa] {O...    34   0.38 
YNL295W Chr14 (76946..78520) [1575 bp, 524 aa] {ON} Putative pro...    33   0.66 
NCAS0A09940 Chr1 complement(1986687..1988171) [1485 bp, 494 aa] ...    33   0.68 
Ecym_2390 Chr2 complement(757433..758116) [684 bp, 227 aa] {ON} ...    32   0.91 
Suva_14.44 Chr14 (73757..75334) [1578 bp, 525 aa] {ON} YNL295W (...    32   1.1  
Smik_14.36 Chr14 (61288..62862) [1575 bp, 524 aa] {ON} YNL295W (...    32   1.3  
TBLA0B02720 Chr2 (626800..628308) [1509 bp, 502 aa] {ON} Anc_8.7...    32   2.0  
ZYRO0C02244g Chr3 complement(174640..176022) [1383 bp, 460 aa] {...    31   2.3  
TPHA0P01260 Chr16 complement(252274..253758) [1485 bp, 494 aa] {...    31   3.9  
Kpol_1013.23 s1013 complement(54054..55028) [975 bp, 324 aa] {ON...    30   6.0  
Skud_10.102 Chr10 (173179..175305) [2127 bp, 708 aa] {ON} YJL112...    30   6.3  
SAKL0C12342g Chr3 complement(1099949..1101607) [1659 bp, 552 aa]...    30   7.0  

>SAKL0F02618g Chr6 (225795..226556) [762 bp, 253 aa] {ON} similar to
           uniprot|Q06524 Saccharomyces cerevisiae YPR151C SUE1
           Mitochondrial protein required for degradation of
           unstable forms of cytochrome c
          Length = 253

 Score =  446 bits (1146), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 221/253 (87%), Positives = 221/253 (87%)

Query: 1   MKQSRLFSTTATNMIKKKNSDIFRLLPKVPTTQFLEPRELTRDILFSGYRPVTYPVKENP 60
           MKQSRLFSTTATNMIKKKNSDIFRLLPKVPTTQFLEPRELTRDILFSGYRPVTYPVKENP
Sbjct: 1   MKQSRLFSTTATNMIKKKNSDIFRLLPKVPTTQFLEPRELTRDILFSGYRPVTYPVKENP 60

Query: 61  FFNIGTQRKGLAGETSXXXXXXXXXXXXXXXXXHNVMAXXXXXXXXXXXXXXXTWRYNPR 120
           FFNIGTQRKGLAGETS                 HNVMA               TWRYNPR
Sbjct: 61  FFNIGTQRKGLAGETSAKKEYKNEAERENEKEEHNVMAGPRGTGGIVSGGVNGTWRYNPR 120

Query: 121 IPTKLLPYNLWSSSTMAMEYYPEWLNVPKTIANKLKPFDMPIVSVKDKKQYNPTHRCAFN 180
           IPTKLLPYNLWSSSTMAMEYYPEWLNVPKTIANKLKPFDMPIVSVKDKKQYNPTHRCAFN
Sbjct: 121 IPTKLLPYNLWSSSTMAMEYYPEWLNVPKTIANKLKPFDMPIVSVKDKKQYNPTHRCAFN 180

Query: 181 GVLEEQLPFAKEEENKQQLSDNNSLVLEGEGVHKIKHAYMNYRKKKQNGKFLDKKLSKQV 240
           GVLEEQLPFAKEEENKQQLSDNNSLVLEGEGVHKIKHAYMNYRKKKQNGKFLDKKLSKQV
Sbjct: 181 GVLEEQLPFAKEEENKQQLSDNNSLVLEGEGVHKIKHAYMNYRKKKQNGKFLDKKLSKQV 240

Query: 241 DQFIKYLKEKEGS 253
           DQFIKYLKEKEGS
Sbjct: 241 DQFIKYLKEKEGS 253

>KLTH0F14938g Chr6 complement(1220898..1221587) [690 bp, 229 aa]
           {ON} weakly similar to uniprot|Q06524 Saccharomyces
           cerevisiae YPR151C SUE1 Mitochondrial protein required
           for degradation of unstable forms of cytochrome c
          Length = 229

 Score =  182 bits (463), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 108/252 (42%), Positives = 136/252 (53%), Gaps = 26/252 (10%)

Query: 1   MKQSRLFSTTATNMIKKKNSDIFRLLPKVPTTQFLEPRELTRDILFSGYRPVTYPVKENP 60
           M   R FS  A+ M+K+K+S+IFR LPKVPTTQ+LEP ELTRDIL+SGYRPV YPVKENP
Sbjct: 1   MAHKRQFSLEASKMLKRKSSEIFRSLPKVPTTQYLEPAELTRDILYSGYRPVIYPVKENP 60

Query: 61  FF-NIGTQRKGLAGETSXXXXXXXXXXXXXXXXXHNVMAXXXXXXXXXXXXXXXTWRYNP 119
            F   G + + L GE                    N MA               TWRYNP
Sbjct: 61  LFKEAGWKTQRLRGERGARKSSTVPQSSEM-----NAMAGPLGTGGIGSGGVNGTWRYNP 115

Query: 120 RIPTKLLPYNLWSSSTMAMEYYPEWLNVPKTIANKLKPFDMPIVSVKDKKQYNPTHRCAF 179
           RIP+KLLPYNLWS ++MAMEY+PEWL VP+T+ NKL+PF+ P             HR   
Sbjct: 116 RIPSKLLPYNLWSCTSMAMEYHPEWLAVPRTVVNKLRPFESP-------------HR--- 159

Query: 180 NGVLEEQLPFAKEEENKQQLSDNNSLVLEGEGVHKIKHAYMNYRKKKQNGKFLDKKLSKQ 239
              + E+    K   +    +   +             A    RK  ++G+  D KLSKQ
Sbjct: 160 --PVAERSTDCKAGSSPTVTAAAVAPATALPATGARAKAPARKRKPAEHGE--DNKLSKQ 215

Query: 240 VDQFIKYLKEKE 251
           V +FI YL+EK+
Sbjct: 216 VGEFINYLREKD 227

>Kwal_55.21248 s55 complement(748370..749038) [669 bp, 222 aa] {ON}
           YPR151C - Hypothetical ORF [contig 130] FULL
          Length = 222

 Score =  179 bits (453), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 105/252 (41%), Positives = 136/252 (53%), Gaps = 33/252 (13%)

Query: 1   MKQSRLFSTTATNMIKKKNSDIFRLLPKVPTTQFLEPRELTRDILFSGYRPVTYPVKENP 60
           M Q R F   A+ M+K+++SDIFR LPKVPTTQ+LEP ELTRDIL+SGYRPV YPVKENP
Sbjct: 1   MAQKRQFCVEASKMLKRRSSDIFRSLPKVPTTQYLEPAELTRDILYSGYRPVIYPVKENP 60

Query: 61  FFNIGTQRKGLAGETSXXXXXXXXXXXXXXXXXHNVMAXXXXXXXXXXXXXXXTWRYNPR 120
            F    +  G   +                    N MA               TWRYNPR
Sbjct: 61  LF----KETGWKTQRLREEPGSDTALTAAKESSKNAMAGPQGTGGIGSGGVNGTWRYNPR 116

Query: 121 IPTKLLPYNLWSSSTMAMEYYPEWLNVPKTIANKLKPFDMPIVSVKDKKQYNPTHRCAFN 180
           IP+KLLP++LWSS++MAMEY+PEWL VP+T+ NKL+PF+ P                   
Sbjct: 117 IPSKLLPFSLWSSTSMAMEYHPEWLAVPRTVVNKLRPFNSP------------------- 157

Query: 181 GVLEEQLPFAKEEENKQQLSDNNSLVLEGEGVHKIKHAYMNYRKKKQNGK-FLDKKLSKQ 239
               E+   A  +      SD  ++        +   A  + RK+K + +   D+KLSKQ
Sbjct: 158 ----ERPDNAGGDSEATSASDTPAVQ-----AAQAAQAKQHARKRKSSSEGSQDRKLSKQ 208

Query: 240 VDQFIKYLKEKE 251
           V QFI YL+EK+
Sbjct: 209 VGQFINYLREKD 220

>ZYRO0D09812g Chr4 (833123..833680) [558 bp, 185 aa] {ON} similar to
           gnl|GLV|CAGL0L08426g Candida glabrata CAGL0L08426g and
           weakly similar to YPR151C uniprot|Q06524 Saccharomyces
           cerevisiae YPR151C SUE1 Mitochondrial protein required
           for degradation of unstable forms of cytochrome c
          Length = 185

 Score =  142 bits (358), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 76/166 (45%), Positives = 95/166 (57%), Gaps = 7/166 (4%)

Query: 1   MKQSRLFSTTATNMIKKK--NSDIFRLLPKVPTTQFLEPRELTRDILFSGYRPVTYPVKE 58
           M   RLFST      K+K  +SDIFR +P+VPTTQFLE RELTRDILFSGYRPV YPVKE
Sbjct: 1   MMSKRLFSTATIRSFKRKCCSSDIFRSMPRVPTTQFLESRELTRDILFSGYRPVMYPVKE 60

Query: 59  NPFFNIGTQRKGLAGE-----TSXXXXXXXXXXXXXXXXXHNVMAXXXXXXXXXXXXXXX 113
           NP F   T+   L  E      S                 ++V+A               
Sbjct: 61  NPLFKERTRNGELTDELQSRHNSGLRQGRTQEEEKESGEEYSVIAGPRGCGGIASGGASG 120

Query: 114 TWRYNPRIPTKLLPYNLWSSSTMAMEYYPEWLNVPKTIANKLKPFD 159
           TWR   ++P+KLLPY+ WS+++M ME++PEW  VP+ +  KLKPFD
Sbjct: 121 TWRNGAKMPSKLLPYSWWSTTSMGMEFFPEWEGVPRHVVRKLKPFD 166

>Kpol_1017.4 s1017 (17411..17965) [555 bp, 184 aa] {ON}
           (17411..17965) [555 nt, 185 aa]
          Length = 184

 Score =  137 bits (345), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 71/167 (42%), Positives = 91/167 (54%), Gaps = 11/167 (6%)

Query: 5   RLFSTTATNMIKKKNSD----IFRLLPKVPTTQFLEPRELTRDILFSGYRPVTYPVKENP 60
           R +S+T    +K+K S     IFR LP+VPTTQFLE   LT DILFSGYRP+TYPVKENP
Sbjct: 14  RCYSSTPIRFMKRKMSSDTEHIFRSLPRVPTTQFLESTTLTNDILFSGYRPITYPVKENP 73

Query: 61  FFNIGTQRKGLAGE-------TSXXXXXXXXXXXXXXXXXHNVMAXXXXXXXXXXXXXXX 113
            F      K + G+        S                  N ++               
Sbjct: 74  LFRNTGNTKNIFGQDLVNAESNSNDASLLQEHDKNITSQEFNTLSGDRGTGGIKSGGVNG 133

Query: 114 TWRYNPRIPTKLLPYNLWSSSTMAMEYYPEWLNVPKTIANKLKPFDM 160
           TWR+NPR+P+KLLPY+ WS+S M MEYYPEW N+P+ +   LKP+ +
Sbjct: 134 TWRFNPRVPSKLLPYSWWSTSIMGMEYYPEWKNIPRKVVKDLKPYQL 180

>Smik_16.403 Chr16 complement(702998..703609) [612 bp, 203 aa] {ON}
           YPR151C (REAL)
          Length = 203

 Score =  136 bits (342), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 66/140 (47%), Positives = 83/140 (59%), Gaps = 1/140 (0%)

Query: 23  FRLLPKVPTTQFLEPRELTRDILFSGYRPVTYPVKENPFFNIGTQRKGLAGETSXXXXXX 82
           FR LPKVPTTQ+LE RELTRDIL+SGYRPV YPVKENP F    ++K L    +      
Sbjct: 53  FRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFR-DKKKKSLQMLLTADEAPI 111

Query: 83  XXXXXXXXXXXHNVMAXXXXXXXXXXXXXXXTWRYNPRIPTKLLPYNLWSSSTMAMEYYP 142
                       N++                TW+YNP +P +LLP+N WS+S+M MEY+P
Sbjct: 112 TEAKTTEKSKHKNILFGERGTGGIMSGGVNGTWKYNPTVPNELLPFNWWSTSSMGMEYFP 171

Query: 143 EWLNVPKTIANKLKPFDMPI 162
           EW N+P  +  KLKPFD P+
Sbjct: 172 EWRNIPSYMTRKLKPFDKPL 191

>Suva_16.479 Chr16 complement(827450..828088) [639 bp, 212 aa] {ON}
           YPR151C (REAL)
          Length = 212

 Score =  135 bits (339), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 68/137 (49%), Positives = 80/137 (58%), Gaps = 1/137 (0%)

Query: 23  FRLLPKVPTTQFLEPRELTRDILFSGYRPVTYPVKENPFFNIGTQRKGLAGETSXXXXXX 82
           FR LPKVPTTQ+LE RELTRDIL+SGYRPV YPVKENP F    ++K L    +      
Sbjct: 62  FRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFR-DKKKKSLQMLLASDEKPA 120

Query: 83  XXXXXXXXXXXHNVMAXXXXXXXXXXXXXXXTWRYNPRIPTKLLPYNLWSSSTMAMEYYP 142
                       NV                 TW+YNP +P +LLPYN WS+S+M MEY+P
Sbjct: 121 TEAKATEKSEHKNVFFGERGTGGIMSGGVNGTWKYNPTVPNELLPYNWWSTSSMGMEYFP 180

Query: 143 EWLNVPKTIANKLKPFD 159
           EW NVP  +  KLKPFD
Sbjct: 181 EWKNVPSYMMRKLKPFD 197

>YPR151C Chr16 complement(831055..831675) [621 bp, 206 aa] {ON}
           SUE1Mitochondrial protein required for degradation of
           unstable forms of cytochrome c
          Length = 206

 Score =  134 bits (338), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 67/137 (48%), Positives = 81/137 (59%), Gaps = 1/137 (0%)

Query: 23  FRLLPKVPTTQFLEPRELTRDILFSGYRPVTYPVKENPFFNIGTQRKGLAGETSXXXXXX 82
           FR LPKVPTTQ+LE RELTRDIL+SGYRPV YPVKENP F    +RK L    +      
Sbjct: 55  FRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFR-DKKRKSLQTLLTMNEKTN 113

Query: 83  XXXXXXXXXXXHNVMAXXXXXXXXXXXXXXXTWRYNPRIPTKLLPYNLWSSSTMAMEYYP 142
                       N++                TW+YNP +P +LLP+N WS+S+M MEY+P
Sbjct: 114 AEAKTIDEKKHKNILFGERGTGGIMSGGVNGTWKYNPTVPNELLPFNWWSTSSMGMEYFP 173

Query: 143 EWLNVPKTIANKLKPFD 159
           EW NVP  +  KLKPFD
Sbjct: 174 EWKNVPPYMMRKLKPFD 190

>Skud_16.445 Chr16 complement(784636..785283) [648 bp, 215 aa] {ON}
           YPR151C (REAL)
          Length = 215

 Score =  131 bits (329), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 67/137 (48%), Positives = 80/137 (58%), Gaps = 1/137 (0%)

Query: 23  FRLLPKVPTTQFLEPRELTRDILFSGYRPVTYPVKENPFFNIGTQRKGLAGETSXXXXXX 82
           FR LPKVPTTQ+LE RELTRDIL+SGYRPV YPVKENP F    +R  L    +      
Sbjct: 62  FRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFR-DKKRDSLQMLLAPDEAPA 120

Query: 83  XXXXXXXXXXXHNVMAXXXXXXXXXXXXXXXTWRYNPRIPTKLLPYNLWSSSTMAMEYYP 142
                       NV+                TW+YNP +P +LLP+N WS+S+M MEY+P
Sbjct: 121 AEAKATEKDMHKNVLFGERGTGGISSGGVNGTWKYNPTVPNELLPFNWWSTSSMGMEYFP 180

Query: 143 EWLNVPKTIANKLKPFD 159
           EW NVP  +  KLKPFD
Sbjct: 181 EWKNVPSYMMRKLKPFD 197

>KLLA0E03983g Chr5 (363400..363975) [576 bp, 191 aa] {ON} similar to
           gnl|GLV|CAGL0L08426g Candida glabrata CAGL0L08426g and
           weakly similar to YPR151C uniprot|Q06524 Saccharomyces
           cerevisiae YPR151C SUE1 Mitochondrial protein required
           for degradation of unstable forms of cytochrome c
          Length = 191

 Score =  120 bits (301), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 61/145 (42%), Positives = 80/145 (55%), Gaps = 1/145 (0%)

Query: 16  KKKNSDIFRLLPKVPTTQFLEPRELTRDILFSGYRPVTYPVKENPFFNIGTQRKGLAGET 75
           K K + ++R LP+VPTT+FL P+ELT DILFSGYRP+  P+++NP F    +   +  E 
Sbjct: 5   KSKATQMYRQLPRVPTTRFLAPQELTADILFSGYRPIVSPLRDNPLFQAKVKELEVEREK 64

Query: 76  SXXXXXXXXXXXXXXXXXHNVMAXXXXXXXXXXXXXXXTWRYNPRIPTKLLPYNLWSSST 135
           +                 H  MA               TWRYNPRIP KLL   LWSSS 
Sbjct: 65  NGGGKLKSKAAFASEPE-HPFMAGPNGTGGILSGGVNGTWRYNPRIPNKLLQSALWSSSA 123

Query: 136 MAMEYYPEWLNVPKTIANKLKPFDM 160
           M ME+YPEW +VP  ++  LKP+ +
Sbjct: 124 MGMEFYPEWNDVPNKVSASLKPYQL 148

>TPHA0D03300 Chr4 complement(678395..678985) [591 bp, 196 aa] {ON}
           Anc_3.496 YPR151C
          Length = 196

 Score =  120 bits (300), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 61/141 (43%), Positives = 77/141 (54%)

Query: 20  SDIFRLLPKVPTTQFLEPRELTRDILFSGYRPVTYPVKENPFFNIGTQRKGLAGETSXXX 79
           + IF+ LP+VPTT++LE  +LT DILFSGYRP+TYPVKENP F    +       T    
Sbjct: 48  NSIFKNLPRVPTTRYLESTKLTNDILFSGYRPITYPVKENPLFRNINKYNNDFLSTQETQ 107

Query: 80  XXXXXXXXXXXXXXHNVMAXXXXXXXXXXXXXXXTWRYNPRIPTKLLPYNLWSSSTMAME 139
                          +V+                TW+YNP +P  LLPYN WS+S M ME
Sbjct: 108 EKNNPVLPQKNHEAFSVLTGEKGTGGIMSGGVNGTWKYNPTVPENLLPYNWWSTSIMGME 167

Query: 140 YYPEWLNVPKTIANKLKPFDM 160
           YYPEW NVP+     LKPF++
Sbjct: 168 YYPEWNNVPRRFLKTLKPFEV 188

>KNAG0A07960 Chr1 complement(1270134..1270667) [534 bp, 177 aa] {ON}
           Anc_3.496 YPR151C
          Length = 177

 Score =  119 bits (297), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 61/146 (41%), Positives = 82/146 (56%), Gaps = 3/146 (2%)

Query: 21  DIFRLLPKVPTTQFLEPRELTRDILFSGYRPVTYPVKENPFFNIGTQRKGLAGETSXXXX 80
            +FR LPKVP T++LE REL +DIL+SGYRPV YPV+ENP F      K +A        
Sbjct: 30  SMFRRLPKVPMTKYLETRELAKDILYSGYRPVMYPVRENPLFR--NSNKLMAISHPEHDT 87

Query: 81  XXXXXXXXXXXXXHNVMAXXXXXXXXXXXXXXXTWRYNPRIPTKLLPYNLWSSSTMAMEY 140
                        +  +                TW+Y P+IP K+LP+N WS+S++AME 
Sbjct: 88  EGTEGTHRDSQTVNTELFGNNNCGGINTLGCNGTWKYAPKIPQKMLPFNWWSASSLAMEV 147

Query: 141 YPEWLNVPKTIANKLKPFDMPIVSVK 166
           YPEW +VPK +   LKPFD+ ++ VK
Sbjct: 148 YPEWSSVPKHVVKGLKPFDL-LLGVK 172

>NDAI0B05890 Chr2 complement(1423733..1424569) [837 bp, 278 aa] {ON}
           Anc_3.496 YPR151C
          Length = 278

 Score =  113 bits (282), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 59/140 (42%), Positives = 75/140 (53%), Gaps = 1/140 (0%)

Query: 20  SDIFRLLPKVPTTQFLEPRELTRDILFSGYRPVTYPVKENPFFNIGTQRKGLAGETSXXX 79
           ++IFR +PKVP T++LE +EL++D+L+SGYRP+ YPVKENP F + T +K  +       
Sbjct: 126 NNIFRTMPKVPMTKYLETKELSQDMLYSGYRPIMYPVKENPLFRL-TLKKNSSSSFPFST 184

Query: 80  XXXXXXXXXXXXXXHNVMAXXXXXXXXXXXXXXXTWRYNPRIPTKLLPYNLWSSSTMAME 139
                                             TWRY+PRIP  LLP  +WS S M ME
Sbjct: 185 TSSSSSEKKKPQQEQMKKHYDDEYGGIMTGGINGTWRYSPRIPNNLLPNKIWSMSIMGME 244

Query: 140 YYPEWLNVPKTIANKLKPFD 159
           YYPEW  VP  I   LKPFD
Sbjct: 245 YYPEWKGVPFNIVKNLKPFD 264

>TDEL0D05640 Chr4 complement(1013767..1014141) [375 bp, 124 aa] {ON}
           Anc_3.496 YPR151C
          Length = 124

 Score =  100 bits (249), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 57/156 (36%), Positives = 78/156 (50%), Gaps = 48/156 (30%)

Query: 5   RLFSTTATNMIKKK-NSDIFRLLPKVPTTQFLEPRELTRDILFSGYRPVTYPVKENPFFN 63
           R FST++    +K    D+FR LP+VPTT+FLE + L+ DILFSGYRPV YPV+ENP F 
Sbjct: 12  RRFSTSSRVWRRKSVTDDLFRTLPRVPTTRFLETQRLSSDILFSGYRPVMYPVRENPLFG 71

Query: 64  IGTQRKGLAGETSXXXXXXXXXXXXXXXXXHNVMAXXXXXXXXXXXXXXXTWRYNPRIPT 123
            GT+ +  A                                                + +
Sbjct: 72  RGTKTEAPAS-----------------------------------------------LES 84

Query: 124 KLLPYNLWSSSTMAMEYYPEWLNVPKTIANKLKPFD 159
            L  Y+LWS++TM +E +PEW NVP+ +  KL+PFD
Sbjct: 85  NLPRYDLWSTTTMGLERFPEWSNVPREVVRKLRPFD 120

>NCAS0F03570 Chr6 complement(711238..711930) [693 bp, 230 aa] {ON}
           Anc_3.496 YPR151C
          Length = 230

 Score = 79.3 bits (194), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 45/153 (29%), Positives = 70/153 (45%), Gaps = 37/153 (24%)

Query: 17  KKNSDIFRLLPKVPTTQFLEPRELTRDILFSGYRPVTYPVKENPFFNIGTQRKGLAGETS 76
           K +++IFR LPKVP T++LE ++L+++ILF+GY+P+ YPV+ENP F +  +++    E  
Sbjct: 112 KYSNNIFRKLPKVPMTRYLETKQLSKEILFAGYKPIMYPVRENPLFKLKIKQEDAKRENG 171

Query: 77  XXXXXXXXXXXXXXXXXHNVMAXXXXXXXXXXXXXXXTWRYNPRIPTKLLPYNLWSSSTM 136
                                                                +WS+S +
Sbjct: 172 NEKRALGSSVSHKYK-------------------------------------GIWSTSIL 194

Query: 137 AMEYYPEWLNVPKTIANKLKPFDMPIVSVKDKK 169
            ++ YPEW NVP      LKPFD  + S+  KK
Sbjct: 195 GLQDYPEWNNVPWNNIKNLKPFDEELASITIKK 227

>CAGL0L08426g Chr12 (926880..927302) [423 bp, 140 aa] {ON} similar
           to uniprot|Q06524 Saccharomyces cerevisiae YPR151c
          Length = 140

 Score = 69.3 bits (168), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 45/148 (30%), Positives = 70/148 (47%), Gaps = 20/148 (13%)

Query: 17  KKNSDIFRLLPKVPTTQFLEPRELTRDILFSGYRPVTYPVKENPFFNIGTQRKG-LAGET 75
           K+ ++IFR LPKVP T++LE R L+ D+L++GYRP+ YP++ENP       R+    GE+
Sbjct: 2   KRVNEIFRKLPKVPMTRYLENRLLSEDMLYNGYRPILYPMRENPLLCHSNVRETHYYGES 61

Query: 76  SXXXXXXXXXXXXXXXXXHNVMAXXXXXXXXXXXXXXXTWRYNPRIPTKL---LPYNLWS 132
           S                                             P+K+   L Y++  
Sbjct: 62  SNELQKKDEEPVNELLYGPEGRGGISTMGVRRMAD-----------PSKVKLGLSYSI-- 108

Query: 133 SSTMAMEYYPEWLNVPKTIANKLKPFDM 160
              M MEYYPEW  VP+ +  ++KP+++
Sbjct: 109 ---MGMEYYPEWEKVPRDVVKRIKPYEV 133

>Ecym_1233 Chr1 (481548..481811) [264 bp, 87 aa] {ON} similar to
          Ashbya gossypii AFR315C
          Length = 87

 Score = 67.8 bits (164), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 36/49 (73%)

Query: 14 MIKKKNSDIFRLLPKVPTTQFLEPRELTRDILFSGYRPVTYPVKENPFF 62
          M+K K  +I R LP+VPTTQ+L   EL  DI FSGYRP+ YPVK+NP F
Sbjct: 1  MVKGKPLEILRHLPRVPTTQYLSLEELRTDIFFSGYRPMVYPVKQNPLF 49

>TBLA0D02940 Chr4 (720446..720661) [216 bp, 71 aa] {ON} Anc_3.496
          YPR151C
          Length = 71

 Score = 63.9 bits (154), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 29/56 (51%), Positives = 38/56 (67%)

Query: 14 MIKKKNSDIFRLLPKVPTTQFLEPRELTRDILFSGYRPVTYPVKENPFFNIGTQRK 69
          ++ + +  + R LP+VPTT++LE   L  DI FSGYRPV YPVKENP F  G  +K
Sbjct: 7  VVVRNSKSVLRDLPRVPTTEYLENTRLYNDIFFSGYRPVMYPVKENPLFRNGELKK 62

>KAFR0G03710 Chr7 complement(764660..764899) [240 bp, 79 aa] {ON}
          Anc_3.496 YPR151C
          Length = 79

 Score = 53.5 bits (127), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 30/37 (81%)

Query: 26 LPKVPTTQFLEPRELTRDILFSGYRPVTYPVKENPFF 62
          LP+VPTT++L+  +L  DIL++GYRPV YP+KENP  
Sbjct: 11 LPRVPTTKYLDKSKLKIDILYNGYRPVLYPMKENPLL 47

>AFR315C Chr6 complement(1006937..1007170) [234 bp, 77 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YPR151C
          (SUE1)
          Length = 77

 Score = 50.8 bits (120), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 22/39 (56%), Positives = 30/39 (76%)

Query: 23 FRLLPKVPTTQFLEPRELTRDILFSGYRPVTYPVKENPF 61
          FR+LP+VP+TQ L   ++  DILFS +RP+TYPV +NP 
Sbjct: 7  FRMLPRVPSTQHLPADKVRLDILFSRHRPLTYPVSQNPL 45

>KNAG0J01760 Chr10 (320758..321534) [777 bp, 258 aa] {ON} Anc_8.682
           YPL159C
          Length = 258

 Score = 51.6 bits (122), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 37/137 (27%), Positives = 56/137 (40%), Gaps = 36/137 (26%)

Query: 26  LPKVPTTQFLEPRELTRDILFSGYRPVTYPVKENPFFNIGTQRKGLAGETSXXXXXXXXX 85
           LP VP+TQ +E  ++  ++L+SGYRP+        F +     +GL              
Sbjct: 96  LPSVPSTQHIEANDMCTELLYSGYRPL--------FLDSTALERGL-------------- 133

Query: 86  XXXXXXXXHNVMAXXXXXXXXXXXXXXXTWRYNPRIPTKLL-PYNLWSSSTMAMEYYPEW 144
                      +A               +  Y   I  KL  P  +W++S   +E Y EW
Sbjct: 134 -----------LAAKEQASFTQSASPTGSTFYE--IAMKLEDPACIWANSATGLEKYTEW 180

Query: 145 LNVPKTIANKLKPFDMP 161
            N+P ++AN LKPF  P
Sbjct: 181 DNIPYSVANSLKPFVPP 197

>Kpol_1013.9 s1013 (15300..16085) [786 bp, 261 aa] {ON}
           (15300..16085) [786 nt, 262 aa]
          Length = 261

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 37/139 (26%), Positives = 49/139 (35%), Gaps = 42/139 (30%)

Query: 23  FRLLPKVPTTQFLEPRELTRDILFSGYRPVTYPVKENPFFNIGTQRKGLAGETSXXXXXX 82
           +  LPKVP+T+ L  RE+    L+SGYRP+    K       G+ +  L+G         
Sbjct: 109 YSWLPKVPSTENLNHREIRTSALYSGYRPIYINSK-------GSGKNKLSGTMKNGVNST 161

Query: 83  XXXXXXXXXXXHNVMAXXXXXXXXXXXXXXXTWRYNPRIPTKLLPYNLWSSSTMAMEYYP 142
                                                 I  KL   + W SS   ME Y 
Sbjct: 162 FY-----------------------------------EIAMKLENPSPWMSSATGMELYS 186

Query: 143 EWLNVPKTIANKLKPFDMP 161
           EW +VP  +   LKPF  P
Sbjct: 187 EWDHVPLDVLKDLKPFHPP 205

>NCAS0C01310 Chr3 complement(241103..241876) [774 bp, 257 aa] {ON}
           Anc_8.682
          Length = 257

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 40/148 (27%), Positives = 55/148 (37%), Gaps = 33/148 (22%)

Query: 16  KKKNSDIFRLLPKVPTTQFLEPRELTRDILFSGYRPVTYPVKENPFFNIGTQRKGLAGET 75
           KKK  D +  LPKV     L   E++ DIL+SGYRP+    K+       + RK   G +
Sbjct: 81  KKKRFD-YSTLPKVEPITNLRHNEISTDILYSGYRPLFLNFKDLE----NSSRKAEFGNS 135

Query: 76  SXXXXXXXXXXXXXXXXXHNVMAXXXXXXXXXXXXXXXTWRYNPRIPTKLLPYNLW-SSS 134
           +                                         +P   +     N W S+S
Sbjct: 136 NNSTLYEIAMKLDD---------------------------LSPEAISGSTSSNFWHSTS 168

Query: 135 TMAMEYYPEWLNVPKTIANKLKPFDMPI 162
              ME + EW NVP +I   LKPF  P+
Sbjct: 169 ATGMEVFDEWDNVPNSILKNLKPFQAPV 196

>ZYRO0F07480g Chr6 (607194..607904) [711 bp, 236 aa] {ON} similar to
           uniprot|Q99373 Saccharomyces cerevisiae YPL159C PET20
           Protein required for respiratory growth and stability of
           the mitochondrial genome
          Length = 236

 Score = 42.7 bits (99), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 24/30 (80%)

Query: 23  FRLLPKVPTTQFLEPRELTRDILFSGYRPV 52
           +  LP+VP+T +L PR+++  IL+SGYRP+
Sbjct: 85  YSWLPRVPSTNYLRPRDMSSKILYSGYRPL 114

 Score = 42.0 bits (97), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 21/33 (63%)

Query: 129 NLWSSSTMAMEYYPEWLNVPKTIANKLKPFDMP 161
           +LW+SS    E YPEW  VP  +  KLKPF+ P
Sbjct: 150 SLWTSSATGQEIYPEWDYVPMEVQRKLKPFNAP 182

>Kpol_1072.12 s1072 complement(24362..25030) [669 bp, 222 aa] {ON}
           complement(24362..25030) [669 nt, 223 aa]
          Length = 222

 Score = 42.0 bits (97), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 35/148 (23%), Positives = 56/148 (37%), Gaps = 42/148 (28%)

Query: 23  FRLLPKVPTTQFLEPRELTRDILFSGYRPVTYPVKENPFFNIGTQRKGLAGETSXXXXXX 82
           +  LPKVP+ + L  +++T DI +SG+R    P+  +P     T+ +    ++S      
Sbjct: 94  YSWLPKVPSNKRLTHQDITTDIFYSGFR----PLSIDP-----TELENKDEDSSTWYEVS 144

Query: 83  XXXXXXXXXXXHNVMAXXXXXXXXXXXXXXXTWRYNPRIPTKLLPYNLWSSSTMAMEYYP 142
                      HN                                 ++W+SS   ME Y 
Sbjct: 145 LTLDSPVPPSGHN---------------------------------SIWTSSATGMERYR 171

Query: 143 EWLNVPKTIANKLKPFDMPIVSVKDKKQ 170
           EW +VP+ + N L PF  P +    K Q
Sbjct: 172 EWHSVPEEVINSLTPFQPPDIDGNVKSQ 199

>YPL159C Chr16 complement(250907..251668) [762 bp, 253 aa] {ON}
           PET20Mitochondrial protein, required for respiratory
           growth under some conditions and for stability of the
           mitochondrial genome
          Length = 253

 Score = 42.0 bits (97), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 29/38 (76%), Gaps = 1/38 (2%)

Query: 15  IKKKNSDIFRLLPKVPTTQFLEPRELTRDILFSGYRPV 52
           +KKK SD F  LP+VP+T  L+  ++T ++L+SGYRP+
Sbjct: 93  LKKKRSD-FSWLPRVPSTSHLKQSDMTTNVLYSGYRPL 129

 Score = 37.0 bits (84), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 20/35 (57%)

Query: 127 PYNLWSSSTMAMEYYPEWLNVPKTIANKLKPFDMP 161
           P + W SS   +E++ EW N+P  +   LKPF  P
Sbjct: 159 PLSPWISSATGLEFFSEWENIPSELLKNLKPFHPP 193

>Smik_6.356 Chr6 (572523..573284) [762 bp, 253 aa] {ON} YPL159C
           (REAL)
          Length = 253

 Score = 41.6 bits (96), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 28/37 (75%), Gaps = 1/37 (2%)

Query: 16  KKKNSDIFRLLPKVPTTQFLEPRELTRDILFSGYRPV 52
           KKK SD F  LPKVP+T  L+  ++T ++L+SGYRP+
Sbjct: 94  KKKRSD-FSWLPKVPSTSHLKQSDMTTNVLYSGYRPL 129

 Score = 36.6 bits (83), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 20/35 (57%)

Query: 127 PYNLWSSSTMAMEYYPEWLNVPKTIANKLKPFDMP 161
           P + W SS   +E++ EW N+P  +   LKPF  P
Sbjct: 159 PLSPWISSATGLEFFSEWDNIPSELLRNLKPFHPP 193

>TBLA0B03800 Chr2 complement(873861..874835) [975 bp, 324 aa] {ON}
           Anc_8.682 YPL159C
          Length = 324

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 40/65 (61%), Gaps = 8/65 (12%)

Query: 1   MKQSRLFSTTATNMIKK-KNSDIFRL-------LPKVPTTQFLEPRELTRDILFSGYRPV 52
           +  S +  T++TN I K KN ++ ++       LPKVPT + L+ R++  ++L+SGYRP+
Sbjct: 134 LSHSNILKTSSTNNIPKIKNPNVQKIKPIDYSWLPKVPTLKNLKQRDVMTNVLYSGYRPL 193

Query: 53  TYPVK 57
           +   K
Sbjct: 194 SIDFK 198

 Score = 33.1 bits (74), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 21/41 (51%)

Query: 131 WSSSTMAMEYYPEWLNVPKTIANKLKPFDMPIVSVKDKKQY 171
           W SS   +E Y EW ++P  +  KLKP   P +    K Q+
Sbjct: 235 WMSSAAGLEVYSEWDSIPIEVLKKLKPLQSPQMIKLSKNQF 275

>NDAI0K01320 Chr11 complement(297117..297893) [777 bp, 258 aa] {ON}
           Anc_8.682 YPL159C
          Length = 258

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 29/58 (50%), Gaps = 9/58 (15%)

Query: 130 LWSSSTMAMEYYPEWLNVPKTIANKLKPFDMPIVSVKDKKQYNPTHRCAFNGVLEEQL 187
           +W +S   +E + EW NVP+++   LKPF  P          +P+H       L+E+L
Sbjct: 156 IWDTSATGVETFTEWDNVPESVIRNLKPFQKPT---------SPSHMTTTTTSLDEKL 204

 Score = 29.6 bits (65), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 25/48 (52%), Gaps = 3/48 (6%)

Query: 23  FRLLPKVPTTQFLEPRELTRDILFSGYRPVTYPVKENPFFNIGTQRKG 70
           F  LPK+     L  ++++  +L+SGYRP+  P   N  F  G +  G
Sbjct: 91  FSRLPKITPPSNLRHQDISMKLLYSGYRPLFIP---NGSFQQGQKNNG 135

>SAKL0H06380g Chr8 complement(563753..564412) [660 bp, 219 aa] {ON}
           similar to uniprot|Q99373 Saccharomyces cerevisiae
           YPL159C PET20 Protein required for respiratory growth
           and stability of the mitochondrial genome
          Length = 219

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 22/38 (57%)

Query: 131 WSSSTMAMEYYPEWLNVPKTIANKLKPFDMPIVSVKDK 168
           W SS    E+Y EW NVP  +  KLKPF  P+  ++ K
Sbjct: 139 WVSSATGTEFYGEWDNVPTEVIKKLKPFQPPVDEMEKK 176

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 28/43 (65%), Gaps = 1/43 (2%)

Query: 10  TATNMIKKKNSDIFRLLPKVPTTQFLEPRELTRDILFSGYRPV 52
           T   +  KK  D +  LPK P+T+ L+ RE++ D+ +SGYRP+
Sbjct: 68  TQVELSGKKRHD-YSWLPKAPSTEHLKLREISTDVFYSGYRPI 109

>KLLA0D06061g Chr4 (520082..520831) [750 bp, 249 aa] {ON} weakly
           similar to uniprot|Q99373 Saccharomyces cerevisiae
           YPL159C PET20 Protein required for respiratory growth
           and stability of the mitochondrial genome
          Length = 249

 Score = 40.0 bits (92), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 32/62 (51%), Gaps = 3/62 (4%)

Query: 14  MIKKKNSDIFRLLPKVPTTQFLEPRELTRDILFSGYRPVTYP---VKENPFFNIGTQRKG 70
           M  KK S  +  LP+VPTT+ +   E   D+L+SGYRP+       KEN       + + 
Sbjct: 100 MATKKLSRDYSWLPRVPTTEHILREEFNSDMLYSGYRPIVVGDKNAKENKLMQFAMKLEK 159

Query: 71  LA 72
           L+
Sbjct: 160 LS 161

 Score = 37.0 bits (84), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 18/33 (54%)

Query: 131 WSSSTMAMEYYPEWLNVPKTIANKLKPFDMPIV 163
           W SS    E++ EW NVP  I   LKPF  P +
Sbjct: 166 WVSSATGQEFFSEWDNVPSEIIKDLKPFHPPSI 198

>TDEL0A06270 Chr1 (1098704..1099432) [729 bp, 242 aa] {ON} Anc_8.682
           YPL159C
          Length = 242

 Score = 40.0 bits (92), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 21/37 (56%)

Query: 131 WSSSTMAMEYYPEWLNVPKTIANKLKPFDMPIVSVKD 167
           W +S   +EYY EW ++P  +  KLKPF  P  +  D
Sbjct: 158 WVTSATGLEYYREWDSIPGELQKKLKPFTAPEQAASD 194

 Score = 39.3 bits (90), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 31/50 (62%)

Query: 3   QSRLFSTTATNMIKKKNSDIFRLLPKVPTTQFLEPRELTRDILFSGYRPV 52
           Q +  +   +   +K+    +  LP+VP+T  L+PR+++  +L+SGYRP+
Sbjct: 73  QQKKMTVEISGRGRKQQRHDYSWLPRVPSTGNLKPRDMSMKVLYSGYRPL 122

>Suva_16.151 Chr16 complement(260210..260971) [762 bp, 253 aa] {ON}
           YPL159C (REAL)
          Length = 253

 Score = 39.3 bits (90), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 27/37 (72%), Gaps = 1/37 (2%)

Query: 16  KKKNSDIFRLLPKVPTTQFLEPRELTRDILFSGYRPV 52
           +KK  D F  LP+VP+T  L+  ++T ++L+SGYRP+
Sbjct: 94  RKKRRD-FSWLPRVPSTSHLKHSDMTTNVLYSGYRPI 129

 Score = 36.2 bits (82), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 20/35 (57%)

Query: 127 PYNLWSSSTMAMEYYPEWLNVPKTIANKLKPFDMP 161
           P + W SS   +E++ EW N+P  +   LKPF  P
Sbjct: 159 PLSPWISSATGLEFFSEWENIPSELLKNLKPFHPP 193

>CAGL0M02101g Chr13 complement(254024..254827) [804 bp, 267 aa] {ON}
           some similarities with uniprot|Q99373 Saccharomyces
           cerevisiae YPL159c
          Length = 267

 Score = 39.3 bits (90), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 18/33 (54%)

Query: 131 WSSSTMAMEYYPEWLNVPKTIANKLKPFDMPIV 163
           W SS    E Y EW NVP  +   LKPF  P+V
Sbjct: 174 WVSSATGSEMYAEWDNVPGDVIKDLKPFTPPVV 206

>TPHA0G01570 Chr7 complement(319949..320716) [768 bp, 255 aa] {ON}
           Anc_8.682 YPL159C
          Length = 255

 Score = 38.5 bits (88), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 24/44 (54%), Gaps = 6/44 (13%)

Query: 23  FRLLPKVPTTQFLEPRELTRDILFSGYRPVTYPV------KENP 60
           +  LPK PTT  L   E   D+ +SGYRP++  V      +ENP
Sbjct: 103 YSSLPKAPTTHHLHSSEFNTDLFYSGYRPLSIDVNQLASEQENP 146

 Score = 32.0 bits (71), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 18/33 (54%)

Query: 131 WSSSTMAMEYYPEWLNVPKTIANKLKPFDMPIV 163
           W  S    E Y EW N+PK++ + LK F  P +
Sbjct: 169 WLFSATGSELYKEWDNIPKSVLDNLKCFHPPQI 201

>KLTH0D11396g Chr4 (931339..932016) [678 bp, 225 aa] {ON} similar to
           uniprot|Q99373 Saccharomyces cerevisiae YPL159C PET20
           Protein required for respiratory growth and stability of
           the mitochondrial genome
          Length = 225

 Score = 38.1 bits (87), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 22/40 (55%), Gaps = 2/40 (5%)

Query: 131 WSSSTMAMEYYPEWLNVPKTIANKLKPFDMPIV--SVKDK 168
           W SS    E+Y EW N+P  +  KL+PF  P    + KDK
Sbjct: 141 WISSATGTEFYGEWDNIPADVIKKLRPFQPPTDDPAAKDK 180

 Score = 36.6 bits (83), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 26/41 (63%)

Query: 11  ATNMIKKKNSDIFRLLPKVPTTQFLEPRELTRDILFSGYRP 51
           A+ +  K+    F  LPK P+T  L+ R+++  +L+SGYRP
Sbjct: 70  ASELRGKQRKTDFSWLPKAPSTDHLKHRDVSTTLLYSGYRP 110

>Skud_16.123 Chr16 complement(222359..223126) [768 bp, 255 aa] {ON}
           YPL159C (REAL)
          Length = 255

 Score = 37.7 bits (86), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 27/37 (72%), Gaps = 1/37 (2%)

Query: 16  KKKNSDIFRLLPKVPTTQFLEPRELTRDILFSGYRPV 52
           +KK  D F  LP+VP+T  L+  ++T ++L+SGYRP+
Sbjct: 94  RKKRRD-FSWLPRVPSTSHLKHTDMTTNVLYSGYRPL 129

 Score = 36.2 bits (82), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 20/35 (57%)

Query: 127 PYNLWSSSTMAMEYYPEWLNVPKTIANKLKPFDMP 161
           P + W SS   +E++ EW N+P  +   LKPF  P
Sbjct: 159 PLSPWISSATGLEFFSEWENIPSELLKNLKPFHPP 193

>TPHA0D01290 Chr4 (268062..268718) [657 bp, 218 aa] {ON} Anc_8.682
           YPL159C
          Length = 218

 Score = 37.4 bits (85), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 21/30 (70%)

Query: 23  FRLLPKVPTTQFLEPRELTRDILFSGYRPV 52
           +  LPKVP T  +  RE+T + L+SGYRP+
Sbjct: 92  YSWLPKVPQTSSITHREITTNSLYSGYRPL 121

 Score = 35.8 bits (81), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 18/32 (56%)

Query: 131 WSSSTMAMEYYPEWLNVPKTIANKLKPFDMPI 162
           W  S   +E Y EW  VP  +  KLKP+D+ I
Sbjct: 161 WMMSATGLESYSEWDYVPSKVIKKLKPYDLSI 192

>Kwal_26.8828 s26 (960466..961137) [672 bp, 223 aa] {ON} YPL159C -
           Hypothetical ORF [contig 68] FULL
          Length = 223

 Score = 37.0 bits (84), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 28/58 (48%), Gaps = 6/58 (10%)

Query: 131 WSSSTMAMEYYPEWLNVPKTIANKLKPFDMPI--VSVKDKKQYNPTHRCAFNGVLEEQ 186
           W SS    E+Y EW  VP  +  +L+PF  P    + KDKK      +    G+LE +
Sbjct: 141 WISSATGTEFYGEWDGVPADVIKQLRPFQPPADDGASKDKK----ARKLLQKGILEAE 194

 Score = 35.8 bits (81), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 21/29 (72%)

Query: 23  FRLLPKVPTTQFLEPRELTRDILFSGYRP 51
           F  LPK P+T  L+ R+++  +L+SGYRP
Sbjct: 82  FSWLPKAPSTDHLKQRDVSTTLLYSGYRP 110

>KAFR0H02380 Chr8 complement(455996..456658) [663 bp, 220 aa] {ON}
           Anc_8.682 YPL159C
          Length = 220

 Score = 34.7 bits (78), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 25/34 (73%)

Query: 26  LPKVPTTQFLEPRELTRDILFSGYRPVTYPVKEN 59
           LP+VP+T  ++ ++L  ++LFS YRP++  +K +
Sbjct: 91  LPRVPSTSNMDRKQLNTELLFSAYRPLSMDLKSD 124

>KLLA0A07447g Chr1 (669272..670732) [1461 bp, 486 aa] {ON} similar
           to uniprot|P48564 Saccharomyces cerevisiae YNL295W
          Length = 486

 Score = 35.4 bits (80), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 41/174 (23%), Positives = 69/174 (39%), Gaps = 21/174 (12%)

Query: 16  KKKNSDIFRLLPKVPTTQFLEPRELTRDILFSGYRPV---TYPVKENPFFNIGTQRKGLA 72
           KK+ ++   L+P+VP+T +L   +L  + LF+GY+P+     P++ N   N      GL 
Sbjct: 80  KKRKAEKSFLVPQVPSTDYLPREDLETEGLFAGYKPLFLGNSPLESN---NNDVLLDGLF 136

Query: 73  GETSXXXXXXXXXXXXXXXXXHNVMAXXXXXXXXXXXXXXXTWRYNPRIPTKLLPYNLWS 132
                                 + M                     P+IP        W 
Sbjct: 137 SSIRKLKNAQINSENNTVEIDVSDMLDDLKKDNQEYQRLHEK---APKIP--------WD 185

Query: 133 SSTMAMEYYPE-WLNVPKTIANKLKPFDMPIV---SVKDKKQYNPTHRCAFNGV 182
           +S   + Y  E +  VP+++ +KLKPF +  V   + KDK+  N   +  F+G 
Sbjct: 186 ASISGLVYNDEPFKGVPRSVVSKLKPFKLVRVEKKNSKDKEAKNDKIKLKFHGT 239

>TDEL0E00710 Chr5 (152143..153573) [1431 bp, 476 aa] {ON} Anc_3.62
           YNL295W
          Length = 476

 Score = 34.3 bits (77), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 21/28 (75%)

Query: 25  LLPKVPTTQFLEPRELTRDILFSGYRPV 52
           LLP+VP+T ++   E+  + LF+GYRP+
Sbjct: 74  LLPRVPSTDYIPNTEVQTEGLFAGYRPL 101

>Skud_14.42 Chr14 (70507..72081) [1575 bp, 524 aa] {ON} YNL295W
           (REAL)
          Length = 524

 Score = 33.9 bits (76), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 25/33 (75%)

Query: 20  SDIFRLLPKVPTTQFLEPRELTRDILFSGYRPV 52
           S++  L+PKV +T+++  +E+  + LF+GYRP+
Sbjct: 105 SNLHLLVPKVASTEYIPIKEVHTEGLFAGYRPL 137

>Kpol_1066.44 s1066 complement(74670..76109) [1440 bp, 479 aa] {ON}
           complement(74670..76109) [1440 nt, 480 aa]
          Length = 479

 Score = 33.9 bits (76), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 21/28 (75%)

Query: 25  LLPKVPTTQFLEPRELTRDILFSGYRPV 52
           +LP+VP+T+ +   E+  D LF+GYRP+
Sbjct: 73  ILPRVPSTENIPVEEVQTDGLFAGYRPL 100

>YNL295W Chr14 (76946..78520) [1575 bp, 524 aa] {ON} Putative
           protein of unknown function
          Length = 524

 Score = 33.1 bits (74), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 24/33 (72%)

Query: 20  SDIFRLLPKVPTTQFLEPRELTRDILFSGYRPV 52
           S++  L+P+V +T ++  +E+  + LF+GYRP+
Sbjct: 105 SNLHLLVPRVASTDYISNKEVHTEGLFAGYRPL 137

>NCAS0A09940 Chr1 complement(1986687..1988171) [1485 bp, 494 aa]
          {ON} Anc_3.62 YNL295W
          Length = 494

 Score = 33.1 bits (74), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 21/28 (75%)

Query: 25 LLPKVPTTQFLEPRELTRDILFSGYRPV 52
          ++PKVPTT ++   E+  + LF+GY+P+
Sbjct: 69 IVPKVPTTDYIPSLEMQTEGLFAGYKPL 96

>Ecym_2390 Chr2 complement(757433..758116) [684 bp, 227 aa] {ON}
           similar to Ashbya gossypii AAL087C
          Length = 227

 Score = 32.3 bits (72), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 13/38 (34%), Positives = 20/38 (52%)

Query: 131 WSSSTMAMEYYPEWLNVPKTIANKLKPFDMPIVSVKDK 168
           W  +      Y EW NVP+++   L+P+  P V  K+K
Sbjct: 145 WVKNATGRVLYDEWDNVPQSVIRNLRPYVPPKVETKEK 182

 Score = 30.8 bits (68), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 11/31 (35%), Positives = 20/31 (64%)

Query: 23  FRLLPKVPTTQFLEPRELTRDILFSGYRPVT 53
           +   P  P T+ L+  ++  D+L+SGYRP++
Sbjct: 86  YSWFPVAPKTEHLKEGDIAVDLLYSGYRPLS 116

>Suva_14.44 Chr14 (73757..75334) [1578 bp, 525 aa] {ON} YNL295W
           (REAL)
          Length = 525

 Score = 32.3 bits (72), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 23/33 (69%)

Query: 20  SDIFRLLPKVPTTQFLEPRELTRDILFSGYRPV 52
           S++  L+PKV +T  +  +E+  + LF+GYRP+
Sbjct: 106 SNLHLLVPKVASTDHIPKKEVNTEGLFAGYRPL 138

>Smik_14.36 Chr14 (61288..62862) [1575 bp, 524 aa] {ON} YNL295W
           (REAL)
          Length = 524

 Score = 32.0 bits (71), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 21/28 (75%)

Query: 25  LLPKVPTTQFLEPRELTRDILFSGYRPV 52
           L+PKV +T  ++ +E+  + LF+GYRP+
Sbjct: 110 LVPKVASTDHIQNKEVHTEGLFAGYRPL 137

>TBLA0B02720 Chr2 (626800..628308) [1509 bp, 502 aa] {ON} Anc_8.798
           YOR320C
          Length = 502

 Score = 31.6 bits (70), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 29/54 (53%), Gaps = 7/54 (12%)

Query: 17  KKNSDIFRLLPKVPTTQFLEPRELTRDILFSGYRPVTYPVKENPFFNIGTQRKG 70
           KK   I+  LP +P T +L  + L +DI+ SG  P+  P+     F+ GT+  G
Sbjct: 267 KKGQMIYNHLPSLPDTLYLNAKNLGQDIISSG--PLYSPI-----FDYGTESVG 313

>ZYRO0C02244g Chr3 complement(174640..176022) [1383 bp, 460 aa]
          {ON} similar to gnl|GLV|KLLA0A07447g Kluyveromyces
          lactis KLLA0A07447g and weakly similar to YNL295W
          uniprot|P48564 Saccharomyces cerevisiae YNL295W
          Hypothetical ORF
          Length = 460

 Score = 31.2 bits (69), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 11/28 (39%), Positives = 20/28 (71%)

Query: 25 LLPKVPTTQFLEPRELTRDILFSGYRPV 52
          ++P+VP T ++   E+  + LF+GYRP+
Sbjct: 57 VVPRVPPTDYISAPEIQTEGLFAGYRPL 84

>TPHA0P01260 Chr16 complement(252274..253758) [1485 bp, 494 aa] {ON}
           Anc_3.62 YNL295W
          Length = 494

 Score = 30.8 bits (68), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 19/28 (67%)

Query: 25  LLPKVPTTQFLEPRELTRDILFSGYRPV 52
           L+PKV +T  L   E+  + LF+GYRP+
Sbjct: 88  LVPKVASTDNLSSAEIQTEGLFAGYRPL 115

>Kpol_1013.23 s1013 complement(54054..55028) [975 bp, 324 aa] {ON}
           complement(54054..55028) [975 nt, 325 aa]
          Length = 324

 Score = 30.0 bits (66), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 36/134 (26%), Positives = 58/134 (43%), Gaps = 20/134 (14%)

Query: 125 LLPY-NLWSSSTMAMEYYPEWLNVP-KTIANKLKPFDMPIVSVKDKKQYNPTHR------ 176
           +L Y NL   +TM  EYY + +N   KTI N      M ++   + + ++P  +      
Sbjct: 174 VLSYCNLNLQNTMLNEYYQKLMNCNLKTICNA-SILSMSLLRSNETRSFHPCSKELREAA 232

Query: 177 ------CAFNGVLEEQLPFAKEEENKQQLSDNNSLVLEGEGVHKIKHAYMNYRK-KKQNG 229
                 C  NGV   +L          Q       VL    V +++H+  +Y+K KKQNG
Sbjct: 233 DRSSEYCKSNGV---ELADLATRYALSQWYGKGPTVLGVSSVKELEHSLNSYKKVKKQNG 289

Query: 230 KFLDKKLSKQVDQF 243
             LD+  +K ++  
Sbjct: 290 -LLDESDNKMIEHI 302

>Skud_10.102 Chr10 (173179..175305) [2127 bp, 708 aa] {ON} YJL112W
           (REAL)
          Length = 708

 Score = 30.0 bits (66), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 39/79 (49%), Gaps = 1/79 (1%)

Query: 171 YNPTHRCAFNGVLEEQLPFAKEEENKQQLSDNNSLVLEGEGVHKIKHAYMNYRKKKQNGK 230
           Y+PT   +F+  L   L F   ++N   LS+   + LE EG+ + K   +      +  +
Sbjct: 218 YSPTALKSFSQTLVNSLEFLNIQKN-STLSEVKDIDLEIEGLRQTKEKLLTKIANIEQNQ 276

Query: 231 FLDKKLSKQVDQFIKYLKE 249
           FL +   KQ+D  + +L+E
Sbjct: 277 FLLEDNLKQIDDRMDFLEE 295

>SAKL0C12342g Chr3 complement(1099949..1101607) [1659 bp, 552 aa]
           {ON} similar to uniprot|P48564 Saccharomyces cerevisiae
           YNL295W Hypothetical ORF
          Length = 552

 Score = 30.0 bits (66), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 11/28 (39%), Positives = 19/28 (67%)

Query: 25  LLPKVPTTQFLEPRELTRDILFSGYRPV 52
           L+P VP T ++   E+  + LF+GY+P+
Sbjct: 160 LVPHVPNTDYIPHSEIQTEGLFAGYKPL 187

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.132    0.390 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 26,471,425
Number of extensions: 1150973
Number of successful extensions: 4279
Number of sequences better than 10.0: 76
Number of HSP's gapped: 4447
Number of HSP's successfully gapped: 104
Length of query: 253
Length of database: 53,481,399
Length adjustment: 107
Effective length of query: 146
Effective length of database: 41,212,137
Effective search space: 6016972002
Effective search space used: 6016972002
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 64 (29.3 bits)