Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0F02596g3.497ON1132112556370.0
Ecym_12323.497ON1204119228950.0
AFR316W3.497ON1191115728730.0
KLTH0G02442g3.497ON1113110028700.0
Kwal_47.188863.497ON1105114428190.0
ZYRO0D09790g3.497ON1180110721510.0
Suva_7.4223.497ON1127113621100.0
Skud_7.4453.497ON1123113420700.0
YGR134W (CAF130)3.497ON1122120220290.0
TDEL0D056503.497ON1077109419870.0
Smik_6.2303.497ON1124112919860.0
KAFR0C020003.497ON1066109519770.0
NCAS0E007703.497ON115087918640.0
KNAG0B007703.497ON103898817030.0
Kpol_480.123.497ON111484416860.0
NDAI0G009003.497ON1279119216900.0
TBLA0C045103.497ON1307108616600.0
CAGL0I10428g3.497ON1163109214960.0
TPHA0A056803.497ON107481714420.0
KLLA0E03961g3.497ON1132114412691e-155
NDAI0J023504.264ON66491820.52
ZYRO0G13684g8.821ON162497810.73
SAKL0G07458g5.402ON3725122754.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0F02596g
         (1132 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0F02596g Chr6 complement(221983..225381) [3399 bp, 1132 aa] ...  2175   0.0  
Ecym_1232 Chr1 complement(477523..481137) [3615 bp, 1204 aa] {ON...  1119   0.0  
AFR316W Chr6 (1008188..1011763) [3576 bp, 1191 aa] {ON} Syntenic...  1111   0.0  
KLTH0G02442g Chr7 complement(189819..193160) [3342 bp, 1113 aa] ...  1110   0.0  
Kwal_47.18886 s47 (1013635..1016952) [3318 bp, 1105 aa] {ON} YGR...  1090   0.0  
ZYRO0D09790g Chr4 complement(828446..831988) [3543 bp, 1180 aa] ...   833   0.0  
Suva_7.422 Chr7 (727936..731319) [3384 bp, 1127 aa] {ON} YGR134W...   817   0.0  
Skud_7.445 Chr7 (736960..740331) [3372 bp, 1123 aa] {ON} YGR134W...   801   0.0  
YGR134W Chr7 (757770..761138) [3369 bp, 1122 aa] {ON}  CAF130Par...   786   0.0  
TDEL0D05650 Chr4 (1015679..1018912) [3234 bp, 1077 aa] {ON} Anc_...   769   0.0  
Smik_6.230 Chr6 (375653..379027) [3375 bp, 1124 aa] {ON} YGR134W...   769   0.0  
KAFR0C02000 Chr3 (396123..399323) [3201 bp, 1066 aa] {ON} Anc_3....   766   0.0  
NCAS0E00770 Chr5 complement(141832..145284) [3453 bp, 1150 aa] {...   722   0.0  
KNAG0B00770 Chr2 complement(142612..145728) [3117 bp, 1038 aa] {...   660   0.0  
Kpol_480.12 s480 complement(23340..26684) [3345 bp, 1114 aa] {ON...   654   0.0  
NDAI0G00900 Chr7 complement(187653..191492) [3840 bp, 1279 aa] {...   655   0.0  
TBLA0C04510 Chr3 (1092230..1096153) [3924 bp, 1307 aa] {ON} Anc_...   644   0.0  
CAGL0I10428g Chr9 complement(1031462..1034953) [3492 bp, 1163 aa...   580   0.0  
TPHA0A05680 Chr1 (1285934..1289158) [3225 bp, 1074 aa] {ON} Anc_...   560   0.0  
KLLA0E03961g Chr5 complement(358995..362393) [3399 bp, 1132 aa] ...   493   e-155
NDAI0J02350 Chr10 complement(575858..577852) [1995 bp, 664 aa] {...    36   0.52 
ZYRO0G13684g Chr7 (1092969..1097843) [4875 bp, 1624 aa] {ON} sim...    36   0.73 
SAKL0G07458g Chr7 complement(609418..620595) [11178 bp, 3725 aa]...    33   4.5  

>SAKL0F02596g Chr6 complement(221983..225381) [3399 bp, 1132 aa] {ON}
            similar to uniprot|P53280 Saccharomyces cerevisiae
            YGR134W CAF130 Part of the evolutionarily-conserved CCR4-
            NOT transcriptional regulatory complex involved in
            controlling mRNA initiation elongation and degradation
          Length = 1132

 Score = 2175 bits (5637), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1054/1125 (93%), Positives = 1054/1125 (93%)

Query: 1    MTKKKKAVSVDSHDETHKGMALSRLCKDYYPDQRNLTIPHVEEFPDAVVQEMLILSLFVT 60
            MTKKKKAVSVDSHDETHKGMALSRLCKDYYPDQRNLTIPHVEEFPDAVVQEMLILSLFVT
Sbjct: 1    MTKKKKAVSVDSHDETHKGMALSRLCKDYYPDQRNLTIPHVEEFPDAVVQEMLILSLFVT 60

Query: 61   LPGHSILELYYDLSCGRVDLSSYKQWQHSQVRSTDGYKKLVKRWSTSTXXXXXXXXXXXQ 120
            LPGHSILELYYDLSCGRVDLSSYKQWQHSQVRSTDGYKKLVKRWSTST           Q
Sbjct: 61   LPGHSILELYYDLSCGRVDLSSYKQWQHSQVRSTDGYKKLVKRWSTSTLVLLRFTDLLLQ 120

Query: 121  NKNVPLEYTKHNTAEYKLSLIFLLDKQNEFXXXXXXXXXXXXXXXHAKPMIESILLGNIP 180
            NKNVPLEYTKHNTAEYKLSLIFLLDKQNEF               HAKPMIESILLGNIP
Sbjct: 121  NKNVPLEYTKHNTAEYKLSLIFLLDKQNEFLILDPDYNLLLDYLLHAKPMIESILLGNIP 180

Query: 181  GLLKALVYQYNKLPEFNGCHTWYTFRTHYHGTQEIFHKFFIALTDKFTASKEIMPELEGW 240
            GLLKALVYQYNKLPEFNGCHTWYTFRTHYHGTQEIFHKFFIALTDKFTASKEIMPELEGW
Sbjct: 181  GLLKALVYQYNKLPEFNGCHTWYTFRTHYHGTQEIFHKFFIALTDKFTASKEIMPELEGW 240

Query: 241  FVEGPVSRDSGCIKPITGDDYTSSAAIDDFNEDYWTQQKTNTQEQVYSFELNEDGTLEIP 300
            FVEGPVSRDSGCIKPITGDDYTSSAAIDDFNEDYWTQQKTNTQEQVYSFELNEDGTLEIP
Sbjct: 241  FVEGPVSRDSGCIKPITGDDYTSSAAIDDFNEDYWTQQKTNTQEQVYSFELNEDGTLEIP 300

Query: 301  NVFAHTKRRHDALYKVLGLNDDPTPLLKSCFLTFCCLADPVTQPPPNDKHIVSLDLLSDM 360
            NVFAHTKRRHDALYKVLGLNDDPTPLLKSCFLTFCCLADPVTQPPPNDKHIVSLDLLSDM
Sbjct: 301  NVFAHTKRRHDALYKVLGLNDDPTPLLKSCFLTFCCLADPVTQPPPNDKHIVSLDLLSDM 360

Query: 361  FLGLMYPEITADLVQPLNKDTWTLHICFNLQKIINATLSRLNCDDFTRLNEINNSDDSVD 420
            FLGLMYPEITADLVQPLNKDTWTLHICFNLQKIINATLSRLNCDDFTRLNEINNSDDSVD
Sbjct: 361  FLGLMYPEITADLVQPLNKDTWTLHICFNLQKIINATLSRLNCDDFTRLNEINNSDDSVD 420

Query: 421  WRKNLYKWLPQGLNTQDLELIYMVDILATYTIYKLYSNRPIQMNPFLLPMISLWKNLTCV 480
            WRKNLYKWLPQGLNTQDLELIYMVDILATYTIYKLYSNRPIQMNPFLLPMISLWKNLTCV
Sbjct: 421  WRKNLYKWLPQGLNTQDLELIYMVDILATYTIYKLYSNRPIQMNPFLLPMISLWKNLTCV 480

Query: 481  VLLGLEIDRLEEEQETFNTPVMVRATIRGASALRSVLATIINGHARYKSHDFKHEPINLF 540
            VLLGLEIDRLEEEQETFNTPVMVRATIRGASALRSVLATIINGHARYKSHDFKHEPINLF
Sbjct: 481  VLLGLEIDRLEEEQETFNTPVMVRATIRGASALRSVLATIINGHARYKSHDFKHEPINLF 540

Query: 541  MSPHGRKLCNGALYADLRSHAATMLALGIXXXXXXXXXXXXQPGDRFDEDVKYMFDYEFD 600
            MSPHGRKLCNGALYADLRSHAATMLALGI            QPGDRFDEDVKYMFDYEFD
Sbjct: 541  MSPHGRKLCNGALYADLRSHAATMLALGIELETLTDLLSDLQPGDRFDEDVKYMFDYEFD 600

Query: 601  DYNEVDTELMADDELEDIESRERIKEVRGYYKRCHCVFDDDSLVPENXXXXXXXXXXXXT 660
            DYNEVDTELMADDELEDIESRERIKEVRGYYKRCHCVFDDDSLVPEN            T
Sbjct: 601  DYNEVDTELMADDELEDIESRERIKEVRGYYKRCHCVFDDDSLVPENEDGGGEEGDQEDT 660

Query: 661  KKHLQDSHEDQLPPQQNVVMSTTSKPLAVRSRDTVEFDFNGRDWRDIPRGLNFYYTDAYI 720
            KKHLQDSHEDQLPPQQNVVMSTTSKPLAVRSRDTVEFDFNGRDWRDIPRGLNFYYTDAYI
Sbjct: 661  KKHLQDSHEDQLPPQQNVVMSTTSKPLAVRSRDTVEFDFNGRDWRDIPRGLNFYYTDAYI 720

Query: 721  FVTKLHADVVHYLMKEATRKKLERNHASFILRSIATCVKLEQEEAIVRRALGNQDGDKSS 780
            FVTKLHADVVHYLMKEATRKKLERNHASFILRSIATCVKLEQEEAIVRRALGNQDGDKSS
Sbjct: 721  FVTKLHADVVHYLMKEATRKKLERNHASFILRSIATCVKLEQEEAIVRRALGNQDGDKSS 780

Query: 781  NATTIKTENELTSDFIYEKWCEDSLFEKMMYHNSDLVWRMMDEMLMCSGYRRVLIWFITH 840
            NATTIKTENELTSDFIYEKWCEDSLFEKMMYHNSDLVWRMMDEMLMCSGYRRVLIWFITH
Sbjct: 781  NATTIKTENELTSDFIYEKWCEDSLFEKMMYHNSDLVWRMMDEMLMCSGYRRVLIWFITH 840

Query: 841  LEINHSVIHYIFELVMGLRGNITYEDDEEKSKNLDALDGLAQGSSTSELTLPFSRQGPII 900
            LEINHSVIHYIFELVMGLRGNITYEDDEEKSKNLDALDGLAQGSSTSELTLPFSRQGPII
Sbjct: 841  LEINHSVIHYIFELVMGLRGNITYEDDEEKSKNLDALDGLAQGSSTSELTLPFSRQGPII 900

Query: 901  LSSIEVNMLLQEFFTNAAIFFSSKLRXXXXXXXXXXXXXXXXXXXXXVPPHVIGLMKLVC 960
            LSSIEVNMLLQEFFTNAAIFFSSKLR                     VPPHVIGLMKLVC
Sbjct: 901  LSSIEVNMLLQEFFTNAAIFFSSKLRESFDSENEELDENFEDEDEFSVPPHVIGLMKLVC 960

Query: 961  FMVDTLMQKKKFDFTDSEYIFELQTLLMNWIGIVPEARDLFFKLKSQIVATSQDTQEQGT 1020
            FMVDTLMQKKKFDFTDSEYIFELQTLLMNWIGIVPEARDLFFKLKSQIVATSQDTQEQGT
Sbjct: 961  FMVDTLMQKKKFDFTDSEYIFELQTLLMNWIGIVPEARDLFFKLKSQIVATSQDTQEQGT 1020

Query: 1021 PVKESEKDDIDAPDTLEMNDTMSEHNKKLMMLIPPGTTNERNALTALRGFIGKYSLTNKT 1080
            PVKESEKDDIDAPDTLEMNDTMSEHNKKLMMLIPPGTTNERNALTALRGFIGKYSLTNKT
Sbjct: 1021 PVKESEKDDIDAPDTLEMNDTMSEHNKKLMMLIPPGTTNERNALTALRGFIGKYSLTNKT 1080

Query: 1081 AVFGRKIIYQDDEIMGMYMTDKEMMYREFLAEFGIDYNDIVEGVY 1125
            AVFGRKIIYQDDEIMGMYMTDKEMMYREFLAEFGIDYNDIVEGVY
Sbjct: 1081 AVFGRKIIYQDDEIMGMYMTDKEMMYREFLAEFGIDYNDIVEGVY 1125

>Ecym_1232 Chr1 complement(477523..481137) [3615 bp, 1204 aa] {ON}
            similar to Ashbya gossypii AFR316W
          Length = 1204

 Score = 1119 bits (2895), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 614/1192 (51%), Positives = 776/1192 (65%), Gaps = 106/1192 (8%)

Query: 22   LSRLCKDYYPDQRNLT---IPHVEEFPDAVVQEMLILSLFVTLPGHSILELYYDLSCGRV 78
            L+ + + Y PD R+L    +   +E  DA++ E ++++LF+T  G+S+L + YDL CGR+
Sbjct: 18   LTSIFRTYKPDIRSLVEFRLNVGDEHFDALITEKVVVTLFMTRSGNSMLHMLYDLCCGRI 77

Query: 79   DLSSYKQWQHSQVRSTDGY-KKLVKRWSTSTXXXXXXXXXXXQNKNVPLEYTKHNTAEYK 137
             L+ YKQ    +VRS   Y K   K W +             +N+N  L+Y ++ +A  K
Sbjct: 78   KLTEYKQ--SLKVRSNHSYWKSCYKDWGSRRDILSEFLDFCLRNENCALDYIEYASATRK 135

Query: 138  LSLIFLLDKQNEFXXXXXXXXXXXXXXXHAKPMIESILLGNIPGLLKALVYQYNKLPEFN 197
            L L FLL +                    ++PM E +L   IP  L  LV +YN+  EFN
Sbjct: 136  LPLQFLLPEPLRPYLIDDEYNLLLDYMIQSRPMWEMLLTQGIPKFLPELVDEYNRSYEFN 195

Query: 198  GCHTWYTFRTHYH-----GTQEIFHKFFIALTDKFTASKEIMPELEG--WFVEGPVSRDS 250
            G + WY   T         T+E++ KFF  L DK T +KE++P+L    W    P S   
Sbjct: 196  GYYVWYGNVTCSQVQVQSSTKELYTKFFYTLFDKLTVTKELLPKLNVALWSHSWPASYTK 255

Query: 251  GCIKPITGDDYTSSAAIDDFNEDYWTQQKTNTQEQVYSFELNEDGTLEIPNVFAHTKRRH 310
              +  ++ DD        D   D+W QQK +++EQV++F+LN DGTLE PNVF H K+RH
Sbjct: 256  QTLLDLSNDDDDHYDQDVDSENDHWPQQKLSSREQVFTFDLNRDGTLEFPNVFLHAKKRH 315

Query: 311  DALYKVLGLNDDPTPLLKSCFLTFCCLADPVTQPPPNDKHIVSLDLLSDMFLGLMYPEIT 370
            + LY+VLGL D   PLLK+ F+T   L DP+TQPPP + HI+S+DL+  MFLG      T
Sbjct: 316  EILYRVLGLPDAEGPLLKAQFMTLAALVDPITQPPPTEDHIISIDLIFQMFLG-----ST 370

Query: 371  ADLVQPL---NKDTWTLHICFNLQKIINATLSRLNCDDFTRLNEINNSDDSVDWRKNLYK 427
            ++L++ +       W  H+C+N+QKI+ AT+ RLNC D   LN +NNSD+SV W  NL K
Sbjct: 371  SNLIENMLISRGRDWRFHVCYNMQKIVLATMKRLNCHDGDVLNTVNNSDESVHWNVNLDK 430

Query: 428  WLPQGLNTQDLELIYMVDILATYTIYKLYSNRPIQMNPFLLPMISLWKNLTCVVLLGLEI 487
            W P+GLNTQDLEL+YMVD+L+ Y +Y+LYS  P+QMNPFL   + LWKNLT V+L GLEI
Sbjct: 431  WTPRGLNTQDLELLYMVDMLSIYAMYRLYSYLPVQMNPFLPLALHLWKNLTNVLLRGLEI 490

Query: 488  DRLEEEQETFNTPVMVRATIRGASALRSVLATIINGHARYKSHDFKHEPINLFMSPHGRK 547
            DR EE++ETFNTP++VRA IRG +ALRSV+AT+IN H   K HDFKHEPINLFMSPHGRK
Sbjct: 491  DRFEEDRETFNTPIIVRAAIRGTAALRSVVATMINDHFSSKEHDFKHEPINLFMSPHGRK 550

Query: 548  LCNGALYADLRSHAATMLALGIXXXXXXXXXXXXQPGDRFDEDVKYMFDYEFDDYNEVDT 607
            LC+GALYAD+RSHAA ML+LGI            QPGDRFD+DVKYMFDYE+DDYN +D 
Sbjct: 551  LCHGALYADVRSHAAAMLSLGIDLNDVTDLLSDLQPGDRFDDDVKYMFDYEYDDYNAIDP 610

Query: 608  ELMAD------DELEDIESRERIKEVRGYYKRCHCVFDDDSLVPENXXXXXXXXXXXXTK 661
            E + D      + LE+I+ RERIK++RGYYKRCHCVFDDD L+ +              K
Sbjct: 611  EQLYDENEEDLERLEEIQQRERIKDMRGYYKRCHCVFDDDELLSDEEEGETASSNIDRPK 670

Query: 662  KHLQDSHEDQLPPQQNVVMSTT-----SKPLAVRSRDTVEFDFNGRDWRDIPRGLNFYYT 716
                 SH     P    ++STT     S+  A+RSRD V+FDFNG+DWRDIPRGLNFYYT
Sbjct: 671  Y----SHNSLNLPSS--MLSTTFNGPNSQKFAIRSRDGVDFDFNGKDWRDIPRGLNFYYT 724

Query: 717  DAYIFVTKLHADVVHYLMKEATRKKLERNHASFILRSIATCVKLEQEEAIVRRAL-GNQD 775
            + Y+FV KLHADVV+YLMKEAT KK+E NHASFILRSIATC+KLEQE+++V   + G  D
Sbjct: 725  EHYVFVNKLHADVVYYLMKEATTKKMEPNHASFILRSIATCIKLEQEKSMVYDVMNGRTD 784

Query: 776  GDKSSNATTIKTENELTSDFIYEKWCEDSLFEKMMYHNSDLVWRMMDEMLMCSGYRRVLI 835
               SSN+ + +  NELTSDFIYEKWCE+SLF KMMY+N+DLVWRMMDEMLMCSGYRRVLI
Sbjct: 785  KGSSSNSNSDRV-NELTSDFIYEKWCEESLFTKMMYYNNDLVWRMMDEMLMCSGYRRVLI 843

Query: 836  WFITHLEINHSVIHYIFELVMGLRGNITYEDDEE---KSKNLDALDGLAQGSSTSELTLP 892
            WFITHLEI+HS+IHYIFELVMG+RGN+ Y+++ E   K++NLD LD L+ GSS+  + +P
Sbjct: 844  WFITHLEISHSLIHYIFELVMGMRGNVDYDEEAEDDIKNRNLDILDSLSLGSSSVTIKIP 903

Query: 893  FSRQGPIILSSIEVNMLLQEFFTNAAIFFSSKLRXXXXXXXXXXXXXXXXXX-------- 944
            FSRQGPIILS IE+NMLL EFF NA I+FS  ++                          
Sbjct: 904  FSRQGPIILSIIEINMLLLEFFINATIYFSDNMKNLNSDEELPLSQSENEGSDDLEYGLC 963

Query: 945  ------XXXVPPHVIGLMKLVCFMVDTLMQKKKFDFTDSEYIFELQTLLMNWIGIVPEAR 998
                     V PHVIGLMKLVCFMVD LM+KKKFDFTDSEYIFELQTLLMNWIGI+PEAR
Sbjct: 964  EDGDKDTLGVSPHVIGLMKLVCFMVDMLMEKKKFDFTDSEYIFELQTLLMNWIGIIPEAR 1023

Query: 999  DLFFKLKSQIV-ATSQD----TQEQGTP----------VKESEK---------------- 1027
            +LFFKLKS I+ A+SQ+    + +QGT           V E E                 
Sbjct: 1024 NLFFKLKSSILEASSQNDSSKSDKQGTENIRKKSSQSLVTEGEGIEQKIVNIDREDHLEN 1083

Query: 1028 --DDIDAPDT----------------LEMNDTMSEHNKKLMMLIPPGTTNERNALTALRG 1069
               D D P T                ++ N+ +S++NK L+ L+P    NE  A+TALR 
Sbjct: 1084 CLSDADFPPTPIDINNLKLENVGSPEIDNNNNLSKYNKMLIELLPLHVDNENTAVTALRS 1143

Query: 1070 FIGKYSLTNKTAVFGRKIIYQDDEIMGMYMTDKEMMYREFLAEFGIDYNDIV 1121
            FI K+SLTNKTAVFGR++IYQD  IMG+YM DKEM  REFLAEFGIDYN +V
Sbjct: 1144 FITKHSLTNKTAVFGRRVIYQDHAIMGLYMADKEMRQREFLAEFGIDYNSVV 1195

>AFR316W Chr6 (1008188..1011763) [3576 bp, 1191 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YGR134W (CAF130)
          Length = 1191

 Score = 1111 bits (2873), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 589/1157 (50%), Positives = 748/1157 (64%), Gaps = 91/1157 (7%)

Query: 39   PHVEEFPDAVVQEMLILSLFVTLPGHSILELYYDLSCGRVDLSSYKQWQHSQVRS-TDGY 97
            PH E     ++ E ++++LF+T  G+SIL L YDLSCGR+ LS Y+Q    +VRS    +
Sbjct: 42   PHFE----LMIVEKVVVTLFMTRGGNSILHLLYDLSCGRIKLSEYRQ--SLKVRSNVHQW 95

Query: 98   KKLVKRWSTSTXXXXXXXXXXXQNKNVPLEYTKHNTAEYKLSLIFLLDKQNEFXXXXXXX 157
            K   K W +             +N++  L+YT++     KL L FLL             
Sbjct: 96   KTCYKEWGSRRDTLSRFLDFCLRNEDCALDYTEYGRVMRKLPLQFLLPAGLHAYVLDEGY 155

Query: 158  XXXXXXXXHAKPMIESILLGNIPGLLKALVYQYNKLPEFNGCHTWYTFRTHY----HGTQ 213
                    +++ M E +L+  IP LL  L+  YN++ EFNG +TWY          + T+
Sbjct: 156  NLLLDYIINSRLMWEELLIQGIPRLLPELIEDYNRVFEFNGYYTWYGGAPSGAGAANSTR 215

Query: 214  EIFHKFFIALTDKFTASKEIMPELEG--WFVEGPVSRDSGCIKPITGDDYTSSAAIDDFN 271
            E+  K   AL DK T +KE++P L    W    P       I   + ++        +  
Sbjct: 216  ELHTKVLYALFDKLTVAKELLPRLNATVWSHSWPPMYHKHGINEFSNEEEDLYDFDSELE 275

Query: 272  EDYWTQQKTNTQEQVYSFELNEDGTLEIPNVFAHTKRRHDALYKVLGLNDDPTPLLKSCF 331
             D W Q K++ +EQVY+FELN DG+LE PNVF HT+RRH+ LY++LGL +   PLL++ F
Sbjct: 276  GDSWPQHKSSAKEQVYTFELNRDGSLEFPNVFLHTRRRHETLYRILGLPNRECPLLRAQF 335

Query: 332  LTFCCLADPVTQPPPNDKHIVSLDLLSDMFLGLMYPEITADLVQPLNKDTWTLHICFNLQ 391
            +T C L DP+TQPPP +KHI+S+DL+  MFLG +    ++ L   L    W  H+C NLQ
Sbjct: 336  MTLCALVDPITQPPPTEKHIISIDLIYQMFLGSI----SSLLESSLRGQDWRFHVCHNLQ 391

Query: 392  KIINATLSRLNCDDFTRLNEINNSDDSVDWRKNLYKWLPQGLNTQDLELIYMVDILATYT 451
            KII AT+ RLNC D   LN INNSD++V W  N+ KW P+GLNTQDLEL+YMVD+L  YT
Sbjct: 392  KIILATMKRLNCHDSEVLNSINNSDETVHWNVNIGKWTPRGLNTQDLELLYMVDMLGIYT 451

Query: 452  IYKLYSNRPIQMNPFLLPMISLWKNLTCVVLLGLEIDRLEEEQETFNTPVMVRATIRGAS 511
            IY+LYS+ P+QMNPFL     LWKNLT V+LLGLEIDR EE++ETF+TP++VRATIRG++
Sbjct: 452  IYQLYSDLPVQMNPFLPLSFHLWKNLTNVLLLGLEIDRFEEDRETFSTPIIVRATIRGSA 511

Query: 512  ALRSVLATIINGHARYKSHDFKHEPINLFMSPHGRKLCNGALYADLRSHAATMLALGIXX 571
            ALRSV+AT+IN H   K HDFKHEPINLFMSPHGRKLC GALYAD+RSHAA MLALGI  
Sbjct: 512  ALRSVVATMINSHFSIKEHDFKHEPINLFMSPHGRKLCQGALYADVRSHAAAMLALGIEL 571

Query: 572  XXXXXXXXXXQPGDRFDEDVKYMFDYEFDDYNEVDTELMAD------DELEDIESRERIK 625
                      QPGDRFD+DVKYMFDYE+DDYN +D E + D      + LE+I+ RERIK
Sbjct: 572  NDVTDLLSDLQPGDRFDDDVKYMFDYEYDDYNAIDPEQLYDENEEDLERLEEIQQRERIK 631

Query: 626  EVRGYYKRCHCVFDDDSLVPENXXXXXXXXXXXXTKKHLQDSHEDQLPPQQNVVMSTTSK 685
            ++RGYYKRCHCVFDDD L+ +             T  H+ ++   Q  P   V   +TS 
Sbjct: 632  DMRGYYKRCHCVFDDDELLSDE----EGTDTGEHTDNHITETV--QSAPLNLVTGVSTSG 685

Query: 686  P--LAVRSRDTVEFDFNGRDWRDIPRGLNFYYTDAYIFVTKLHADVVHYLMKEATRKKLE 743
            P  +AVRSRD VEFDFNG+DWRDIPRG+NFYY + Y+FV KLHADV+HYLMKEAT KKLE
Sbjct: 686  PQKVAVRSRDYVEFDFNGKDWRDIPRGMNFYYVEDYVFVNKLHADVLHYLMKEATSKKLE 745

Query: 744  RNHASFILRSIATCVKLEQEEAIVRRALGNQDGDKSSNATTIKTENELTSDFIYEKWCED 803
             N +SFILRS+ATC+KLEQE+ +V  A+         +A+  +  N LTSDFIYEKWCED
Sbjct: 746  SNQSSFILRSVATCIKLEQEKTMVHDAIFKSKDKSPLSASGSEGSNGLTSDFIYEKWCED 805

Query: 804  SLFEKMMYHNSDLVWRMMDEMLMCSGYRRVLIWFITHLEINHSVIHYIFELVMGLRGNIT 863
            +LFEKMMY+N+DLVWRMMDEMLMCSGYRRVLIWFITHLE++HSVIHYIFELVMG+RGN+ 
Sbjct: 806  ALFEKMMYYNNDLVWRMMDEMLMCSGYRRVLIWFITHLELSHSVIHYIFELVMGMRGNVA 865

Query: 864  YEDDEEK---SKNLDALDGLAQGSSTSELTLPFSRQGPIILSSIEVNMLLQEFFTNAAIF 920
            Y+D EE+   ++NLD LD  + GSS    ++PFSRQGPI+LS+IEVNMLLQEFF NAAI+
Sbjct: 866  YKDLEEEYIINRNLDLLDSFSLGSSCIPASIPFSRQGPIVLSTIEVNMLLQEFFINAAIY 925

Query: 921  FSSKLRXXXX-------------XXXXXXXXXXXXXXXXXVPPHVIGLMKLVCFMVDTLM 967
            FS+ LR                                     HV+GLMKL+CFMVD L+
Sbjct: 926  FSNYLRDTASYEHLDVEQPEEQTEIEEGEAEDEIADERLTASSHVLGLMKLLCFMVDMLI 985

Query: 968  QKKKFDFTDSEYIFELQTLLMNWIGIVPEARDLFFKLKSQIVATSQ-------------- 1013
            +KKK DFTDSEY+FELQTLLMNWIG+VPEAR LFFKLKS ++ +S               
Sbjct: 986  EKKKLDFTDSEYLFELQTLLMNWIGLVPEARTLFFKLKSTLLNSSALNGSALSHLEGELA 1045

Query: 1014 ----------DTQEQGTPVKESEKDDI-------------------DAPDTLEMNDTMSE 1044
                      DT E   P+ +S   D                     AP+ +  ++ +S 
Sbjct: 1046 SNDNDDSEPVDTAEDAGPMDKSNGLDGLPLCDIGALTNGQPTSAANSAPNGMSESN-ISY 1104

Query: 1045 HNKKLMMLIPPGTTNERNALTALRGFIGKYSLTNKTAVFGRKIIYQDDEIMGMYMTDKEM 1104
             N+ L+ L+PP + +E  A+TALR FI K+ LT KTA+FGR++IYQD+ IMG+YM DKE+
Sbjct: 1105 CNQMLIKLLPPHSADENAAVTALRSFIAKHPLTTKTAIFGRRVIYQDNAIMGLYMADKEL 1164

Query: 1105 MYREFLAEFGIDYNDIV 1121
              REFLAEFGIDYN + 
Sbjct: 1165 QQREFLAEFGIDYNAVA 1181

>KLTH0G02442g Chr7 complement(189819..193160) [3342 bp, 1113 aa] {ON}
            similar to uniprot|P53280 Saccharomyces cerevisiae
            YGR134W CAF130 Part of the evolutionarily- conserved
            CCR4- NOT transcriptional regulatory complex involved in
            controlling mRNA initiation elongation and degradation
          Length = 1113

 Score = 1110 bits (2870), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 589/1100 (53%), Positives = 732/1100 (66%), Gaps = 55/1100 (5%)

Query: 44   FPDAVVQEMLILSLFVTLPGHSILELYYDLSCGRVDLSSYKQWQHS--QVRSTDGYKKLV 101
            F D   QE L+L LF T PG S L LYY+LSCGRV+L  YK+WQ S  Q  S   YK++V
Sbjct: 44   FTDIDAQEKLVLGLFTTRPGLSTLRLYYELSCGRVNLLRYKKWQQSKPQRVSDAAYKRMV 103

Query: 102  KRWSTSTXXXXXXXXXXXQNKNVPLEYTKHNTAEYKLSLIFLLDKQNEFXXXXXXXXXXX 161
            KRW++ST           +N N  L+Y    +  +KLS+ FLLD + E            
Sbjct: 104  KRWTSSTEHVGLLMDHFLRNDNWALDYASFYSPAHKLSVAFLLDPETEVLVIDDEYNLLL 163

Query: 162  XXXXHAKPMIESILLG-NIPGLLKALVYQYNKLPEFNGCHTWYTFRT-HYHGTQEIFHKF 219
                  + ++E +L   ++P LL    Y + +L +  G + WYTF    +   Q+I +K+
Sbjct: 164  DFALQCRALVEQLLNQIDLPSLLAKCAYGHGRLFQLCGRYVWYTFSAEQFDEAQDICYKY 223

Query: 220  FIALTDKFTASKEIMPELEGWFVEGPVSRDSGCIKPITGDDYTSSAAIDDFNED--YWTQ 277
               LTDK TA ++++P+++  F    +   S     + GD   +     D N D  +W Q
Sbjct: 224  LSVLTDKLTAQQDLIPQIQPLF---EIISSSKASHWVYGDGLFTENPESDSNSDSDHWPQ 280

Query: 278  QKTNTQEQVYSFELNEDGTLEIPNVFAHTKRRHDALYKVLGLNDDPT-PLLKSCFLTFCC 336
            ++ + QE+VYSF+L +DGTLE  NVF  T+RRH ALY+VL L    T PLL S F T C 
Sbjct: 281  KRLSAQERVYSFDLKDDGTLEASNVFNRTRRRHQALYQVLNLQKQNTAPLLSSQFFTLCA 340

Query: 337  LADPVTQPPPNDKHIVSLDLLSDMFLGLMYPEITADLVQPLNKDTWTLHICFNLQKIINA 396
            L DPVTQP PND HIVS+DLLSDMFLGL+Y EI       L+ D W  H+CFNLQKI+ A
Sbjct: 341  LVDPVTQPTPNDSHIVSIDLLSDMFLGLLYSEINE-----LHID-WRFHVCFNLQKIVQA 394

Query: 397  TLSRLNCDDFTRLNEINNSDDSVDWRKNLYKWLPQGLNTQDLELIYMVDILATYTIYKLY 456
            TL RLNC DF RLN +NNSDDS+DWR+NL+KWLPQGLNTQDLELIYM+DILA Y I+KLY
Sbjct: 395  TLPRLNCHDFQRLNSVNNSDDSIDWRRNLHKWLPQGLNTQDLELIYMIDILAIYIIHKLY 454

Query: 457  SNRPIQMNPFLLPMISLWKNLTCVVLLGLEIDRLEEEQETFNTPVMVRATIRGASALRSV 516
             + P QMNPFL  MISLWKNLT VVLLGLEIDR EEEQETF+TPV+VRA IRG+SALRSV
Sbjct: 455  RDLPAQMNPFLASMISLWKNLTFVVLLGLEIDRFEEEQETFSTPVLVRAAIRGSSALRSV 514

Query: 517  LATIINGHARYKSHDFKHEPINLFMSPHGRKLCNGALYADLRSHAATMLALGIXXXXXXX 576
            +ATI+NGH  YK HDF+HEPIN+FMSPHGRKLC+GALY D+RSHAA MLALGI       
Sbjct: 515  VATILNGHVEYKRHDFQHEPINIFMSPHGRKLCHGALYTDVRSHAAAMLALGIELEDVTN 574

Query: 577  XXXXXQPGDRFDEDVKYMFDYEFDDYNEVDTELMADDELEDIESRERIKEVRGYYKRCHC 636
                 QPGDRFDEDVKYMFDYE+D+YNEVDTE + +DELED+ESRERIKE+R YYKRCHC
Sbjct: 575  LLSDLQPGDRFDEDVKYMFDYEYDNYNEVDTEELDEDELEDVESRERIKEMRAYYKRCHC 634

Query: 637  VFDDDSLVPENXXXXXXXXXXXXTKKHLQDSHEDQLPPQQNVVMSTTSKPLAVRS-RDTV 695
             FDDD L+PE+              +          PP  NV +S TSKP+A+RS +D+V
Sbjct: 635  QFDDDELLPEDEEDGRPDASPYRVTR--------DAPPDNNVKLSNTSKPMALRSQKDSV 686

Query: 696  EFDFNGRDWRDIPRGLNFYYTDAYIFVTKLHADVVHYLMKEATRKKLERNHASFILRSIA 755
            EFDFNGRDWR IPRGLNFY+ + Y F   L +   H LM  A  KKL     + +LR IA
Sbjct: 687  EFDFNGRDWRGIPRGLNFYFNENYEFEKHLSSGQAHSLMCNAAEKKLPLEEGTQLLRVIA 746

Query: 756  TCVKLEQEEAIVRRALGNQDGDKSSNATTIKTENELTSDFIYEKWCEDSLFEKMMYHNSD 815
            TCV  EQE  ++R AL   +  +S N +T+  + +LT+DF+YEKWCE+S+FEK+++HN  
Sbjct: 747  TCVAKEQELTVLRSALLLGETPESENHSTLVADGDLTTDFVYEKWCENSMFEKILFHNET 806

Query: 816  LVWRMMDEMLMCSGYRRVLIWFITHLEINHSVIHYIFELVMGLRGNITYEDDEEKSKNLD 875
            LVWRMMDEMLMCSGYRRVLIWFITHLE+++S+I YI+ LV+G RG        EK+    
Sbjct: 807  LVWRMMDEMLMCSGYRRVLIWFITHLEVSNSMIEYIYTLVLGNRG--------EKA---- 854

Query: 876  ALDGLAQGSSTSELTLPFSRQGPIILSSIEVNMLLQEFFTNAAIFFSSKLRXXXXXXXXX 935
            A DG           +PFSRQG I+LS IE+ MLLQEFFTNAAIFFS +LR         
Sbjct: 855  ASDG-------DYAKVPFSRQGAIVLSDIEIKMLLQEFFTNAAIFFSKQLR-ESLGDGED 906

Query: 936  XXXXXXXXXXXXVPPHVIGLMKLVCFMVDTLMQKKKFDFTDSEYIFELQTLLMNWIGIVP 995
                        + PHV+GLMKLVC+MV +LMQK+ FDF D +YIFELQTLLM+WI I+P
Sbjct: 907  DEDQGDDEKGSGISPHVVGLMKLVCYMVKSLMQKEMFDFKDPDYIFELQTLLMSWICILP 966

Query: 996  EARDLFFKLKSQIVATSQDTQEQGTPVKESEKDDIDAPDTL----------EMNDTMSEH 1045
            EARDLFF L+S +   SQ+ + +   +  + + D  +   L          E    +S +
Sbjct: 967  EARDLFFALRSLVDEQSQNIKLESESIASACEPDSQSEPQLPQGTHAELEPEATHAVSIY 1026

Query: 1046 NKKLMMLIPPGTTNERNALTALRGFIGKYSLTNKTAVFGRKIIYQDDEIMGMYMTDKEMM 1105
            NKKLM L+PP    E +A+TALR FI K+SLT KTA+FGR++I QDD IM MYM+D+EM 
Sbjct: 1027 NKKLMSLLPPAAGTENSAITALRSFISKHSLTTKTALFGRRVISQDDTIMPMYMSDREMD 1086

Query: 1106 YREFLAEFGIDYNDIVEGVY 1125
             R+FLAEFGIDYND V+G Y
Sbjct: 1087 NRQFLAEFGIDYNDFVDGAY 1106

>Kwal_47.18886 s47 (1013635..1016952) [3318 bp, 1105 aa] {ON} YGR134W
            (CAF130) - CCR4 Associated Factor 130 kDa [contig 189]
            FULL
          Length = 1105

 Score = 1090 bits (2819), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 578/1144 (50%), Positives = 744/1144 (65%), Gaps = 63/1144 (5%)

Query: 1    MTKKKKAVSVDSHDETHKGMALSRLCKDYYPDQRNLTIPHVEEFPDAVVQEMLILSLFVT 60
            M K KK+  V+   +  +  +L  L K   P            +    +QE L++ LF T
Sbjct: 1    MVKTKKSSLVN---DPERRSSLETLPKLVDPKPNESEARGTNSYASLSIQEKLVIGLFTT 57

Query: 61   LPGHSILELYYDLSCGRVDLSSYKQWQHSQVRSTDG--YKKLVKRWSTSTXXXXXXXXXX 118
             PG SIL+LYY+LSCGR++L  YK+WQ S+ +S     YKKLVK+W+ S+          
Sbjct: 58   KPGLSILKLYYELSCGRINLLRYKKWQQSKFQSLPDAVYKKLVKKWTGSSDYISALMEYL 117

Query: 119  XQNKNVPLEYTKHNTAEYKLSLIFLLDKQNEFXXXXXXXXXXXXXXXHAKPMIESIL-LG 177
             +N +  L+Y    +AEYKLS+ FLLD+  E                  +  +E +L   
Sbjct: 118  LRNDSTSLDYVSFYSAEYKLSMAFLLDQDTELLIIDDEYNLLLDFLLQTRASVEELLSQA 177

Query: 178  NIPGLLKALVYQYNKLPEFNGCHTWYTFR-THYHGTQEIFHKFFIALTDKFTASKEIMPE 236
            ++P L+      +++L + +G + WYTF    +   Q+I +K+   LTDK TA ++++P+
Sbjct: 178  DLPSLIAKSALSHHRLFQLSGRYVWYTFSDERFAEAQDICYKYLSVLTDKLTAQQDLIPQ 237

Query: 237  LEGWFVEGPVSRDSGCIKPITGDDYTSSAAIDDFNED--YWTQQKTNTQEQVYSFELNED 294
            ++  F     SR +   +   GD   S     D N D  +W Q+K +  E++YSF+L +D
Sbjct: 238  IQPLFDSVNSSRLAHLSQ---GDSLYSEGVESDSNSDSDHWPQKKLSAHERIYSFDLKDD 294

Query: 295  GTLEIPNVFAHTKRRHDALYKVLGLND-DPTPLLKSCFLTFCCLADPVTQPPPNDKHIVS 353
            GTLE PNVF  T+RRH ALY+VL L   + +P LK+ F T C L DPVTQP PND HI+S
Sbjct: 295  GTLESPNVFGRTRRRHQALYQVLRLQQQNSSPCLKAQFFTLCALVDPVTQPTPNDSHIIS 354

Query: 354  LDLLSDMFLGLMYPEITADLVQPLNKDTWTLHICFNLQKIINATLSRLNCDDFTRLNEIN 413
            +DLLSDMF+GL++ EI      P N   W  HICFNLQKI+ +TL RLNC DF +LN +N
Sbjct: 355  IDLLSDMFIGLLHSEIKQ---LPFN---WRFHICFNLQKILQSTLPRLNCHDFQQLNSVN 408

Query: 414  NSDDSVDWRKNLYKWLPQGLNTQDLELIYMVDILATYTIYKLYSNRPIQMNPFLLPMISL 473
            NSDDS+DWR+NL+KWLPQGLNTQDLEL+YM+DILA Y I+KLY +RP+QMNPFL  MISL
Sbjct: 409  NSDDSIDWRRNLHKWLPQGLNTQDLELVYMIDILAIYIIHKLYRDRPVQMNPFLASMISL 468

Query: 474  WKNLTCVVLLGLEIDRLEEEQETFNTPVMVRATIRGASALRSVLATIINGHARYKSHDFK 533
            WKNLT VVLLGLEIDR EEEQETF+TPV+VRA IRG+SALRSV+AT++NGH  YK HDF+
Sbjct: 469  WKNLTFVVLLGLEIDRFEEEQETFSTPVLVRAAIRGSSALRSVVATVLNGHVEYKRHDFQ 528

Query: 534  HEPINLFMSPHGRKLCNGALYADLRSHAATMLALGIXXXXXXXXXXXXQPGDRFDEDVKY 593
            HEPIN+FMSPHGRKLC+GALY D+RSHAA MLALGI            QPGDRFDEDVKY
Sbjct: 529  HEPINIFMSPHGRKLCHGALYTDVRSHAAAMLALGIELEDVTNLLSDLQPGDRFDEDVKY 588

Query: 594  MFDYEFDDYNEVDTELMADDELEDIESRERIKEVRGYYKRCHCVFDDDSLVPENXXXXXX 653
            MFDYE+D+YNEV TE M ++ELED+ESRERIKE+R YYKRCHC FDDD L+PE       
Sbjct: 589  MFDYEYDNYNEVGTEDMDEEELEDVESRERIKEMRAYYKRCHCQFDDDELLPEEEEESGI 648

Query: 654  XXXXXXTKKHLQDSHEDQLPPQQNVVMSTTSKPLAVRS-RDTVEFDFNGRDWRDIPRGLN 712
                    K        +LPP  NV +S T+KP+A+R+ +DT+EFDFNGRDWRDIPRGLN
Sbjct: 649  PISHTRISK--------ELPPDTNVKLSNTAKPVALRNKKDTIEFDFNGRDWRDIPRGLN 700

Query: 713  FYYTDAYIFVTKLHADVVHYLMKEATRKKLERNHASFILRSIATCVKLEQEEAIVRRALG 772
            FY+ + Y F   +     H LM  A  ++L +  A  +LR ++TCV  EQE  ++R A  
Sbjct: 701  FYFNENYDFEKSVKRGAAHTLMNSAAERQLSKEEAVHLLRLVSTCVAKEQEHTVLRSAFA 760

Query: 773  NQDGDKSSNATTIKTENELTSDFIYEKWCEDSLFEKMMYHNSDLVWRMMDEMLMCSGYRR 832
              D    S  +T+  + +LT+D+IYE WC+DSLF+KM++HN  LVWR+MDEMLMCSGYRR
Sbjct: 761  ADDSQALSCQSTLVADGDLTTDYIYENWCQDSLFDKMLFHNETLVWRIMDEMLMCSGYRR 820

Query: 833  VLIWFITHLEINHSVIHYIFELVMGLRGNITYEDDEEKSKNLDALDGLAQGSSTSELTLP 892
            VLIWFITHLE+  S+I YI+ LVMG RG        EK  N +   G           LP
Sbjct: 821  VLIWFITHLEVTSSMIEYIYSLVMGNRG--------EKLANEETPFG----------KLP 862

Query: 893  FSRQGPIILSSIEVNMLLQEFFTNAAIFFSSKLRXXXXXXXXXXXXXXXXXXXXXVPPHV 952
            FSRQG I+LS IE+ MLLQEFFTNAAIFFS +LR                     + P++
Sbjct: 863  FSRQGDIVLSEIEIKMLLQEFFTNAAIFFSKQLR------ESLGDEEEEETENLGISPYI 916

Query: 953  IGLMKLVCFMVDTLMQKKKFDFTDSEYIFELQTLLMNWIGIVPEARDLFFKLKSQIVATS 1012
            +GLM+LVCFMV +L+Q++ FDF D +YIFEL+TLLM+WI I+PEARDLFF L+S++   S
Sbjct: 917  VGLMRLVCFMVKSLIQEEMFDFKDPDYIFELETLLMSWICILPEARDLFFALRSRVDQQS 976

Query: 1013 Q-------DTQEQGTPVKES----EKDDIDAPDTLEMNDTMSEHNKKLMMLIPPGTTNER 1061
            +       D     + V  S      D+ D     E  +++S +NKKL+ L+PP    E 
Sbjct: 977  RKPAKRDPDAMATASVVNLSPDFRTTDENDGSSDSEETNSVSIYNKKLISLLPPVVGTEN 1036

Query: 1062 NALTALRGFIGKYSLTNKTAVFGRKIIYQDDEIMGMYMTDKEMMYREFLAEFGIDYNDIV 1121
             A+TALR FI K+SLT  TAVFGR++I  DD IM MYM+DK++  R FLAEFGIDYND V
Sbjct: 1037 TAVTALRSFISKHSLTMGTAVFGRRVINHDDRIMSMYMSDKDIDNRNFLAEFGIDYNDFV 1096

Query: 1122 EGVY 1125
            +G Y
Sbjct: 1097 DGAY 1100

>ZYRO0D09790g Chr4 complement(828446..831988) [3543 bp, 1180 aa] {ON}
            similar to uniprot|P53280 Saccharomyces cerevisiae
            YGR134W CAF130 Part of the evolutionarily-conserved CCR4-
            NOT transcriptional regulatory complex involved in
            controlling mRNA initiation elongation and degradation
          Length = 1180

 Score =  833 bits (2151), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 465/1107 (42%), Positives = 654/1107 (59%), Gaps = 63/1107 (5%)

Query: 47   AVVQEMLILSLFVTLPGHSILELY----YDLSCGRVDLSSYKQWQHSQVRSTDGYKKLVK 102
            +++ EM+I++L  T  G S+L L      + S  +  +S+ ++W     R    +  L+ 
Sbjct: 86   SLLLEMVIVALLTTRAGLSVLALLKPSGSNPSIPKC-ISNQRKWLAQVERKGKLHSDLIS 144

Query: 103  RWSTSTXXXXXXXXXXXQNKNVPLEYTKHNTAEYKLSLIFLLDKQNEFXXXXXXXXXXXX 162
            +W +             +N++V L     N  E+K+ L FL+  Q+++            
Sbjct: 145  QWQSDDDIFLKFLHFLLKNEDVWLPCENVNQCEWKVPLSFLI--QSKYRAAELILDPSYN 202

Query: 163  XXX----HAKPMIE-----SILLGNIPGL-LKALVYQYNKLPEFNGCHTWYTFRTHYHGT 212
                      P+ E     +I  GN  G+ LK  V  YN++ +F+G  TWYT +T     
Sbjct: 203  LLVDYFLAVVPLCEKWLRRAISYGN--GVHLKRTVINYNRVYDFSGYFTWYTLQTRGSNH 260

Query: 213  QEIFHKFFIALTDKFTASKEIMPELEGWFVEGPVS---RDSGCIKPITGDDYTSS----- 264
              +  +    L D      E + ++E    E  +    +    I+ I+     S      
Sbjct: 261  PFVSQQILFDLIDSDDKEIEAVSQIESNDQEERIQIIDQIRSAIQDISSASLNSGFYGDE 320

Query: 265  --AAIDDFNEDYWTQQKTNTQEQVYSFELNEDGTLEIPNVFAHTKRRHDALYKVLGLNDD 322
              +A+++++++Y    + N  EQV+SF+LN+DG+LE+PN+ +H   RH+ L KVL LN+ 
Sbjct: 321  DRSALEEYSDNY--HHQVNQNEQVFSFDLNQDGSLELPNLMSHAAVRHEILMKVLKLNNS 378

Query: 323  PTPLLKSCFLTFCCLADPVTQPPPNDKHIVSLDLLSDMFLGLMYPEITADLVQPLNKDTW 382
             +PLL+  F     L DP+TQP PNDKH++SLDLL  MFLG + PEI   L      D W
Sbjct: 379  SSPLLQLQFKIVAGLVDPLTQPAPNDKHVISLDLLYQMFLGFLTPEIQQTLEFEEGCD-W 437

Query: 383  TLHICFNLQKIINATLSRLNCDDFTRLNEINNSDDSVDWRKNLYKWLPQGLNTQDLELIY 442
              H+CFN+QKII+A+L RLN DDF RLN INNSDD+VDWR  L KWLP G NTQDLELI 
Sbjct: 438  RFHVCFNMQKIIDASLVRLNFDDFERLNSINNSDDNVDWRSQLDKWLPHGFNTQDLELIC 497

Query: 443  MVDILATYTIYKLYSNRPIQMNPFLLPMISLWKNLTCVVLLGLEIDRLEEEQETFNTPVM 502
            MVDI+A YTIYKLY + PIQ+NPFL  +ISLWKNLTCV+LLGLEIDR+EEE ETF+TP+M
Sbjct: 498  MVDIIAVYTIYKLYEHLPIQLNPFLSSLISLWKNLTCVILLGLEIDRIEEELETFDTPLM 557

Query: 503  VRATIRGASALRSVLATIINGHARYKSHDFKHEPINLFMSPHGRKLCNGALYADLRSHAA 562
            VRATIRGA+ALR+++AT++NGH     HD KHE +N FMSPHGRKLC GALYA+LRSHAA
Sbjct: 558  VRATIRGAAALRAIVATVLNGHVEATKHDIKHESLNTFMSPHGRKLCQGALYAELRSHAA 617

Query: 563  TMLALGIXXXXXXXXXXXXQPGDRFDEDVKYMFDYEFDDYNEVDT---ELMADDELEDIE 619
             +LALG             QPGDRFDEDV+YMF+YEF+DYN++ +   +    D+ +D  
Sbjct: 618  ALLALGSELEDVTSLFSDLQPGDRFDEDVRYMFEYEFEDYNDLSSREEDYSGFDKYDDYT 677

Query: 620  SRERIKEVRGYYKRCHCVFDDDSLVPENXXXXXXXXXXXXTKKHLQDSHEDQLPPQQN-- 677
               +    +G+ +RC+C+F                       ++       Q+ PQQN  
Sbjct: 678  DSSKTHARKGFGRRCNCIF----------DDDEMLEDEDYENEYEGHKAPKQILPQQNPT 727

Query: 678  --VVMSTTSKPLAVRSRDTVEFDFNGRDWRDIPRGLNFYYTDAYIFVTKLHADVVHYLMK 735
              V MSTT KP A+RS  + EFD++G+DWRDIPR  N YY+  Y FV  L  + +  L  
Sbjct: 728  TSVSMSTTGKPHAIRSGGSFEFDYSGKDWRDIPRMSNLYYSPNYHFVEDLDPNTIISLTN 787

Query: 736  EATRKKLERNHASFILRSIATCVKLEQEEAIVRR--ALGNQDGDKSSNATTIKTENELTS 793
            +AT++ L +  +  +L S+ATCVK EQ+E ++     L +Q+G + S    I    +++ 
Sbjct: 788  KATKQSLSKIESLLLLGSVATCVKNEQDEIVLGNITELHHQNGSRGSQ--VIDKLKDISP 845

Query: 794  DFIYEKWCEDSLFEKMMYHNSDLVWRMMDEMLMCSGYRRVLIWFITHLEINHSVIHYIFE 853
            D IYE WC+DS FEKM+Y N ++ WR+MDEMLMCSG+RRVLIWFITH+E+NHS+IHYIFE
Sbjct: 846  DDIYEMWCKDSTFEKMVYCNHEVAWRLMDEMLMCSGFRRVLIWFITHMELNHSLIHYIFE 905

Query: 854  LVMGLRGNITYEDDEEKSKNLDALDGLAQGSSTSELTLPFSRQGPIILSSIEVNMLLQEF 913
            LVMGLR   +++++ E     +++  + + +     +LPFSRQG I LSSIE  MLLQEF
Sbjct: 906  LVMGLRK--SFDENNENDNGDESISEMTKEAPEVRTSLPFSRQGSIQLSSIETKMLLQEF 963

Query: 914  FTNAAIFFSSKLRXXXXXXXXXXXXXXXXXXXXXVPPHVIGLMKLVCFMVDTLMQKKKFD 973
            FTNAAIF + K +                     V  + +GLMKL+C MV   ++K KFD
Sbjct: 964  FTNAAIFLTEKSKEWIGEEPMEDEATINDGENGNVSLYAVGLMKLICLMVRAFIKKGKFD 1023

Query: 974  FTDSEYIFELQTLLMNWIGIVPEARDLFFKLKSQIVATSQDTQE-----QGTPVKESEKD 1028
            F +SE +FELQTLLMNWI I+PEA+DLFF+LK+ +     D  +        P    +  
Sbjct: 1024 FRESECVFELQTLLMNWIAIIPEAKDLFFELKALVAEVHSDPMDDEELSNNPPDSNKKLS 1083

Query: 1029 DIDAPDTLEMNDTM-SEHNKKLMMLIPP--GTTNERNALTALRGFIGKYSLTNKTAVFGR 1085
             +   D +  N+ + SE+N+KL+ L+ P      E  A+ ALR FI KYS      + GR
Sbjct: 1084 SMVENDNINGNEAVDSEYNRKLISLLSPVMHRKEENAAVVALRNFIKKYSFDTTVPLIGR 1143

Query: 1086 KIIYQDDEIMGMYMTDKEMMYREFLAE 1112
            K++Y+ +EI+ +  ++  M   ++L +
Sbjct: 1144 KVVYEGNEILPLPESETPMSLLDYLVD 1170

>Suva_7.422 Chr7 (727936..731319) [3384 bp, 1127 aa] {ON} YGR134W
            (REAL)
          Length = 1127

 Score =  817 bits (2110), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 468/1136 (41%), Positives = 656/1136 (57%), Gaps = 80/1136 (7%)

Query: 20   MALSRLCKD--YYPDQRNL-------TIPHVEEFPDAVVQEMLILSLFVTLPGHSILELY 70
            ++L  L KD  Y P   NL       TI + +E    ++ E L ++LF T  G SIL+  
Sbjct: 34   ISLQELLKDRHYTPSVENLEKLLYDETILNDQEIRFPLLFEALSVTLFTTKSGKSILQ-- 91

Query: 71   YDLSCGRVDLSSYKQWQHSQVRSTDGYKKLVKRWSTSTXXXXXXXXXXXQNKNVPLEYTK 130
               +         K W+ S       Y  +++ W                NK  PL+  +
Sbjct: 92   ---TMKASTSKERKAWEKSFENHDSNYASIIRSWKEDDVLLLKFLRFILANKTTPLQIDR 148

Query: 131  HNTAEYKLSLIFLL-DKQNEFXXXXXXXXXXXXXXXHA-KPMIESILLGNI-----PGLL 183
            +N  +YKL L FL+  K N                 +A    +E ++  N        + 
Sbjct: 149  YNLPKYKLPLSFLIVSKVNLPSIILNEGYNMLKDYLYAISGRMEGLIWCNSTFDQSARIF 208

Query: 184  KALVYQYNKLPEFNGCHTWYTFRTHYHGTQEIFHKFFIALTDKFTASKEIMPELEGWFVE 243
            K  + QY+++ EF   + WY+F    + T ++ H   + L D +  +           ++
Sbjct: 209  KGTLQQYDRMIEFRNFYFWYSFSAEKNATPKLNHNINL-LMDSYEDN-----------LD 256

Query: 244  GPVSRDSGCIKPITGDDYTSSAAIDDFNEDYWTQQKTNTQEQVYSFELNEDGTLEIPNVF 303
            G  S D         D++          +D    +  N QEQ+YSFELN+DGTL+IPNV 
Sbjct: 257  GVSSVDDAG----KSDNHQKQP------KDTIIHRTVNDQEQIYSFELNQDGTLQIPNVM 306

Query: 304  AHTKRRHDALYKVLGLNDDPTPLLKSCFLTFCCLADPVTQPPPNDKHIVSLDLLSDMFLG 363
             H+  RH+ L+K+L L    TPLL+  F T C L DP+TQP PNDKHI+S+D L  +FLG
Sbjct: 307  EHSLLRHELLFKILNLTPVLTPLLEQQFSTLCGLVDPLTQPTPNDKHIISIDFLYQLFLG 366

Query: 364  LMYPEITADLVQPLNKDTWTLHICFNLQKIINATLSRLNCDDFTRLNEINNSDDSVDWRK 423
            LMYP I        + D W  +ICFN+QKII+AT+ RLNC  F +LN INN+DD+V WR 
Sbjct: 367  LMYPSIKTSQEHNNHYD-WKFYICFNMQKIIDATMLRLNCFGFEKLNSINNTDDTVHWRT 425

Query: 424  NLYKWLPQGLNTQDLELIYMVDILATYTIYKLYSNRPIQMNPFLLPMISLWKNLTCVVLL 483
             L+ WLP GLNTQDLEL+YM+DILA YTIYKLY   PIQ+NPFL  ++SLWKNL+CV+LL
Sbjct: 426  QLHIWLPHGLNTQDLELLYMIDILAVYTIYKLYEEIPIQLNPFLFSLLSLWKNLSCVILL 485

Query: 484  GLEIDRLEEEQETFNTPVMVRATIRGASALRSVLATIINGHARYKSHDFKHEPINLFMSP 543
             LEIDR+EEE+ T+ TP+MVRATIRGA+ALRSV+A ++NG  +   HDFKHE +N FMSP
Sbjct: 486  ALEIDRIEEEKGTYETPLMVRATIRGAAALRSVIAAVLNGLVKSNDHDFKHESLNTFMSP 545

Query: 544  HGRKLCNGALYADLRSHAATMLALGIXXXXXXXXXXXXQPGDRFDEDVKYMFDYEFDDYN 603
            +GRKLC+GALYADLRSH A++LALG             Q GDRFDED++YMFDYE +DYN
Sbjct: 546  YGRKLCHGALYADLRSHTASLLALGASIEDVTDLFADLQSGDRFDEDIRYMFDYECEDYN 605

Query: 604  EVDTELMADDEL-EDIESRERIKEV--RGYY-KRCHCVFDDDSLVPENXXXXXXXXXXXX 659
            E  ++   D+EL E + S E+ K     G+Y +RC+C+F+DD LV E+            
Sbjct: 606  ESFSDC-GDEELGEGVNSGEKTKTSIHNGFYQRRCNCIFNDDKLVAEDGANASTNNDSIK 664

Query: 660  TKKHLQDSHEDQLPPQQNVVMSTTS-KPLAVRSRDTVEFDFNGRDWRDIPRGLNFYYTDA 718
             +    D +        N   +T+S  P +VRSR T EFD++G DWRD+P+  N YY+ +
Sbjct: 665  NEIR-SDGNAGSNTAITNANHATSSINPYSVRSRSTFEFDYSGEDWRDVPKDFNIYYSPS 723

Query: 719  YIFVTKLHADVVHYLMKEATRKKLERNHASFILRSIATCVKLEQEEAIVR------RALG 772
            Y F+ +   D++  L      +KL R  +  ++RS+A+CVK EQ++ I+        ++G
Sbjct: 724  YSFIQEPKLDIIFNLTLRGATEKLSREESVLLVRSVASCVKNEQDQMILADLGSNFTSIG 783

Query: 773  NQDGDKSSNATTIKTENE----LTSDFIYEKWCEDSLFEKMMYHNSDLVWRMMDEMLMCS 828
                   +  T+ KT +E     T D IYE W E+S FE+M+Y N D+ WR+MDEMLMC+
Sbjct: 784  ENFEGGDTGITSDKTNDEELRRTTPDDIYEIWSEESAFERMLYVNHDVAWRLMDEMLMCT 843

Query: 829  GYRRVLIWFITHLEINHSVIHYIFELVMGLRGNITYEDDEEKSKNLDALDGLAQGSSTSE 888
            GYRR+LIWF+THLE+ HS+I+Y+FEL+MGLRGN    +  ++ +  D +  + +    +E
Sbjct: 844  GYRRILIWFLTHLELKHSLIYYVFELIMGLRGNPFSGEASDQDRKDDMIYEILKKKQKNE 903

Query: 889  LT--LPFSRQGPIILSSIEVNMLLQEFFTNAAIFFSSKLRXXXXXXXXXXXXXXXXXXXX 946
             T  LPFSRQGPI+LS IE  MLLQEFF NAAIF SSK                      
Sbjct: 904  NTSGLPFSRQGPIVLSDIETKMLLQEFFMNAAIFLSSK------------NTEEEGEDAD 951

Query: 947  XVPPHVIGLMKLVCFMVDTLMQKKKFDFTDSEYIFELQTLLMNWIGIVPEARDLFFKLKS 1006
             V  + +GL+KL+C+MV TL+   KF FT SE  FELQTLLM WIGI+PEA+DLFF++KS
Sbjct: 952  KVSLYSLGLVKLICYMVQTLIANDKFFFTKSECTFELQTLLMTWIGILPEAKDLFFQIKS 1011

Query: 1007 QIVATSQDTQEQGTPVKESEKDDIDAPDTLEMN-DTMSEHNKKLMMLIP--PGTTNERNA 1063
            ++ A  +D     T V+  +K D+D     + N  ++S+ N K++ L P  P   ++ +A
Sbjct: 1012 RL-AMEEDGITDNT-VQHKDKTDLDLDSGKKPNTKSISKLNMKILSLFPSNPTENDDNSA 1069

Query: 1064 LTALRGFIGKYSLTNKTAVFGRKIIYQDDEIMGMYMTDKEMMYREFLAEFGIDYND 1119
            ++ LR FI  YS   +    GR++++ DD+I+ +   DK +   E++    +D  D
Sbjct: 1070 ISTLRSFITDYSFDTQVVAPGRRVVFHDDKILPLPKADKPIPLHEYITLAELDMGD 1125

>Skud_7.445 Chr7 (736960..740331) [3372 bp, 1123 aa] {ON} YGR134W
            (REAL)
          Length = 1123

 Score =  801 bits (2070), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 464/1134 (40%), Positives = 645/1134 (56%), Gaps = 100/1134 (8%)

Query: 27   KDYYPDQRNL-------TIPHVEEFPDAVVQEMLILSLFVTLPGHSILELYYDLSCGRVD 79
            K+Y P   NL       +I   ++   +++ E L + LF T  G SIL+     +     
Sbjct: 41   KNYVPSLENLEKLLYNESILDDQKIRLSILFEALSIILFTTKSGKSILQ-----AVQAST 95

Query: 80   LSSYKQWQHSQVRSTDGYKKLVKRWSTSTXXXXXXXXXXXQNKNVPLEYTKHNTAEYKLS 139
            L   K W  S       Y  +V+ W  +             NK   L+  K+N  EYKL 
Sbjct: 96   LKEKKLWAQSLRDDDSNYASVVQGWKDNDVLFLKFLRFLLANKTTSLQIDKYNLPEYKLP 155

Query: 140  LIFLLDKQNEFXXXXXXXXXXXXX--XXHAKPMIESILLGNIPGLLKALVYQ-----YNK 192
            L FL+  +  F                      I+ ++ GN      ALV +     Y++
Sbjct: 156  LSFLIVSKINFPSIILNEGHNMLKDYLYSMSGRIDCLIRGNSITSRSALVVKKILKDYDR 215

Query: 193  LPEFNGCHTWYTFRTHYHGTQEIFHKFFIALTDKFTASKEIMPELEGWFVEGPVSRDSGC 252
            + EF+  + WY+F        E    F + +           PE            D G 
Sbjct: 216  IVEFHNLYFWYSFNVENDVNFEFSDNFDLLMNS---------PEDHA---------DGGV 257

Query: 253  IKPITGDDYTSSAAIDDFNEDYWTQQKTNTQEQVYSFELNEDGTLEIPNVFAHTKRRHDA 312
            I     DD   S       ++   ++  N QEQ+YSFEL++DGTL+IPN+  H+  RH+ 
Sbjct: 258  I-----DDRCKSDNPQKHAKNTIIKRTINDQEQIYSFELDQDGTLQIPNIMEHSLMRHEL 312

Query: 313  LYKVLGLNDDPTPLLKSCFLTFCCLADPVTQPPPNDKHIVSLDLLSDMFLGLMYPEITAD 372
            L+K+L L    TPLL+  F   C L DP+ QP PND+ ++S+D L  +FLGLMYP I + 
Sbjct: 313  LFKILNLPSVLTPLLELQFCNLCGLVDPLMQPSPNDEQVISIDFLFQLFLGLMYPSIKSS 372

Query: 373  LVQPLNKDTWTLHICFNLQKIINATLSRLNCDDFTRLNEINNSDDSVDWRKNLYKWLPQG 432
                 + D W  + CFN+QKII+AT+ RLNC DF RLN +NN+D  + WR  L+KWLP G
Sbjct: 373  QEHNDHYD-WKFYTCFNMQKIIDATMLRLNCSDFERLNSVNNTDSVIHWRTQLHKWLPHG 431

Query: 433  LNTQDLELIYMVDILATYTIYKLYSNRPIQMNPFLLPMISLWKNLTCVVLLGLEIDRLEE 492
            LNTQDLEL+YM+DILA YTIYKLY   PIQ+NPFL  ++SLWKNL+CV+LL LEIDR+EE
Sbjct: 432  LNTQDLELLYMIDILAIYTIYKLYEKIPIQLNPFLFSLLSLWKNLSCVILLALEIDRIEE 491

Query: 493  EQETFNTPVMVRATIRGASALRSVLATIINGHARYKSHDFKHEPINLFMSPHGRKLCNGA 552
            E  T+ TP+MVRATIRGA+ALRSV+A+++NG  +   HDFKHE +N FMSP+GRKLC+GA
Sbjct: 492  ENGTYETPLMVRATIRGAAALRSVIASVLNGLVKSNDHDFKHESLNTFMSPYGRKLCHGA 551

Query: 553  LYADLRSHAATMLALGIXXXXXXXXXXXXQPGDRFDEDVKYMFDYEFDDYNEVDTELMAD 612
            LYADLRSH A++LALG             Q GDRFDED++YMFDYE +DYNE  +E  +D
Sbjct: 552  LYADLRSHTASLLALGASIEDVTDLFADLQSGDRFDEDIRYMFDYECEDYNEPFSE--SD 609

Query: 613  DEL--EDIESRERIK--EVRGYY-KRCHCVFDDDSLVPENXXXXXXXXXXXXTKKHLQDS 667
            DE   ED  SR +IK     G+Y +RC+C+F+DD LV E+                   +
Sbjct: 610  DEQLNEDANSRGKIKSSSSNGFYQRRCNCIFNDDKLVAEDGTNEAFEISG-------NSN 662

Query: 668  HEDQLPPQQNVVMSTTS----------KPLAVRSRDTVEFDFNGRDWRDIPRGLNFYYTD 717
             E+++P   NV+ ST +           PL+VRSR T EFD++G DWRD+P+  N YY+ 
Sbjct: 663  MENEMPNNVNVIPSTATTNSNRFASSINPLSVRSRSTFEFDYSGEDWRDVPKDFNMYYSP 722

Query: 718  AYIFVTKLHADVVHYLMKEATRKKLERNHASFILRSIATCVKLEQEEAIVRRALGNQDGD 777
            +Y F+ +   DV+  L      +KL R+ +  ++ S+A+CVK EQ++ I+   LG+   +
Sbjct: 723  SYSFIQEPKLDVIFNLTLRGATEKLNRDDSIVLVCSVASCVKNEQDQMIL-SDLGSNFAE 781

Query: 778  -------KSSNATTIKTENE----LTSDFIYEKWCEDSLFEKMMYHNSDLVWRMMDEMLM 826
                   KSSN  T KT NE     T D IYE W E+S FE+M+  N D+ WR+MDEMLM
Sbjct: 782  IDENPEAKSSNNIT-KTNNEELRRTTPDDIYEIWSEESAFERMLNVNHDVAWRLMDEMLM 840

Query: 827  CSGYRRVLIWFITHLEINHSVIHYIFELVMGLRGNITYEDDEEKSKNLDALDGLAQGSST 886
            C+GYRR+LIWF+THLE+ HS+I+Y+FELVMGLRG     +  ++ +  D +  + +    
Sbjct: 841  CTGYRRILIWFLTHLELKHSLIYYVFELVMGLRGKPFSGEASDQDRKDDMIYEILKKKRK 900

Query: 887  SE--LTLPFSRQGPIILSSIEVNMLLQEFFTNAAIFFSSKLRXXXXXXXXXXXXXXXXXX 944
            +E    LPFSRQGPI+LS IE  MLLQEFF NAAIF SSK                    
Sbjct: 901  NEDVSGLPFSRQGPIVLSDIETKMLLQEFFMNAAIFLSSK------------NDEEENED 948

Query: 945  XXXVPPHVIGLMKLVCFMVDTLMQKKKFDFTDSEYIFELQTLLMNWIGIVPEARDLFFKL 1004
               +  + +GL+KL+C+MV TL+   KF FT SE  FELQTLLM WIG++PEA+DLFF++
Sbjct: 949  GEKISLYSLGLVKLICYMVQTLIANDKFLFTKSECTFELQTLLMTWIGVLPEAKDLFFQI 1008

Query: 1005 KSQIVATSQDTQEQGTPVKESEKDDIDAPDTLEMNDTMSEHNKKLMMLIP--PGTTNERN 1062
            K+++ A  +D+ + G    +++  +++     + N   SE N KL+ L P  P   N+ +
Sbjct: 1009 KTRL-AMEEDSDKDGQQNDDNKDLEVERRPHTKSN---SELNVKLLNLFPSNPAGNNDNS 1064

Query: 1063 ALTALRGFIGKYSLTNKTAVFGRKIIYQDDEIMGMYMTDKEMMYREFLAEFGID 1116
            A++ LR FI  Y    +    GRK+++ D +I+ +   DK +   E++    ID
Sbjct: 1065 AISTLRSFITDYPFDTQITPPGRKVVFYDGKILPLSKADKPIPLHEYITLAEID 1118

>YGR134W Chr7 (757770..761138) [3369 bp, 1122 aa] {ON}  CAF130Part of
            the evolutionarily-conserved CCR4-NOT transcriptional
            regulatory complex involved in controlling mRNA
            initiation, elongation, and degradation
          Length = 1122

 Score =  786 bits (2029), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 467/1202 (38%), Positives = 645/1202 (53%), Gaps = 165/1202 (13%)

Query: 1    MTKKKKAVSV----------DSHDETH--KGMALSRLCKD--YYPDQRNL-------TIP 39
            MTKKK A +            S D  H    + L  L KD  Y P   NL       T+ 
Sbjct: 1    MTKKKAATNYAERQNLASEDSSGDSVHFKDFIPLQELLKDKNYVPSVENLEKILYNETMF 60

Query: 40   HVEEFPDAVVQEMLILSLFVTLPGHSILELYYDLSCGRVDLSSYKQWQHSQVRSTDGYKK 99
            + ++    ++ E LI++LF T+ G S L L    S     L   K W  S   ++  Y  
Sbjct: 61   NDQKICSNLLLEALIITLFTTISGKSALRLIQTSS-----LKERKSWAQSFENNSSSYAS 115

Query: 100  LVKRWSTSTXXXXXXXXXXXQNKNVPLEYTKHNTAEYKLSLIFLLDKQNEFXXXXXXXXX 159
            +V  W  +             NK  PL+  ++N  EYKL L FL+               
Sbjct: 116  IVLSWKDNDILLLKFLRFLLANKTAPLQINRYNLPEYKLPLSFLI--------------- 160

Query: 160  XXXXXXHAKPMIESILLGNIPGLLKALVYQ----------------------------YN 191
                   +K  I SILL     LLK  +Y                             YN
Sbjct: 161  ------VSKITIPSILLNETYNLLKDYLYSITGRIESLISCSSTFDKPALVVRKILKDYN 214

Query: 192  KLPEFNGCHTWYTFRTHYHGTQEIFHKFFIALTDKFTASKEIMPELEGWFVEGPVSRDSG 251
            ++ E    + WY+F           ++  +  +D  +   E                   
Sbjct: 215  RMIECRNFYFWYSFNAE--------NRVNLTFSDNISLLME------------------- 247

Query: 252  CIKPITGDDYTSSAAIDDFNEDYWTQQK-------TNTQEQVYSFELNEDGTLEIPNVFA 304
                   D+  + + +DD   D+  Q +        N QEQ+YSFELN+DGTLEIPNV  
Sbjct: 248  ------NDEGNAGSGLDDSRFDHQKQPREAIMGRTINDQEQIYSFELNQDGTLEIPNVME 301

Query: 305  HTKRRHDALYKVLGLNDDPTPLLKSCFLTFCCLADPVTQPPPNDKHIVSLDLLSDMFLGL 364
            H+  RH+ L+K+L L    TPLL+  F T C L DP+ QP PNDKHI+S+D L  +FLGL
Sbjct: 302  HSLLRHELLFKILNLTTVLTPLLELQFSTLCGLVDPLMQPTPNDKHIISIDFLFQLFLGL 361

Query: 365  MYPEITADLVQPLNKDTWTLHICFNLQKIINATLSRLNCDDFTRLNEINNSDDSVDWRKN 424
            M   I        + D W  ++CFN+QKII+AT+ RLNC DF  LN +NN+D++V W+  
Sbjct: 362  MSQSIKTSQEHNDHYD-WKFYMCFNMQKIIDATMLRLNCFDFDILNSVNNTDNAVHWKTQ 420

Query: 425  LYKWLPQGLNTQDLELIYMVDILATYTIYKLYSNRPIQMNPFLLPMISLWKNLTCVVLLG 484
            L++WLP GLNTQDLEL+YM+DILA YTIYKLY   PIQ+NPFL  +ISLWKNL+CV+LL 
Sbjct: 421  LHRWLPHGLNTQDLELLYMIDILAVYTIYKLYEKIPIQLNPFLFSLISLWKNLSCVILLA 480

Query: 485  LEIDRLEEEQETFNTPVMVRATIRGASALRSVLATIINGHARYKSHDFKHEPINLFMSPH 544
            LEIDR+EEE  T+ TP+MVRATIRGA+ALRSV+AT++NG  +   HDFKHE +N FMSP+
Sbjct: 481  LEIDRIEEENGTYETPLMVRATIRGAAALRSVIATVLNGLVKNNDHDFKHESLNTFMSPY 540

Query: 545  GRKLCNGALYADLRSHAATMLALGIXXXXXXXXXXXXQPGDRFDEDVKYMFDYEFDDYNE 604
            GRKLC+GALYADLRSH A++LALG             Q GDRFDED++YMFDYE +DY+E
Sbjct: 541  GRKLCHGALYADLRSHTASLLALGASIEDVTDLFADLQSGDRFDEDIRYMFDYECEDYDE 600

Query: 605  VDTELMADDELED---IESRERIKEVRG---YYKRCHCVFDDDSLVPENXXXXXXXXXXX 658
              +E  +D    D   +   E+I        + +RC+C+F+DD LV E+           
Sbjct: 601  SFSE--SDHGGLDESVVNPTEKIASGSNNVFFRRRCNCIFNDDKLVAEDGANEAFGSTNS 658

Query: 659  XTKKHLQDSHEDQLPPQQNVV---MSTTSKPLAVRSRDTVEFDFNGRDWRDIPRGLNFYY 715
               +    ++ + +          + T+  PL+VRSR T EFD++G DWRD+PR  N YY
Sbjct: 659  ENVEGAMHNNRNAVHNATTATSDHVVTSPNPLSVRSRSTFEFDYSGEDWRDVPRDFNMYY 718

Query: 716  TDAYIFVTKLHADVVHYLMKEATRKKLERNHASFILRSIATCVKLEQEEAIVR------R 769
            + +Y F+ +   DV+  L      +KL +  +  ++RS+A+CV+ EQ++ I+        
Sbjct: 719  SPSYSFIHEPKLDVIFSLTLRGATEKLNKEESILLVRSVASCVRNEQDQMILADLESNFS 778

Query: 770  ALGNQDGDKSSNATTIKTENE----LTSDFIYEKWCEDSLFEKMMYHNSDLVWRMMDEML 825
            A  N D +   N    K +NE     T D IYE W E+S FE+M+  N D+ WR+MDEML
Sbjct: 779  ASINGDVEGEGNTKMSKIDNEDLRRTTPDDIYEIWSEESAFERMLNVNHDVAWRLMDEML 838

Query: 826  MCSGYRRVLIWFITHLEINHSVIHYIFELVMGLRGNITYEDDEEKSKNLDALDGLAQGSS 885
            MC+GYRR+LIWF+THLE+ HS+I+Y+FEL+MGLRG     +  ++ K  D +  + +   
Sbjct: 839  MCTGYRRILIWFLTHLELKHSLIYYVFELIMGLRGKPFSGEASDQDKKDDMIYEILKKKQ 898

Query: 886  TSE--LTLPFSRQGPIILSSIEVNMLLQEFFTNAAIFFSSKLRXXXXXXXXXXXXXXXXX 943
             +E    LPFSRQGPI+LS IE  MLLQEFF NAAIF SSK                   
Sbjct: 899  KNEDASGLPFSRQGPIVLSDIETKMLLQEFFMNAAIFLSSK------------NNEEENE 946

Query: 944  XXXXVPPHVIGLMKLVCFMVDTLMQKKKFDFTDSEYIFELQTLLMNWIGIVPEARDLFFK 1003
                +  + +GL++L+C+MV TL+   KF FT SE  FELQTLLM WIGI+PEA+DLFFK
Sbjct: 947  DGEKISLYSLGLVRLICYMVQTLIANDKFFFTKSECTFELQTLLMTWIGILPEAKDLFFK 1006

Query: 1004 LKSQIVATSQDT----QEQGTPVKESEKDDIDAPDTLEMNDTMSEHNKKLMMLIP--PGT 1057
            +K+++    +D+    Q +G    + EK     P         SE N KL+ L P  P  
Sbjct: 1007 IKTRLAMEEEDSADTMQHEGRKNSDIEKKLNAKP--------ASELNLKLLNLFPSKPAN 1058

Query: 1058 TNERNALTALRGFIGKYSLTNKTAVFGRKIIYQDDEIMGMYMTDKEMMYREFLAEFGIDY 1117
             ++ + +  LR FI  YS   +    GR++++ D +I+ +   DK +   E++    +D 
Sbjct: 1059 KDDSSPINTLRSFIADYSFDTQVNPPGRRVVFYDGKILPLPKADKPIPLHEYITLAELDV 1118

Query: 1118 ND 1119
             D
Sbjct: 1119 GD 1120

>TDEL0D05650 Chr4 (1015679..1018912) [3234 bp, 1077 aa] {ON} Anc_3.497
            YGR134W
          Length = 1077

 Score =  769 bits (1987), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 468/1094 (42%), Positives = 622/1094 (56%), Gaps = 100/1094 (9%)

Query: 47   AVVQEMLILSLFVTLPGHSILELYYDLSCGRVDLSSYKQWQHSQVRSTDGYKKLVKRWST 106
            +++ E LI++LF T  G S+L L+ +                S  R   G +  V  W  
Sbjct: 48   SLICETLIIALFTTRAGISLLPLFSE----------------SAKRKRVGPR--VLEWHN 89

Query: 107  STXXXXXXXXXXXQNKNVPLEYTKHNTAEYKLSLIFLLDKQ--NEFXXXXXXXXXXXXXX 164
                         +N++  +E      A +KL L FL++ +                   
Sbjct: 90   DEELMLRFFSYILENRSSRIEPRLFEKARWKLPLFFLIESKFLAASMVLDQNYNLLLDYV 149

Query: 165  XHAKPMIESILLGNIP--GLLKALVYQYNKLPEFNGCHTWYTFRTHYHGTQE-IFHKFFI 221
                PMI+  +          K  V  YN++ E      WY+F T     +     +F  
Sbjct: 150  HTITPMIKRWVHRAFTQGTFFKDTVVCYNRVYELKDSSEWYSFGTKKSNEERRAIQQFLR 209

Query: 222  ALTDKFTASKEIMPELEGWFVEGPVSRDSGCIKPITGDDYTSSAAIDDFNEDYWTQQKTN 281
              +++   +   M                  ++P      ++  AI+D    Y    + +
Sbjct: 210  ENSEQVLDTYHEM------------------VRP------SNERAIND-TASY--HHRIS 242

Query: 282  TQEQVYSFELNEDGTLEIPNVFAHTKRRHDALYKVLGLNDDPTPLLKSCFLTFCCLADPV 341
              E VYSF++N+DG+LEIPN+ +H   RHD L  ++ L    +PLL+  F     L DP+
Sbjct: 243  QHENVYSFDINQDGSLEIPNIMSHASVRHDILQNLMRLPLCDSPLLQWQFKLMAGLVDPL 302

Query: 342  TQPPPNDKHIVSLDLLSDMFLGLMYPEITADLVQPLNKDTWTLHICFNLQKIINATLSRL 401
            TQPPPNDKHI+SLDLL  M LGLM P I+  L    +   W  H+CFN+QKII A+L RL
Sbjct: 303  TQPPPNDKHIISLDLLYQMLLGLMEPAISNTLGS--DGCDWKFHLCFNMQKIIQASLKRL 360

Query: 402  NCDDFTRLNEINNSDDSVDWRKNLYKWLPQGLNTQDLELIYMVDILATYTIYKLYSNRPI 461
            N  DF  LN INNSD+ V WR NL+ WLP GLNTQ+LELIYM+DILA YTIYKLY + P+
Sbjct: 361  NLQDFDTLNSINNSDEDVSWRDNLHSWLPHGLNTQNLELIYMIDILAVYTIYKLYEDLPV 420

Query: 462  QMNPFLLPMISLWKNLTCVVLLGLEIDRLEEEQETFNTPVMVRATIRGASALRSVLATII 521
            Q+NPFL PMISLWKNLTCV+LLGLEIDR EEE ETF TPV+VRATIRGA+ALR+V+ATI+
Sbjct: 421  QLNPFLSPMISLWKNLTCVILLGLEIDRFEEEHETFETPVLVRATIRGAAALRAVVATIL 480

Query: 522  NGHARYKSHDFKHEPINLFMSPHGRKLCNGALYADLRSHAATMLALGIXXXXXXXXXXXX 581
            NGH     HDF HEP+N FMSPHGRKLC GALYADLRSHAA +LALG             
Sbjct: 481  NGHVDTYKHDFMHEPLNTFMSPHGRKLCQGALYADLRSHAAALLALGTELEDVTNLLADL 540

Query: 582  QPGDRFDEDVKYMFDYEFDDYNEVDTELMADDELEDIESRERIKEVRGYYKRCHCVFDDD 641
            Q GDRFDEDV+YMF+YE D+YNE D+E   D +L        +++ +   +RC+C+FDDD
Sbjct: 541  QAGDRFDEDVRYMFEYECDNYNEGDSESEKDGKLA-------VEQPKILQRRCNCIFDDD 593

Query: 642  SLVPENXXXXXXXXXXXXTKKHLQDSHEDQLPPQQNVVMSTTSKPLAVRSRDTVEFDFNG 701
             +  +                 LQ +       Q ++ MS++ KP AVRS    EFD++G
Sbjct: 594  EMAEDEDFDGENDEAFFSKHLILQQN------AQTSLSMSSSGKPRAVRSGGAFEFDYSG 647

Query: 702  RDWRDIPRGLNFYYTDAYIFVTKLHADVVHYLMKEATRKKLERNHASFILRSIATCVKLE 761
            +DWRDIPRG NFYY+  + F+       +  L K+A+ +KL    +  +LRS+A+CVK E
Sbjct: 648  KDWRDIPRGSNFYYSPDFEFIESPSLSSLLALTKKASSEKLVEKESLTLLRSVASCVKNE 707

Query: 762  QEEAIVRRALGN--------QDGDKSSNATTIKTENELTSDFIYEKWCEDSLFEKMMYHN 813
            Q+E      LGN        Q  ++S NA  I+       D IYE WCE+S FEK++Y N
Sbjct: 708  QDEI----TLGNLIDPHQDSQADEESRNADKIE------PDDIYEMWCENSTFEKIVYFN 757

Query: 814  SDLVWRMMDEMLMCSGYRRVLIWFITHLEINHSVIHYIFELVMGLRGNITYEDDEEKSKN 873
              L W++MDEML+C GYRRVLIWFITH+E+NHS+IHYIFELVMGLRGN    D+ ++  +
Sbjct: 758  HTLAWKLMDEMLLCIGYRRVLIWFITHMELNHSLIHYIFELVMGLRGN---SDENDRDVD 814

Query: 874  LDALDGLAQGSSTSELTLPFSRQGPIILSSIEVNMLLQEFFTNAAIFFSSKLRXXXXXXX 933
            L             EL++ FSRQG + LS+IE  MLLQEFFTNAAIF S K         
Sbjct: 815  LAGPPLQDVDKVKGELSVGFSRQGALQLSTIETKMLLQEFFTNAAIFISKKSEESTDIAN 874

Query: 934  XXXXXXXX--XXXXXXVPPHVIGLMKLVCFMVDTLMQKKKFDFTDSEYIFELQTLLMNWI 991
                            V  + +GLMKL+CFMV T + K+KFDF++SE +FELQ LLMNWI
Sbjct: 875  EEQNNENRDLNGNSENVSLYAMGLMKLICFMVRTFINKEKFDFSESECVFELQALLMNWI 934

Query: 992  GIVPEARDLFFKLKSQIV--ATSQDTQEQ-GTPVKESEKDDIDAPDT-LEMNDTMS-EHN 1046
            GI+PEA+ LFF+LKS I   +T+   QEQ    VK   ++D+    + + +++T   E N
Sbjct: 935  GIIPEAKTLFFELKSLIAGFSTATSVQEQKNAEVKNDTQEDVPKEQSPVRVSNTAGFEFN 994

Query: 1047 KKLMMLIPPGTTN--ERNALTALRGFIGKYSLTNKTAVFGRKIIYQDDEIMGMYMTDKEM 1104
            +KLM L+PP   N  E  A+  LR FI   S  N   V GRKI+Y+DD+I+ +  +D  +
Sbjct: 995  RKLMTLLPPLVKNKEENAAMQTLRSFIKTSSFLNTVPVIGRKIVYEDDKILPLPKSDVPL 1054

Query: 1105 MYREFLAEFGIDYN 1118
               E+     IDY+
Sbjct: 1055 ALHEY-----IDYD 1063

>Smik_6.230 Chr6 (375653..379027) [3375 bp, 1124 aa] {ON} YGR134W
            (REAL)
          Length = 1124

 Score =  769 bits (1986), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 455/1129 (40%), Positives = 633/1129 (56%), Gaps = 83/1129 (7%)

Query: 27   KDYYPDQRNL-------TIPHVEEFPDAVVQEMLILSLFVTLPGHSILELYYDLSCGRVD 79
            K+Y P   NL       T+ + ++   +++ E L ++LF T  G SIL+     +  +  
Sbjct: 41   KNYVPSVENLEKVLCDETMLNDQKVRFSLLFEALAITLFTTNSGKSILQSIQTFTSKK-- 98

Query: 80   LSSYKQWQHSQVRSTDGYKKLVKRWSTSTXXXXXXXXXXXQNKNVPLEYTKHNTAEYKLS 139
                K W  S   +   Y  +V  W  +             NK +PL+  ++N  E+KL 
Sbjct: 99   ---RKLWAQSFENNNSNYASIVFSWKDNDILLLKFVRFLLANKTMPLKIDRYNLPEHKLP 155

Query: 140  LIFLL-DKQNEFXXXXXXXXXXXXXXXHA-KPMIESILLG----NIPGLL-KALVYQYNK 192
            L FL+  K N                 ++    IE +L+     N P L+ K  +  Y++
Sbjct: 156  LSFLIVSKINIPSILLNEGYNLLKDYLYSITGRIEELLMCSPKFNQPALVVKRTLKDYDR 215

Query: 193  LPEFNGCHTWYTFRTHYHGTQEIFHKFFIALTDKFTASKEIMPELEGWFVEGPVSRDSGC 252
            + E   C+ WY F           +   +   D            E    +  V+ ++  
Sbjct: 216  MIECENCYCWYYFNAE--------NSAHLKFDDNIACLMGSENNTENGLGDSRVNNNNYH 267

Query: 253  IKPITGDDYTSSAAIDDFNEDYWTQQKTNTQEQVYSFELNEDGTLEIPNVFAHTKRRHDA 312
             +P                +D    +  N QEQ+YSFELN DGTLEIPNV  H+  RH+ 
Sbjct: 268  KQP----------------KDVVMSRTINDQEQIYSFELNHDGTLEIPNVMKHSLLRHEL 311

Query: 313  LYKVLGLNDDPTPLLKSCFLTFCCLADPVTQPPPNDKHIVSLDLLSDMFLGLMYPEITAD 372
            L+K+L L    TPLL+  F T C L DP+ QP PNDKHI+S+D L  +FLGLMYP I + 
Sbjct: 312  LFKILNLTPVSTPLLELQFSTLCGLVDPLMQPTPNDKHIISIDFLFKLFLGLMYPAIKSS 371

Query: 373  LVQPLNKDTWTLHICFNLQKIINATLSRLNCDDFTRLNEINNSDDSVDWRKNLYKWLPQG 432
                 + D W  + CFN+QKII+AT+SRLNC DF  LN +NN+D SV WR  L++WLP G
Sbjct: 372  QGHNDHYD-WKFYTCFNMQKIIDATMSRLNCFDFNILNSVNNTDSSVHWRTQLHRWLPHG 430

Query: 433  LNTQDLELIYMVDILATYTIYKLYSNRPIQMNPFLLPMISLWKNLTCVVLLGLEIDRLEE 492
            LNTQDLEL+YM+DILA YTIYKLY   PIQ+NPFL  +ISLWKNL+CV+LL LEIDR+EE
Sbjct: 431  LNTQDLELLYMIDILAVYTIYKLYEKLPIQLNPFLFSLISLWKNLSCVILLALEIDRIEE 490

Query: 493  EQETFNTPVMVRATIRGASALRSVLATIINGHARYKSHDFKHEPINLFMSPHGRKLCNGA 552
            E  T+ TP+MVRATIRGA+ALRSV+ATI+NG  +   HDFKHE +N FMSP+GRKL +GA
Sbjct: 491  ENGTYETPLMVRATIRGAAALRSVIATILNGLVKTNEHDFKHESLNTFMSPYGRKLSHGA 550

Query: 553  LYADLRSHAATMLALGIXXXXXXXXXXXXQPGDRFDEDVKYMFDYEFDDYNEVDTELMAD 612
            LYADLRSH+A++LA G             Q GDRFDED++YMFDYE  DY+E  +E  +D
Sbjct: 551  LYADLRSHSASLLAFGTSIEDVTDLFADLQSGDRFDEDIRYMFDYECADYDESFSE--SD 608

Query: 613  DE-LED--IESRERIKEVRG----YYKRCHCVFDDDSLVPENXXXXXXXXXXXXTKKHLQ 665
            DE LE+  + +RE+IK          +RC+C+F+DD LV E+              +   
Sbjct: 609  DEGLEEGIVNAREKIKSSNDNNVFCQRRCNCIFNDDKLVAEDGLNEVFESTCNRNGERRV 668

Query: 666  DSHEDQLPPQQNVV---MSTTSKPLAVRSRDTVEFDFNGRDWRDIPRGLNFYYTDAYIFV 722
             ++ D +          +ST+  P +VR+R T EFD++G DWRD+PR  N YY+ +Y F+
Sbjct: 669  RNNIDVVSNTAITTSNHVSTSINPFSVRARSTFEFDYSGEDWRDVPRDFNMYYSPSYPFI 728

Query: 723  TKLHADVVHYLMKEATRKKLERNHASFILRSIATCVKLEQEEAIVRRALGNQDG----DK 778
                 DV+  L      +KL R  +  ++RS+A+CVK EQ++ ++     N  G     +
Sbjct: 729  HDPKLDVIFNLTLRGATEKLNREESILLVRSVASCVKNEQDQMVLADLKTNLTGISKHAE 788

Query: 779  SSNATTI-KTENE----LTSDFIYEKWCEDSLFEKMMYHNSDLVWRMMDEMLMCSGYRRV 833
              N+T+I KT+NE     T D IYE W E+S FE+M+  N D+ WR+MDEMLMC+GYRR+
Sbjct: 789  GENSTSISKTDNEELRRTTPDDIYEIWSEESAFERMLNVNHDVAWRLMDEMLMCTGYRRI 848

Query: 834  LIWFITHLEINHSVIHYIFELVMGLRGNITYEDDEEKSKNLDALDGLAQGSSTSE--LTL 891
            LIWF THLE+ HS+I+Y+FEL+MGLRG        ++ K  D +  + +    ++   +L
Sbjct: 849  LIWFFTHLELKHSLIYYVFELIMGLRGKAFSGKASDQDKKDDMIYEILKKKQKNDDASSL 908

Query: 892  PFSRQGPIILSSIEVNMLLQEFFTNAAIFFSSKLRXXXXXXXXXXXXXXXXXXXXXVPPH 951
            PFSRQGPIILS IE  MLLQEFF NAAIF SS                        +  +
Sbjct: 909  PFSRQGPIILSDIETKMLLQEFFMNAAIFLSSN------------NSEEENEDGEKISLY 956

Query: 952  VIGLMKLVCFMVDTLMQKKKFDFTDSEYIFELQTLLMNWIGIVPEARDLFFKLKSQIVAT 1011
             +GL++L+C+MV TL+   KF FT SE  FELQTLLM WIGI+PEA+DLFF++K+++   
Sbjct: 957  SLGLVRLICYMVQTLITNDKFFFTKSECTFELQTLLMTWIGILPEAKDLFFEIKTRLAM- 1015

Query: 1012 SQDTQEQGTPVKESEKDDIDAPDTLEMNDTMSEHNKKLMMLIPPGTTN-ERNALTALRGF 1070
             ++  + GT   E  +  +D    L        + K L +       N E +A+  LR F
Sbjct: 1016 -EEDNDTGTMQHEGRR-SLDIEKKLNTKPASKLNLKLLSLFPSNSADNGENSAINTLRNF 1073

Query: 1071 IGKYSLTNKTAVFGRKIIYQDDEIMGMYMTDKEMMYREFLAEFGIDYND 1119
            I  YS   +    GRK+++ D +I+ +   DK +   E++    +D  D
Sbjct: 1074 ITDYSFDTQVNPPGRKVVFYDGKILPLTKADKPIPLHEYITLAELDVGD 1122

>KAFR0C02000 Chr3 (396123..399323) [3201 bp, 1066 aa] {ON} Anc_3.497
            YGR134W
          Length = 1066

 Score =  766 bits (1977), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 452/1095 (41%), Positives = 622/1095 (56%), Gaps = 128/1095 (11%)

Query: 47   AVVQEMLILSLFVTLPGHSILELYYDLSCGRVDLSSYKQWQHSQVRSTDGYKKLVKR--W 104
            +V+ E L++SLF T  GHSIL +  +          Y  W  S   S D   K +K   W
Sbjct: 51   SVLLEGLVISLFTTKSGHSILSVLNNPDANSELFQRYNSWLESS--SGDLNYKYLKHELW 108

Query: 105  -STSTXXXXXXXXXXXQNKNVPLEYTKHNTAEYKLSLIFLLDKQNEFXXXXXXXXXXXXX 163
             S              QN+ VP     ++  +YKL L  L++ ++               
Sbjct: 109  QSNRNYYLSQFTKFLLQNEQVPFHLNNYHLTKYKLKLQRLINSESNIISLILNSDNYNLL 168

Query: 164  XX-------HAKPMIESILLGNIPGLLKALVYQYNKLPEFNGCHTWYTFRTHYHGTQEIF 216
                     +   +I  I+ GN       ++ +YN++ E NG HTWYT     + +  + 
Sbjct: 169  LDFIMFFQPYMNDLISYIVEGN---KFFEIIAKYNRIYELNGFHTWYTLTIASNTSIAVR 225

Query: 217  HKFFIALTDKFTASKEIMPELEGWFVEGPVSRDSGCIKPITGDDYTSSAAIDDFNEDYWT 276
            +     L D  +                        I P+  D +TS+     F E   T
Sbjct: 226  Y-----LNDVLS------------------------IDPMITDQFTSNYRDKAFQESEET 256

Query: 277  ----QQKTNTQEQVYSFELNEDGTLEIPNVFAHTKRRHDALYKVLGLNDDPTPLLKSCFL 332
                QQ+T   + ++SF+LNE G  ++PN+  H++ RH  +Y +L LN   +P LK  FL
Sbjct: 257  LLMSQQQTAKDDIIFSFDLNETG--DLPNLIKHSEMRHQIIYDILNLNQIDSPFLKKQFL 314

Query: 333  TFCCLADPVTQPPPNDKHIVSLDLLSDMFLGLMYPEITADLVQPLNKDTWTLHICFNLQK 392
              C L DP+TQP PN++HI+S+DL+  +F+GLMY     +L    +K+     ICFN+QK
Sbjct: 315  LICGLVDPLTQPQPNNEHIISIDLIYQLFMGLMYKFNNNELAGK-DKELQHFTICFNMQK 373

Query: 393  IINATLSRLNCDDFTRLNEINNSDDSVDWRKNLYKWLPQGLNTQDLELIYMVDILATYTI 452
            II+ +L  LNC+D+  L+ I N D   D++  L KWLP G+NTQDLELIYM++I+A YTI
Sbjct: 374  IISRSLVLLNCNDYDTLSTILN-DFPNDYKTALNKWLPHGINTQDLELIYMINIIAIYTI 432

Query: 453  YKLYSNRPIQMNPFLLPMISLWKNLTCVVLLGLEIDRLEEEQETFNTPVMVRATIRGASA 512
            YKLYSN PIQ+NPFL  ++SLWK L+ +VL+GLEIDR+EE  ET++TP++VRATIRGA+A
Sbjct: 433  YKLYSNLPIQLNPFLQTLVSLWKTLSHLVLIGLEIDRIEESNETYDTPIIVRATIRGAAA 492

Query: 513  LRSVLATIINGHARYKSHDFKHEPINLFMSPHGRKLCNGALYADLRSHAATMLALG-IXX 571
            LR+V+ATI+N H   K HDFKHE  N FMSPHGRKLC+GAL ADLRSHAA +LALG    
Sbjct: 493  LRAVIATILNDHVSTKEHDFKHESFNTFMSPHGRKLCSGALLADLRSHAAAILALGDGEL 552

Query: 572  XXXXXXXXXXQPGDRFDEDVKYMFDYEFDDYNEVDTELMADDELEDIESRERIKEVRGYY 631
                      Q GDRFDEDVKY+F+YE+ DYNE+  E    +ELE++E R   K      
Sbjct: 553  HDVTELLADLQAGDRFDEDVKYIFEYEYQDYNELGEEDEQTNELEELEKRSVKK------ 606

Query: 632  KRCHCVFDDDSLVPENXXXXXXXXXXXXTKKHLQDSHEDQLPPQQNVVMSTTSKPLAVRS 691
            +RC+C+F+DD ++ +               ++ +  +E +          + + P +VR 
Sbjct: 607  RRCNCIFEDDKMLED--------------YEYYEVGNESRREDMNLESDKSRTNPYSVRV 652

Query: 692  RDTVEFDFNGRDWRDIPRGLNFYYTDAYIFVTKLHADVVHYLMKEATRKKLERNHASFIL 751
                EFD++G+DWRD+PRG N YY+ +Y F+       V +   +AT +KL    +  +L
Sbjct: 653  NSIFEFDYSGKDWRDVPRGFNLYYSPSYEFIKNPKLGTVLHFTLKATTEKLSDEDSLLLL 712

Query: 752  RSIATCVKLEQEEAIVRRALGNQDGDKSSNATTIKTE----NELTSDFIYEKWCEDSLFE 807
            +S+A+CVKLEQE+ I+         +  SN     TE     E+T D +YE WCE+S FE
Sbjct: 713  QSVASCVKLEQEKMIL---------ENYSNTKNCSTEEDLDREVTPDDVYEIWCEESAFE 763

Query: 808  KMMYHNSDLVWRMMDEMLMCSGYRRVLIWFITHLEINHSVIHYIFELVMGLRGNITYEDD 867
            +M+Y N ++ WR+MDEMLMC+GYRRVL+WFITH+EINHS++HYIFELVMGLRG    + D
Sbjct: 764  RMIYLNKEVAWRLMDEMLMCNGYRRVLMWFITHMEINHSLVHYIFELVMGLRG----QRD 819

Query: 868  EEKSKNLDALDGL--------AQGSSTSELTLPFSRQGPIILSSIEVNMLLQEFFTNAAI 919
            + ++   D L  L         +GS      +PFSRQG IILS IE  MLLQEFFTNAAI
Sbjct: 820  DSRNPGDDRLKSLLLQDMMTDKKGSE----KVPFSRQGSIILSEIETKMLLQEFFTNAAI 875

Query: 920  FFSSKLRXXXXXXXXXXXXXXXXXXXXXVPPHVIGLMKLVCFMVDTLMQKKKFDFTDSEY 979
            FFS+                        V  + IGL+KL+CFMV TLM   KFDF+ SE 
Sbjct: 876  FFSTN-----------DTANMSSNDSENVSLYAIGLVKLICFMVKTLMNNDKFDFSKSEC 924

Query: 980  IFELQTLLMNWIGIVPEARDLFFKLKSQIVATSQDTQEQGTPVKESEKDDIDAPDTLEMN 1039
             FELQTLLMNWIGI+PEA++LFF LK+ +          G P  E  K D D  D+ E  
Sbjct: 925  TFELQTLLMNWIGIIPEAQELFFTLKANV----------GEPSMEG-KSDSDGTDSNE-- 971

Query: 1040 DTMSEHNKKLMMLIPPGTTN--ERNALTALRGFIGKYSLTNKTAVFGRKIIYQDDEIMGM 1097
              +S +N KL+ L+P  T +  E  A+  LR F+ KYS TNK  V GRK+IY+DD+I+ +
Sbjct: 972  GELSWYNSKLLALLPSPTNSGLENPAIETLRSFLKKYSFTNKVPVVGRKVIYKDDKILPI 1031

Query: 1098 YMTDKEMMYREFLAE 1112
                + ++ RE + E
Sbjct: 1032 PKLYQPILLRELIDE 1046

>NCAS0E00770 Chr5 complement(141832..145284) [3453 bp, 1150 aa] {ON}
            Anc_3.497
          Length = 1150

 Score =  722 bits (1864), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/879 (44%), Positives = 541/879 (61%), Gaps = 68/879 (7%)

Query: 284  EQVYSFELNEDGTLEIPNVFAHTKRRHDALYKVLGLND-DPTPLLKSCFLTFCCLADPVT 342
            + VYSF+LN D T E+ NV +HT +RH  L +++  ND   TPLL   F     L DP++
Sbjct: 275  QTVYSFDLNTDKTFELDNVVSHTAKRHRVLNQLINNNDLKTTPLLTLQFTFMAGLVDPLS 334

Query: 343  QPPPNDKHIVSLDLLSDMFLGLMYPEITADLVQPLNKDTWTLHICFNLQKIINATLSRLN 402
            QPPPN+K ++SL LL  MF+GLMYP +  +     +   W  HICFN+ K+IN ++  L 
Sbjct: 335  QPPPNNKQVISLHLLYSMFIGLMYPNL-KECFNANDGFNWKFHICFNMVKLINNSMVILK 393

Query: 403  CDDFTRLN----------EINNSDDSVDWRKNLYKWLPQGLNTQDLELIYMVDILATYTI 452
            CD+F +LN          E   +DD   W+  L +W+P G+NTQDLELIYM++I+A YTI
Sbjct: 394  CDNFNKLNDIINSNNDNDEGTENDDDDAWKLKLNEWIPHGINTQDLELIYMINIMAVYTI 453

Query: 453  YKLYSNRPIQMNPFLLPMISLWKNLTCVVLLGLEIDRLEEEQETFNTPVMVRATIRGASA 512
            Y+LYS+ PIQMNPFL  +I+LWKNL+ ++LLGL+IDR EE ++TF+TP++VRATIRGA++
Sbjct: 454  YQLYSDLPIQMNPFLSCLITLWKNLSAIILLGLDIDRSEEARKTFSTPLLVRATIRGAAS 513

Query: 513  LRSVLATIINGHARYKSHDFKHEPINLFMSPHGRKLCNGALYADLRSHAATMLALGIXXX 572
            LR+V+ATI+N H     HDFKHEP+N FMSPHGRKLC GALYAD+RSHAA +LALG    
Sbjct: 514  LRAVVATILNNHVDVNEHDFKHEPLNTFMSPHGRKLCQGALYADIRSHAAAILALGAELE 573

Query: 573  XXXXXXXXXQPGDRFDEDVKYMFDYEFDDYNEVDTELMADDELEDIESRERIKEVRGYYK 632
                     Q GDRFDED++YMFDYE+DDYN+           +D+E +E ++ +  + +
Sbjct: 574  DVTDLLTDLQAGDRFDEDIRYMFDYEYDDYNDFK---------DDVEEQEEMEIMGSFPR 624

Query: 633  RCHCVFDDDSLVPENXXXXXXXXXXXXTKKHL---------QDSHEDQLPPQQNVVMSTT 683
            RC+C+F+DD+++ ++             ++           +D+  + L P  + + +  
Sbjct: 625  RCNCIFEDDNIINDDTDNINENDEDDDDEQEEYVDAIEGVTKDTPHNNLNP-HDAIRTRN 683

Query: 684  SKPLAVRSRDTVEFDFNGRDWRDIPRGLNFYYTDAYIFVTKLHADVVHYLMKEATRKKLE 743
            S P + RS+ + EFD+ G+DWRDIPRG N YY+ +Y F+     + +  L  +AT +KL 
Sbjct: 684  SHPNSKRSKSSFEFDYGGKDWRDIPRGFNLYYSPSYHFIKSPMMETISTLTSKATNEKLT 743

Query: 744  RNHASFILRSIATCVKLEQEEAIVRRALGNQDGDKSSNATTIKTENELTSDF-------I 796
               ++ ++ ++A+C+KLEQ++ I +  L +        A     ENE  +DF       I
Sbjct: 744  TEDSTLLITAVASCIKLEQDKMISKELLKHNTVKHPHAA-----ENEDDADFKIATPDDI 798

Query: 797  YEKWCEDSLFEKMMYHNSDLVWRMMDEMLMCSGYRRVLIWFITHLEINHSVIHYIFELVM 856
            Y+ W E+S FE+M+Y N D+ WR+MDEMLMC+GYRRVLIWFITH+E+NHS+I YIFELVM
Sbjct: 799  YDMWSEESKFERMLYLNQDVAWRLMDEMLMCNGYRRVLIWFITHMELNHSLIQYIFELVM 858

Query: 857  GLRGN-ITYEDDEEKSKNLDALDGLAQGS------STSELTLPFSRQGPIILSSIEVNML 909
            GLRG+  + E DE  SKN D L  +  G        TS   LPFSRQGP+ILS IE  ML
Sbjct: 859  GLRGSPFSGEGDETDSKN-DLLHEIMYGQVKNKEIVTSLTYLPFSRQGPLILSEIENKML 917

Query: 910  LQEFFTNAAIFFSSKLRXXXXXXXXXXXXXXXXXXXXXVPPHVIGLMKLVCFMVDTLMQK 969
            LQEFFTNAAI+FSSK                       V  +  GL+KL+CFMV +LM+ 
Sbjct: 918  LQEFFTNAAIYFSSKSNNEGTTNNDNGEGIDEEAVNFSV--YSTGLVKLICFMVQSLMEN 975

Query: 970  KKFDFTDSEYIFELQTLLMNWIGIVPEARDLFFKLKSQIVATSQDTQEQGTPVKESEKDD 1029
             KFDF  SE  FELQTLLMNWIGI+PEA DLFF LKS + ++S  T  +      +  D+
Sbjct: 976  NKFDFAKSECTFELQTLLMNWIGIIPEAEDLFFTLKSGVSSSSTKTGRESDDHDNTHADN 1035

Query: 1030 -------------IDAPDTLEMNDTMSEHNKKLMMLIPP--GTTNERNALTALRGFIGKY 1074
                         I   DT +     S  NK+L+ L+P      +E  A++ LR FI +Y
Sbjct: 1036 LSFSDDGDTGHPGISRFDTDDSPPNESIFNKRLVSLLPKRINDKDENAAVSTLRHFIERY 1095

Query: 1075 SLTNKTAVFGRKIIYQDDEIMGMYMTDKEMMYREFLAEF 1113
            S   +  V+GRK++Y D+ ++ +   D+ + + E+L E 
Sbjct: 1096 SFDEEAPVYGRKVVYSDEIVLPLPAADQPISFHEYLTEL 1134

>KNAG0B00770 Chr2 complement(142612..145728) [3117 bp, 1038 aa] {ON}
            Anc_3.497 YGR134W
          Length = 1038

 Score =  660 bits (1703), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/988 (39%), Positives = 558/988 (56%), Gaps = 119/988 (12%)

Query: 167  AKPMIESILLGNIPG-LLKALVYQYNKLPEFNGCHTWYTFRTHYHGTQEIFHKFFIALTD 225
             +P ++ ++   + G L+  +V +Y ++ EF+    W+         +++       + +
Sbjct: 124  VRPQLKGLIRQAVQGSLVDPIVRKYGRVYEFHDYFHWFNLSKKKFANRDVL------ILN 177

Query: 226  KFTASKEIMPELEGWFVEGPVSR---DSGCIKPITGDDYTSSAAIDDFNEDYWTQQKTNT 282
            K T      P+L  +++    S+   D   + P  G+ +  +  +          Q+  T
Sbjct: 178  KGT------PDLFHYYINSFCSKAPYDVHPLHPFLGELFEGNNNV--------KYQQLGT 223

Query: 283  QEQVYSFELNED-----GTLEIP-NVFAHTKRRHDALYKVLGLNDDPTPLLKSCFLTFCC 336
             E VY F+L+E+     G   +  ++   + +RH+ L ++L L +  +P L   F     
Sbjct: 224  NEHVYEFDLDEETHNGSGNRTVAVDLMQQSNQRHEILTRMLNLKEIDSPHLYEQFKCMIS 283

Query: 337  LADPVTQPPPNDKHIVSLDLLSDMFLGLMYPEITADLVQPLNKDTW---TLHICFNLQKI 393
            L DP+TQPPP+D ++VSLDLL  +FL  +          P N+DT    T  +CFN+QKI
Sbjct: 284  LVDPLTQPPPSDTYVVSLDLLYKLFLAFL----------PKNQDTEQNDTFLLCFNMQKI 333

Query: 394  INATLSRLNCDDFTRLNEINNSDDSVD-----WRKNLYKWLPQGLNTQDLELIYMVDILA 448
            I  TL RL C D+ +L  I+      D     +R +L +W+P GLNTQDLEL+YMVDI+A
Sbjct: 334  ITRTLWRLKCWDYAKLTSISKKQTEGDNSQYNYRDHLKEWVPNGLNTQDLELLYMVDIMA 393

Query: 449  TYTIYKLYSNRPIQMNPFLLPMISLWKNLTCVVLLGLEIDRLEEEQETFNTPVMVRATIR 508
             YTIY  YS+ PIQ+NPFL  +ISLWKNL+ V+LL LE+DR EE  +TF+TP++VRATIR
Sbjct: 394  VYTIYNAYSHLPIQLNPFLSMLISLWKNLSAVLLLSLEVDRCEEANDTFDTPLLVRATIR 453

Query: 509  GASALRSVLATIINGHARYKSHDFKHEPINLFMSPHGRKLCNGALYADLRSHAATMLALG 568
            GASALR+V+A ++NGH R   HDFKHEP+N FMSPHGRKLC G+LYADLRSHAA ML+LG
Sbjct: 454  GASALRAVVACVLNGHVRENEHDFKHEPLNTFMSPHGRKLCQGSLYADLRSHAAAMLSLG 513

Query: 569  IXXXXXXXXXXXXQPGDRFDEDVKYMFDYEFDDYNEVDTELMADDELED----------- 617
            +            QPGDRFDED++YMF+YE++DYN VD E    DE ED           
Sbjct: 514  VDLEDVTELLSDLQPGDRFDEDIRYMFEYEYEDYNLVDFE----DEDEDAAAAATTATAS 569

Query: 618  IESRERIKEVRGYY--KRCHCVFDDDSLVPENXXXXXXXXXXXXTKKHLQDSHEDQLPPQ 675
              +     E  G    +RC+C+F DD ++                     D  +  L   
Sbjct: 570  AAAITAANEGTGASQKRRCNCIFTDDKIIQ-------------------SDESKVSLGGG 610

Query: 676  QNVVMSTTSKPLAVRSRDTVEFDFNGRDWRDIPRGLNFYYTDAYIFVTKLHADVVHYLMK 735
            +N       +P +VR++ + EFD++G DWRD+PRGLN Y+  +Y F+ +        +  
Sbjct: 611  KN-------RPYSVRTKSSFEFDYSGNDWRDVPRGLNLYFWPSYEFLARPGLAEFRNVSS 663

Query: 736  EATRKKLERNHASFILRSIATCVKLEQEEAIVRRALGNQDGDKSSNATTIKTENELTSDF 795
            +A   KL    +  +L+ +A+ +K+EQE  I+       +G        +  +  LT D 
Sbjct: 664  KAAGGKLNPMESQQLLKLVASAIKIEQECIIMGTVYPQTEG------IAVGDDGLLTPDN 717

Query: 796  IYEKWCEDSLFEKMMYHNSDLVWRMMDEMLMCSGYRRVLIWFITHLEINHSVIHYIFELV 855
            IY+ W +D +F+++++ N +L W++MDE+LMC GYRRVL+WF+TH+E+NHSVIHYIFELV
Sbjct: 718  IYDAWFQDKVFDRILFMNQELAWKLMDELLMCHGYRRVLLWFVTHMELNHSVIHYIFELV 777

Query: 856  MGLRGNITYEDDEEKSKNLDALDGLAQGSSTSELTLPFSRQGPIILSSIEVNMLLQEFFT 915
            MGLRG     D   + +   AL  L +  + +  TL FSRQG + LS IEV MLLQEFFT
Sbjct: 778  MGLRGQELSADVTLEEQRKQALHNLMEIDTPNGGTLMFSRQGNLALSEIEVKMLLQEFFT 837

Query: 916  NAAIFFSSKLRXXXXXXXXXXXXXXXXXXXXXVPPHVIGLMKLVCFMVDTLMQKKKFDFT 975
            NAAIF S+                        V  + IGL+KL+CFMV TL+   KF+F+
Sbjct: 838  NAAIFLSAS------------ESEEPESETSDVSLYSIGLVKLICFMVKTLIVNHKFEFS 885

Query: 976  DSEYIFELQTLLMNWIGIVPEARDLFFKLKSQIVATSQDTQEQGTPVKESEKDDI----- 1030
             SE  FELQTLLMNW+GIVP+A++LFF LK  I  T   T    T        DI     
Sbjct: 886  KSECTFELQTLLMNWLGIVPDAQELFFLLKKNISDTKTATTTTTTTSALGAPGDIFPTLT 945

Query: 1031 DA-PDTLEMNDTMSEHNKKLMMLIPPGTTNE----RNALTALRGFIGKYSLTNKTAVFGR 1085
            DA  D   + + +SE NKKL+ML+P  T +E      A+ ALR F+ K+SL+++  V GR
Sbjct: 946  DADDDNNAVAENLSEFNKKLVMLLPRATQSEGKGSSQAIDALRNFMRKHSLSSEIPVLGR 1005

Query: 1086 KIIYQDDEIMGMYMTDKEMMYREFLAEF 1113
            +I+ +  +I+     ++ +  RE+L  +
Sbjct: 1006 RIVRRGSQILPQATPERTVTLREYLGSY 1033

>Kpol_480.12 s480 complement(23340..26684) [3345 bp, 1114 aa] {ON}
            complement(23340..26684) [3345 nt, 1115 aa]
          Length = 1114

 Score =  654 bits (1686), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/844 (43%), Positives = 507/844 (60%), Gaps = 54/844 (6%)

Query: 297  LEIPNVFAHTKRRHDALYKV-----LGLNDDPTPLLKSCFLTFCCLADPVTQPPPNDKHI 351
            L+ P++   T +RH AL K+     L      +PLL+  + T   L DP+TQP PND H+
Sbjct: 296  LDFPDLMNETAKRHLALSKLIIDSKLEKQISNSPLLQIQYKTLLALIDPLTQPVPNDTHV 355

Query: 352  VSLDLLSDMFLGLMYPEITADLVQPLNKDTWTLHICFNLQKIINATLSRLNCDDFTRLNE 411
            +S+DLL +MFLGLM P I   L      D W  HICFN+Q+II A+L  LNC+DF RL  
Sbjct: 356  ISIDLLCNMFLGLMKPYIDNQLNNDDGVD-WRFHICFNMQQIIIASLFVLNCNDFERLGT 414

Query: 412  INNSDDSVDWRKNLYKWLPQGLNTQDLELIYMVDILATYTIYKLYSNRPIQMNPFLLPMI 471
            +   D+S DWR  L+ WLP+GLNTQ+LEL+YM  ILA YTIYKLYS+ P+  NPFL  +I
Sbjct: 415  V---DESKDWRSQLHLWLPRGLNTQNLELVYMSCILAVYTIYKLYSDSPVHFNPFLSSLI 471

Query: 472  SLWKNLTCVVLLGLEIDRLEEEQETFNTPVMVRATIRGASALRSVLATIINGHARYKSHD 531
            SLWK+LTCVVL GL+IDRLEE  ++F+TP++VRATIRGA+ALRS++AT++N     K HD
Sbjct: 472  SLWKSLTCVVLYGLQIDRLEESNQSFDTPIIVRATIRGAAALRSIVATVLNEQMELKRHD 531

Query: 532  FKHEPINLFMSPHGRKLCNGALYADLRSHAATMLALGIXXXXXXXXXXXXQPGDRFDEDV 591
            F HE +N FMSPHGRKLC+GALYADL+++ A++LALG             Q GD+FDEDV
Sbjct: 532  FIHESLNTFMSPHGRKLCDGALYADLKAYTASILALGAEFQEVTDLVSYLQAGDQFDEDV 591

Query: 592  KYMFDYEFDDYNEVDTELMADDELEDIESRERIKEVRGYY---KRCHCVFDDDSLVPENX 648
            KYMF+YE++DYNE+          ED  +     E   Y    +RC+C+F DD+L+ E  
Sbjct: 592  KYMFEYEYEDYNEI---------YEDSSNENEENEEIDYAFNKRRCNCIFSDDNLIEEEE 642

Query: 649  XXXXXXXXXXXTK-----KHLQDSHEDQLPPQQNVVMSTTSKPLAVRSRDTVEFDFNGRD 703
                       +            H ++     + + +  SKP AVRS+   EFD++G+D
Sbjct: 643  DDEEESDVEKTSDIDGEIATKSKEHTEKTIESDSGLSNQLSKPHAVRSKSNFEFDYSGKD 702

Query: 704  WRDIPRGLNFYYTDAYIFVTKLHADVVHYLMKEATRKKLERNHASFILRSIATCVKLEQE 763
            WRDIPR  N YY+  Y F+ +   + V  L  +AT +KL +  A+ +L S+A+ VK EQ+
Sbjct: 703  WRDIPREYNLYYSPFYNFIDRPDLNTVFVLTLKATSEKLTKEEAALLLCSVASTVKNEQD 762

Query: 764  EAIVRRALGNQDGDKSSNATTIK-TENELTSDFIYEKWCEDSLFEKMMYHNSDLVWRMMD 822
              I    L   + DKSS A   + T+ E T D IYE WCE+S FE++++ N DL W++MD
Sbjct: 763  RMIFGNLL---EQDKSSTADEHEDTKKEATPDDIYEIWCEESAFERILHFNPDLAWKLMD 819

Query: 823  EMLMCSGYRRVLIWFITHLEINHSVIHYIFELVMGLRGNITYEDDEEKSKNLDALDGLAQ 882
            EMLMCSGYRRVLIWFITH+E++HS+I YIF+L+MG RG I   D  +  K+    + ++ 
Sbjct: 820  EMLMCSGYRRVLIWFITHMELSHSLIIYIFDLMMGSRG-INKTDTSKNVKSTFITENISD 878

Query: 883  GSSTSELTLPFSRQGPIILSSIEVNMLLQEFFTNAAIFFSSKLRXXXXXXXXXXXXXXXX 942
             +S S   L FSR G + LS +E  M+LQE FTNAAI+FS K R                
Sbjct: 879  SNSNS---LKFSRMGHLKLSELETRMILQELFTNAAIYFSDKARKSNQSILTPDYSTEEE 935

Query: 943  XXXXXV----PPHVIGLMKLVCFMVDTLMQKKKFDFTDSEYIFELQTLLMNWIGIVPEAR 998
                        + +GLMKL+C MV  L++  KF+  +S+ +FELQTLLM WI I+PEA+
Sbjct: 936  EFDEENEGGYSIYSVGLMKLICIMVSKLIENSKFNVNESDCVFELQTLLMGWISILPEAK 995

Query: 999  DLFFKLKSQIVATSQDTQEQGTPVKESEKDDIDAPDT------LEMNDTMSEHNKKLMML 1052
            +L FK+ S +   S         V+ SE   I+   T      ++ N    ++N+ L+ L
Sbjct: 996  ELSFKINSSLSEFSH--------VENSELASIEGASTKSHKQLVDKNSESYKYNEILLKL 1047

Query: 1053 IPP--GTTNERNALTALRGFIGKYSLTNKTAVFGRKIIYQDDEIMGMYMTDKEMMYREFL 1110
            IPP  G   E       R +I  YS  ++ +   RKII+Q DEI+ +  ++K   + ++L
Sbjct: 1048 IPPTFGGKEENIIFNTFRDYIKDYSFDSEVSTMCRKIIHQSDEILPLQDSEKPFSFHDYL 1107

Query: 1111 AEFG 1114
             E+G
Sbjct: 1108 TEYG 1111

>NDAI0G00900 Chr7 complement(187653..191492) [3840 bp, 1279 aa] {ON}
            Anc_3.497 YGR134W
          Length = 1279

 Score =  655 bits (1690), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 432/1192 (36%), Positives = 626/1192 (52%), Gaps = 171/1192 (14%)

Query: 38   IPHVEEFPDAVVQEMLILSLFVTLPGHSILELYYDLSCGRVDLSSYKQWQHSQVRSTDGY 97
            I  V++F  +++ E L+++ F T  G SIL   +D                 +   T   
Sbjct: 108  IKKVKKF--SIMLETLVIAYFTTKSGQSILNYLFDTK---------------RKPPTVQN 150

Query: 98   KKLVKRWSTSTXXXXXXXXXXXQNKNVPLEYTKHNTAEYKLSLIFLLD-------KQNEF 150
            K L K W  +            +NKN  +   K N  E KLS+ FLL        +    
Sbjct: 151  KILRKTWEVNEFLYFCFIDFLIRNKNNEINIDKFNEPENKLSIKFLLTFHPLSNIETPSI 210

Query: 151  XXXXXXXXXXXXXXXHAKPMIESILLG--NIPGLLKALVYQYNKLPEFNGCHTWYT---- 204
                            +  +I  I +   N+       + +YN++P+FNG   WYT    
Sbjct: 211  ILDSNYNMLTDYLDATSNWLILLIKMTILNVGPFFYNTIIRYNRIPQFNGHFQWYTSLPN 270

Query: 205  -----------FRTHYHGTQEIFHKFFIALTDK----------FTASKEIMPELEGWFVE 243
                               + +  + FI +  +          F  SK   P +  W +E
Sbjct: 271  DKPLYIKESSNSCNTSSSNKILSSESFIEIITRSNHDFEDDKSFKMSKTSKPVV-LWAIE 329

Query: 244  GPVSR----DSGCIKPIT----GDDY---------------TSSAAIDDFNEDYWTQ--Q 278
              +SR    DS   K       G +Y                 +   D++++DY  +   
Sbjct: 330  EILSRLSFKDSSRYKKNNINGNGQNYPQMERAQNQSDINYLNRNDGADEYDDDYLHRIDD 389

Query: 279  KTNTQEQVYSFELNEDGTLEIP-NVFAHTKRRHDALYKVLGLND-DPTPLLKSCFLTFCC 336
              + +E+VYSF+LN DG++ +P N+  +TK+RH  L K+L  N  D +PLL+  F     
Sbjct: 390  LKDGEEKVYSFDLNNDGSITMPENLMLNTKKRHQILNKLLNSNSFDSSPLLELQFKLMLG 449

Query: 337  LADPVTQPPPNDKHIVSLDLLSDMFLGLMYPEITADLVQPLNKDTWTLHICFNLQKIINA 396
            L DP++QPPPNDKHI+SLDLL  +F+ ++YP    ++ Q      W  H+CF + KIIN 
Sbjct: 450  LVDPLSQPPPNDKHIISLDLLYQLFIAILYPNF--EIFQNNLGFNWKTHVCFQMVKIINN 507

Query: 397  TLSRLNCDDFTRLNEI------NNSDDSV-------------------DWRKNLYKWLPQ 431
             + +LNC+D  +L ++      NN ++ +                   +WR  L +WLP 
Sbjct: 508  CMEKLNCNDLQKLYDLTGFQGENNKEELLQQQQQQQQQQQQTDRFVDGNWRSTLEQWLPH 567

Query: 432  GLNTQDLELIYMVDILATYTIYKLYSNRPIQMNPFLLPMISLWKNLTCVVLLGLEIDRLE 491
            GLNTQDLEL+YMV ILA+YT+ KL    PIQ+NPFL  +I+LWK LT +++LGL+IDR E
Sbjct: 568  GLNTQDLELLYMVMILASYTLQKLNHEIPIQLNPFLPTLINLWKKLTLILVLGLDIDRSE 627

Query: 492  EEQETFNTPVMVRATIRGASALRSVLATIINGHARYKSHDFKHEPINLFMSPHGRKLCNG 551
            E  ET+ TP++V+ATIRGASALRSV+ATI+N +  Y  HDFKHE +N FMSPHGRKLCNG
Sbjct: 628  EAHETYKTPLLVKATIRGASALRSVVATILNNYMEYNDHDFKHEALNTFMSPHGRKLCNG 687

Query: 552  ALYADLRSHAATMLALGIXXXXXXXXXXXXQPGDRFDEDVKYMFDYEFDDYNEVDTE--- 608
            ALY D++  AA++ ALG+            +PGDRFDED+ YMF+YE+DDYN    E   
Sbjct: 688  ALYCDIKLFAASLYALGMDLIEIRNLLSYLEPGDRFDEDINYMFEYEYDDYNAALKENHE 747

Query: 609  -----LMADDELEDIESRERIKEVRGYYKRCHCVFD-----DDSLVPENXXXXXXXXXXX 658
                 L ++D+  DI     +K  R Y +RC+C+F+      D                 
Sbjct: 748  DLGKTLKSNDDNSDIYVLNEVKLDR-YQRRCNCIFEDDKILQDDDDGNGDEQQGEQEEQE 806

Query: 659  XTKKHLQDSHEDQLPPQQNVVMSTTSKPLAVRSRDTVEFDFNGRDWRDIPRGLNFYYTDA 718
             T K++  S +D L  +        +   AVRS+ T EFD++G+DWRDIPRG N YY+ +
Sbjct: 807  GTPKNVA-SFQDPLGKR--------NLDYAVRSKTTFEFDYSGKDWRDIPRGFNIYYSTS 857

Query: 719  YIFVTKLHADVVHYLMKEATRKKLERNHASFILRSIATCVKLEQEEAIVRRALGNQDGDK 778
            Y F+     D +  L  +A+ +KL  + +  +L+ +A+ +K EQ + I++  L  +D   
Sbjct: 858  YSFIDDSSLDTMINLTSKASTQKLNHDDSIQLLQLLASSIKEEQNDMIMKDLLKGKDQLH 917

Query: 779  SSNATTI---KTENE-----LTSDFIYEKWCEDSLFEKMMYHNSDLVWRMMDEMLMCSGY 830
            S+    +   K E E      T D I++ W +  +F +M++ N +L WR+MDEMLMC+GY
Sbjct: 918  SNIINPLVNSKEEKERSTVVATPDDIFDYWFDKDVFVEMLHFNEELSWRLMDEMLMCNGY 977

Query: 831  RRVLIWFITHLEINHSVIHYIFELVMGLRGNITYEDDEEKSKNLDALDGLAQGSSTSELT 890
            RRVLIW+ITH+++NHS+I YIFEL+MGLRG+    ++E K++ L  L  +         T
Sbjct: 978  RRVLIWYITHMKLNHSLIQYIFELLMGLRGSPFANNNECKNELLHEL--MLGKKIVDNHT 1035

Query: 891  LPFSRQGPIILSSIEVNMLLQEFFTNAAIFFSSKLRXX--------XXXXXXXXXXXXXX 942
             PFSRQGP+ILS IE  MLLQEFF+NAAI+F + L                         
Sbjct: 1036 YPFSRQGPLILSDIETKMLLQEFFSNAAIYFDNDLATNEGDGQLEHTTEDISINSDEIEN 1095

Query: 943  XXXXXVPPHVIGLMKLVCFMVDTLMQKKKFDFTDSEYIFELQTLLMNWIGIVPEARDLFF 1002
                 V  + +GLMKL+C MV +L++ KKFDFT S+  FELQTLLMNWIGI+ EA++LFF
Sbjct: 1096 NENHGVSMYSMGLMKLICIMVSSLIENKKFDFTKSDCNFELQTLLMNWIGILKEAKELFF 1155

Query: 1003 KLKSQIVATSQDTQEQGTPVKESEKDDIDAPDTLEMNDT-----------MSEHNKKLMM 1051
            KLKS I  TS+ T          + DD ++ D+ + +++           M++ NK+L+ 
Sbjct: 1156 KLKSDIEETSESTD-------GGDDDDFESIDSRKSSESNGKWEGSRIGKMNDFNKRLLR 1208

Query: 1052 LIPP---GTT--NERNALTALRGFIGKYSLTNK-TAVFGRKIIYQDDEIMGM 1097
            L+ P   G T  N     T  RG +  YS T+K   V GRK++Y DDEI+ +
Sbjct: 1209 LLAPIHSGDTDLNSDTVTTPFRGLLKNYSFTSKPKKVAGRKVVYTDDEILPL 1260

>TBLA0C04510 Chr3 (1092230..1096153) [3924 bp, 1307 aa] {ON} Anc_3.497
            YGR134W
          Length = 1307

 Score =  644 bits (1660), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 420/1086 (38%), Positives = 580/1086 (53%), Gaps = 174/1086 (16%)

Query: 167  AKPMIESILLGNI-PGLLKALVYQYNKLPEF---NGCHTWYTF----RTHYHGTQ----E 214
            + P++ S+L  N+ P L   ++  YNK  E    N C  WY F     T   GT     +
Sbjct: 214  STPLLISLLHTNLDPLLFNNIISSYNKSFELTNDNKC-LWYDFIDSKDTTNFGTITNCID 272

Query: 215  IFHKFF--IALTDKFTASKEIMPELEGWFVEGPVSRDSGCIKPITGDDYTSSAAIDDFNE 272
            I + F     +   FT + EI   L  + +    +  S       G D            
Sbjct: 273  IINNFLEIFDMHKNFTLNAEISNSL--FNISSSSTTKSNMHNENEGADLN---------- 320

Query: 273  DYWTQQKTNTQEQVYSFELNED----GTLEIPNVFAHTKRRHDALYKVLGLNDDP----T 324
                  + +  E   SF L E+    G L  P++ AH  +RHD L K+L + D+     +
Sbjct: 321  --LLMDENSMGEHTLSFNLFENNINHGILH-PDLMAHISKRHDILAKILNVGDNDKYYNS 377

Query: 325  PLLKSCFLTFCCLADPVTQPPPNDKHIVSLDLLSDMFLGLMYPEITADLVQPLNKDTWTL 384
            PLL   F   C L DP+TQP PN K+I+S+DLL  +FLG + PE+        +   W  
Sbjct: 378  PLLHLQFKLLCALVDPLTQPTPNHKNIISIDLLFQLFLGFLKPELDR-YSSAEDGTNWKF 436

Query: 385  HICFNLQKIINATLSRLNCDDFTRLNEINNSDDSVDWRKNLYKWLPQGLNTQDLELIYMV 444
             +CFN++KIIN+ + +LNC DF  LN INNSD+SV WR  L+KWLP+G NTQDLEL+YMV
Sbjct: 437  LVCFNMEKIINSVMKKLNCVDFNTLNSINNSDESVHWRTQLHKWLPRGFNTQDLELLYMV 496

Query: 445  DILATYTIYKLYSNRPIQMNPFLLPMISLWKNLTCVVLLGLEIDRLEEEQETFNTPVMVR 504
            +ILATYTIYKL  + PIQ+NPFL  M+S WKNL+C +LLGLEIDRLEEE ETF+TP++VR
Sbjct: 497  NILATYTIYKLNEDLPIQLNPFLSSMVSHWKNLSCTILLGLEIDRLEEENETFDTPLIVR 556

Query: 505  ATIRGASALRSVLATIINGHARYKSHDFKHEPINLFMSPHGRKLCNGALYADLRSHAATM 564
            AT+R ++ALRS++ATI+N H    +HDFKHE +N FMSP+GRKLCNGALY D RSHA+T+
Sbjct: 557  ATVRSSTALRSIIATILNEHVNAFAHDFKHESLNTFMSPYGRKLCNGALYTDFRSHASTI 616

Query: 565  LALGIXXXXXXXXXXXXQPGDRFDEDVKYMFDYEFDDYNEVDTELMADDE---LEDIESR 621
            LAL              QPGDRFDEDVKYMF  EF+DYN +   L  +D+    + +++R
Sbjct: 617  LALTGDLEHVTQLISDLQPGDRFDEDVKYMF--EFEDYNTLPNVLGGEDDETSTDTLKNR 674

Query: 622  ERIK-----------------EVRGY----------YKRCHCVFDDD------------- 641
            E +K                 E+R Y          ++RC+C+F DD             
Sbjct: 675  EMLKEIHNGNFIPDNEENDEREIRNYLEQKLREMNCHRRCNCIFSDDEIKDTSISDKNYM 734

Query: 642  ------------SLVPENXXX------XXXXXXXXXTKKHLQDSHEDQLPPQQNVVMSTT 683
                        +L+  N                   +K++++  +DQL   +   +  T
Sbjct: 735  GNSSSNGIESRIALLLNNNSSRKGGNGTNSEDDEDVIRKNIENLTKDQLSSTEMESLRVT 794

Query: 684  --SKPLAVRS---------------RDTVEFDFNGRDWRDIPRGLNFYYTDAYIFVTKLH 726
              +KP AVR+               ++  +FD+NG+DWRD PRG+N YY   Y F+ K +
Sbjct: 795  GFNKPHAVRTSNLNNNPSSVNNKNNQNIFDFDYNGKDWRDTPRGMNLYYNLNYEFIEKPN 854

Query: 727  ADVVHYLMKEATRKKLERNHASFILRSIATCVKLEQEEAI---------VRRAL-GNQDG 776
             D+V  L  +AT  KL+++ ++ +LR +A+ VK EQ+  I         V+  +  N+DG
Sbjct: 855  LDLVFQLTLKATNMKLDKDDSNLLLRLVASSVKNEQDRIIFSDNQVSKEVKEIMEQNEDG 914

Query: 777  DKSS----NATTIKTEN------ELTSDFIYEKWCEDSLFEKMMYHNSDLVWRMMDEMLM 826
             ++     N   I+  N      E+T D IYE WCE+S FE+MM  N ++ +R+MDEMLM
Sbjct: 915  VENEKLPHNKNRIENGNEKEIITEITPDDIYEIWCEESAFERMMQLNYEVTFRLMDEMLM 974

Query: 827  CSGYRRVLIWFITHLEINHSVIHYIFELVMGLRG----NITYEDDEEKSK-NLDALDG-- 879
            C GYRRVLIWFITHLE++HSVIHYIFELVMG RG    N   ED    +K N++ L+   
Sbjct: 975  CYGYRRVLIWFITHLELSHSVIHYIFELVMGFRGTSEENGATEDKHTNTKGNVNELENKN 1034

Query: 880  --------LAQGSSTSELTLPFSRQGPIILSSIEVNMLLQEFFTNAAIFFSSK-----LR 926
                    L   S   +L LPFSRQG I LS IE  ML+QEF TNAAI F+ +       
Sbjct: 1035 ENELVNMLLNDYSKIFDLQLPFSRQGNIELSEIERKMLIQEFLTNAAIHFNERNNLKHNP 1094

Query: 927  XXXXXXXXXXXXXXXXXXXXXVPPHVIGLMKLVCFMVDTLMQKKKFDFTDSEYIFELQTL 986
                                 +  + IGLM+L+CFM+   +   K      + IFELQTL
Sbjct: 1095 NSNDNSNSNEDNINKDEDEDEISLYSIGLMRLICFMIQAFLDNNKLKIEVDDSIFELQTL 1154

Query: 987  LMNWIGIVPEARDLFFKLKSQIVATSQDT------------QEQGTPVKESEKDDIDAPD 1034
            LMNWI I+PEA+ LFF++K  I     D             Q+  T   ++ KD+ D  D
Sbjct: 1155 LMNWITIIPEAKKLFFQIKDIISNNQIDNNNFNNNLILDLDQDNNTIENQTSKDNNDKMD 1214

Query: 1035 TLEMNDTMSEHNKKLMMLIPPGT-TN--ERNALTALRGFIGKYSLTNKTAVFGRKIIYQD 1091
                 D+ S  NKKL+ L P  + TN  E  A+  L+ ++ K+    +  + GRK+IY+D
Sbjct: 1215 ESSKVDSNSSFNKKLIELFPKMSHTNKEENTAIDTLKNYLKKFRFHQEVPIIGRKVIYED 1274

Query: 1092 DEIMGM 1097
             +I+ +
Sbjct: 1275 GKILKI 1280

>CAGL0I10428g Chr9 complement(1031462..1034953) [3492 bp, 1163 aa]
            {ON} similar to uniprot|P53280 Saccharomyces cerevisiae
            YGR134w
          Length = 1163

 Score =  580 bits (1496), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/1092 (33%), Positives = 561/1092 (51%), Gaps = 97/1092 (8%)

Query: 44   FPDAVVQEMLILSLFVTLPGHSILELYYDLSCGRVDLSSYKQWQHSQVRSTDGYKKLVKR 103
            F D    E+L ++LF T PG+ IL  + +     +D +         +  +  Y+ L   
Sbjct: 111  FEDNFFYELLTIALFTTKPGNKILHFFKNTG---LDSAIEHNDSDDTLFHSPAYEHLKML 167

Query: 104  WSTSTXXXXXXXXXXXQNKNVPLEYTKHNTAEYKLSLIFLLDKQN-----------EFXX 152
            W               +N+NV ++   +    YK  L FLL   N           EF  
Sbjct: 168  WKWEDEYLHNLLQFILKNRNVDIDLGNYCKTSYKRPLTFLLTCPNNNIKHRFLLSEEFNI 227

Query: 153  XXXXXXXXXXXXXHAKPMIESILLGNIPGLLKALVYQYNKLPEFNGCHTWYTFRTHYHGT 212
                             +     +G         ++ Y+++ E+N  +     R      
Sbjct: 228  LEEYLYAAQSNIKSKIAIAIQSTIGKHMNFFTMTLHLYDRVTEYNQSY----LRYEITDD 283

Query: 213  QEIFHKFFIALTDKFTASKEIMPELEGWFVEGPVSR---DSGCIKPITGDDYTSSAAIDD 269
            +    +F  +L D       ++ E E +     +      SG I  +   D +S+    D
Sbjct: 284  ENALCQFDESLLD-------VLLEFERYVTTDDIEAILLQSGRINKVK--DISSAIERGD 334

Query: 270  FNEDYWT--------QQKTNTQEQVYSFELNEDGTLEIPNVFAHTKRRHDALYKVLGLND 321
            +  +  T         +  N +E + SF++NE+G  E+PN+   +  RH  L++ LGL+ 
Sbjct: 335  YKWEQGTLRSLTPNNHKADNEEEVILSFDINENGLQEVPNIMKDSMLRHSILFEFLGLSQ 394

Query: 322  DPT--PLLKSCFLTFCCLADPVTQPPPNDKHIVSLDLLSDMFLGLMYPEITADLVQPLNK 379
              T  P L+  F T   L DP+TQP PND HI+S+DLL  ++ GL++P +     +  N 
Sbjct: 395  RNTLAPYLEMQFKTLAGLVDPLTQPTPNDTHIISIDLLHGLYTGLVHPALIKS-GKARNY 453

Query: 380  DTWTLHICFNLQKIINATLSRLNCDDFTRLNEINNSDDSVDWRKNLYKWLPQGLNTQDLE 439
            D W     FNL KI+  +L +L+C  +  LN I N ++  DWR+ L  W+P+ LNTQDLE
Sbjct: 454  D-WKYLCGFNLIKIVWKSLKKLHCSSYDTLNNIGNFEEGNDWRQTLEYWIPKNLNTQDLE 512

Query: 440  LIYMVDILATYTIYKLYSNRPIQMNPFLLPMISLWKNLTCVVLLGLEIDRLEEEQETFNT 499
            L+YM+DIL+ Y IYKLY ++PIQ NPFL  + S+WK +T ++ LGL++DR+EE+ ++  T
Sbjct: 513  LLYMIDILSVYAIYKLYEDQPIQNNPFLFELFSVWKYITKIIFLGLQVDRIEEQNDSEET 572

Query: 500  PVMVRATIRGASALRSVLATIINGHARYKSHDFKHEPINLFMSPHGRKLCNGALYADLRS 559
            P+M+RAT+RGASA R+ L TI+N       HDFKHEPIN FMSPHGRKLC+G+LYAD+R 
Sbjct: 573  PLMIRATVRGASAFRAALTTILNRQIENNEHDFKHEPINTFMSPHGRKLCSGSLYADMRV 632

Query: 560  HAATMLALGIXXXXXXXXXXXXQPGDRFDEDVKYMFDYEFDDYNEVDTELMADDELEDIE 619
                 +  G+            QPGDRFDEDV+YMFDYE++DYN     L++D E  D +
Sbjct: 633  STKIFVENGVELDDITNLLTDLQPGDRFDEDVEYMFDYEYEDYN-----LVSDSEDMDEK 687

Query: 620  SRERIKEVR--GYYKRCHCVFDDDSLVPENXXXXXXXXXXXXTKKHLQDSHEDQLPPQQN 677
            +      VR    ++RC+CVF+DD ++ E+            T   L+++          
Sbjct: 688  ADNESDGVRPAPIFRRCNCVFEDDKIMDES----TIDHQSLITDMELENNAISTKDENDK 743

Query: 678  VVMSTTSKPLAVRSRDTVEFDFNGRDWRDIPRGLNFYYTDAYIFVTKLHADVVHYLMKEA 737
            + + +  +P  VR R   +F++ G+DWRDIPRG N YY   ++FV +  +        +A
Sbjct: 744  IKIISQPEPFTVRMRSFFDFNYGGKDWRDIPRGENLYYNGEFVFVQECSSSEFASYFSKA 803

Query: 738  TRKKLERNHASFILRSIATCVKLEQEEAIVRRA-----LGNQDGDKSSNATTIKTENELT 792
                L+ + ++ +++ +A+C++ EQ+  ++        L N D +KS          +LT
Sbjct: 804  VNSVLDISESNRLIQLVASCIREEQDRMVIYHGMSQLPLANGDVNKS----------KLT 853

Query: 793  SDFIYEKWCEDSLFEKMMYHNSDLVWRMMDEMLMCSGYRRVLIWFITHLEINHSVIHYIF 852
             D IY++    + F KM+Y +++L   +MDE+LM  GYRRVLIWF+TH+ I   +IHYIF
Sbjct: 854  VDEIYDQISSSNNFAKMLYQDTELACGLMDELLMIVGYRRVLIWFLTHINITFPLIHYIF 913

Query: 853  ELVMGLRGNITYEDDEEKSKNLDALDGLAQGSSTSELTLPFSRQGPIILSSIEVNMLLQE 912
            ELVMG R  + + D +    N        + SST +    FSR G + LSSIE  MLLQE
Sbjct: 914  ELVMGYR--VGFSDGDANGDN-------NKKSSTGKCG--FSRLGTVALSSIEKQMLLQE 962

Query: 913  FFTNAAIFFSSKLRXXXXXXXXXXXXXXXXXXXXXVPPHVIGLMKLVCFMVDTLMQKKKF 972
            FF NA +  S+K                       +  + +G++ L+C MV TL++  + 
Sbjct: 963  FFLNATVSLSAK-SFESNGTEIDNYDDNADEDNEYISSYAVGIVTLICNMVKTLVRAGQM 1021

Query: 973  DFTDSEYIFELQTLLMNWIGIVPEARDLFFKLKSQIVATSQDTQEQGTPVKESE---KDD 1029
            D + SEY  ELQTLL+NWI ++PEA++LFF LK +  A   D Q+   P+ ESE     +
Sbjct: 1022 DVSKSEYTVELQTLLVNWISLIPEAKELFFFLKQE--AHEFDIQDSLEPINESELQTSGN 1079

Query: 1030 IDAP---DTLEMNDTMSEHNKKLMMLIPPGTTNERNALTALRGFIGKYSLTN-KTAVFGR 1085
            I+ P   D++ ++DT+   N  L       +T   NA  AL  F+     T+ +    GR
Sbjct: 1080 INEPAATDSIPLDDTI---NTSLT-----SSTKNSNATDALSTFLETVEETSVQPPQIGR 1131

Query: 1086 KIIYQDDEIMGM 1097
            K+IY+  +I+ +
Sbjct: 1132 KVIYKGTKILPL 1143

>TPHA0A05680 Chr1 (1285934..1289158) [3225 bp, 1074 aa] {ON} Anc_3.497
            YGR134W
          Length = 1074

 Score =  560 bits (1442), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/817 (40%), Positives = 465/817 (56%), Gaps = 56/817 (6%)

Query: 306  TKRRHDALYKVL------GLNDDPTPLLKSCFLTFCCLADPVTQPPPNDKHIVSLDLLSD 359
            T+RR + LYKVL       +  +   L+   F   C L DP+TQP PND+H++SLDLL  
Sbjct: 285  TERRQNILYKVLIFSKLKQIEPESFQLMSLLFNRICALVDPLTQPIPNDEHVISLDLLYK 344

Query: 360  MFLGLMYPEITADLVQPLNKDTWTLHICFNLQKIINATLSRLNCDDFTRLNEINNSDDSV 419
            +FL +M P +   L++  +   W   I  NLQKI+      LNC D  +LN++   D++ 
Sbjct: 345  IFLAMMLPHVQV-LIERESSYDWRYEISNNLQKILFYAFLNLNCYDMEKLNKV---DETK 400

Query: 420  DWRKNLYKWLPQGLNTQDLELIYMVDILATYTIYKLYSNRPIQMNPFLLPMISLWKNLTC 479
             W++ L+ WLP GLN Q+LEL+YM+ I   Y I+KLY ++P+  NPFL  ++S WK LT 
Sbjct: 401  HWKEQLHLWLPHGLNPQNLELLYMICIFCVYAIFKLYEDKPLHFNPFLPTLLSTWKKLTY 460

Query: 480  VVLLGLEIDRLEEEQETFNTPVMVRATIRGASALRSVLATIINGHARYKSHDFKHEPINL 539
            V+L GL++DR EEE E+FNTP+MVRATIRGASALRSV+A+I+N     K HDF+HEP+N 
Sbjct: 461  VMLYGLQVDRFEEENESFNTPIMVRATIRGASALRSVVASILNNQMDGKKHDFQHEPLNT 520

Query: 540  FMSPHGRKLCNGALYADLRSHAATMLALGIXXXXXXXXXXXXQPGDRFDEDVKYMFDYEF 599
            FMSPHGRKLC GALYADL+S+ A+MLA G+            QPGD FDEDVKYMF+YE+
Sbjct: 521  FMSPHGRKLCTGALYADLKSYTASMLACGMEFKDITELLSYLQPGDCFDEDVKYMFEYEY 580

Query: 600  DDYNEVDTELMADDELEDIESRERIKEVRGYYKRCHCVFDDDSLVPENXXXXXXXXXXXX 659
            DDYNE + +   +D   +  S E IK      +RC CVF DD  V E+            
Sbjct: 581  DDYNEPEEDESDEDGERN-NSEENIK-FNFNRRRCRCVFSDDD-VLEHGDFNDANSEYSN 637

Query: 660  TKKHLQDSHEDQLPPQQNVVMSTTSKPLAVRSRDTVEFDFNGRDWRDIPRGLNFYYTDAY 719
            ++++  D     LP           KP     ++ VEFDF+G+DWR +PR LN +Y+  Y
Sbjct: 638  SEENSNDVDNFVLPND------GIDKP-----KNGVEFDFDGKDWRAVPRHLNMFYSFDY 686

Query: 720  IFVTKLHADVVHYLMKEATRKKLERNHASFILRSIATCVKLEQEEAIV--RRALGNQDGD 777
            IF+      ++  L+ EA+   L +  +  +LR+IA+ +K+ Q+  I+  +R+    D  
Sbjct: 687  IFIENPLEVLIRSLISEASASALSKKKSHLLLRNIASVIKINQDSRILGSKRSPNGTDSS 746

Query: 778  KSSNATTIKTENELTSDFIYEKWCEDSLFEKMMYHNSDLVWRMMDEMLMCSGYRRVLIWF 837
            KS N  +       T D I      D+ FE ++  N +L   +MDE+LM  GYRRVL+WF
Sbjct: 747  KSQNGLS-------TGDLIKLITAGDT-FENILKFNRELGCFLMDELLMILGYRRVLLWF 798

Query: 838  ITHLEINHSVIHYIFELVMGLRGNITYEDDEEKSKNLDALDGLAQGSSTSELTLPFSRQG 897
            +THL ++H++I+YIFEL+M  RG ++   D E+ +              SEL+  FSRQG
Sbjct: 799  LTHLTLSHTIIYYIFELLMHHRGQVS---DTEREQ--------------SELSYTFSRQG 841

Query: 898  PIILSSIEVNMLLQEFFTNAAIFFSSK-LRXXXXXXXXXXXXXXXXXXXXXVPPHVIGLM 956
             + LS +E  MLLQEFFTNA +FFSSK +                         + +GLM
Sbjct: 842  ELRLSDLEREMLLQEFFTNATMFFSSKSVLFASDTGDNNEINTDVDGEEGLYSLYAVGLM 901

Query: 957  KLVCFMVDTLMQKKKFDFTDSEYIFELQTLLMNWIGIVPEARDLFFKLKSQIVATSQDTQ 1016
            ++ C M+ +L     FD + SE IFELQTLLM WI I+PEA+ LFFKLK  + + +    
Sbjct: 902  RVTCIMIISLFDNADFDLSSSESIFELQTLLMGWINIIPEAKLLFFKLKESVKSFNGIDN 961

Query: 1017 EQGTPVKESEKDDIDAPDTLEMNDTMSEHNKKLMMLIPPGTTNERN--ALTALRGFIGKY 1074
             +   ++ES         T++ N      NKKL+   P   + +     L   + F+  Y
Sbjct: 962  PELKSIEESST--TTKKTTIDENSEQYRFNKKLLKTFPKSFSGDDGDILLKTFKDFLRNY 1019

Query: 1075 SLTNKTAVFGRKIIYQDDEIMGMYMTDKEMMYREFLA 1111
            S  ++    GRK+IY+ DEI+ +   +K +   +FL+
Sbjct: 1020 SFDSEPPYIGRKVIYESDEILQLTDIEKPISLHKFLS 1056

>KLLA0E03961g Chr5 complement(358995..362393) [3399 bp, 1132 aa] {ON}
            weakly similar to uniprot|P53280 Saccharomyces cerevisiae
            YGR134W CAF130 Part of the evolutionarily- conserved
            CCR4-NOT transcriptional regulatory complex involved in
            controlling mRNA initiation elongation and degradation
          Length = 1132

 Score =  493 bits (1269), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 356/1144 (31%), Positives = 557/1144 (48%), Gaps = 115/1144 (10%)

Query: 46   DAVVQEMLILSLFVTLPGHSILELYYDLSCGRVDLSSYKQWQHSQVRSTDGY-KKLVKRW 104
            ++V+ E L+++LF T+PG +++    + +    D+   +      +R  D Y   L   W
Sbjct: 20   ESVLLEKLVIALFTTVPGQAVVTQLINDAKRTNDVDGVE----CLIRMNDPYWVALFGTW 75

Query: 105  STSTXXXXXXXXXXXQNKNVPLEYTKHNTAEYKLSLIFLLDKQN-EFXXXXXXXXXXXXX 163
            +T             +N+   ++  +++   +K+++ FLL  Q+ +F             
Sbjct: 76   ATDKHILSLFLGWVLRNETDHIDLERYSDQSFKMAMRFLLTNQDPKFTAPLWDTSNILLD 135

Query: 164  XXH-AKPMIESILLGNIPGLLKALVYQYNKLPEFNGCHTWYT---FRTHYHGTQEIFHKF 219
              H AKP+IES+L           + +YN+L EFNG + W+T     +H      I  + 
Sbjct: 136  YLHNAKPLIESVLKKLDGSQFLQCLMKYNRLYEFNGSYQWFTPPQSTSHAESPTTILERN 195

Query: 220  FIALTDKFTASKEIMPELEGWFVEGPVSRDSGCIKPITGDDYTSSAAIDDFNEDYWTQQK 279
               L+       +++  L            +G I+  + + Y  ++  +  N     Q  
Sbjct: 196  STFLSTLGNFGNDMVRALS--------QLKTGDIRLNSLESYGKNSGHN--NPPLSKQDD 245

Query: 280  TNTQEQVYSFELNEDGTLEIPNVFAHTKRRHDALYKVLGLNDDPTPLLKSCFLTFCCLAD 339
             N         LN +G  +  N+F             LGL+ +P PLL   F + C  AD
Sbjct: 246  HNP--------LNLNGKSDRFNLFFK-----------LGLHKEPHPLLAEQFNSLCLFAD 286

Query: 340  PVTQPPPNDKHIVSLDLLSDMFLGLMYPEITADLVQ--PLNKDTWTLHICFNLQKIINAT 397
            P+TQPPPND HI+SLDLL D++LG     +TA +V+  P  +  W +H+  NL+ I  A 
Sbjct: 287  PMTQPPPNDSHIISLDLLHDLYLG----SLTAYIVKLIPNYQKVWKIHLSANLETITLAI 342

Query: 398  LSRLNCDDFTRLNEINN----SDDSVDWRKNLYKWLPQGLNTQDLELIYMVDILATYTIY 453
            L  L   D+  L+ + +    S D+  + K +  W+P  L+  ++E++YM+  L+ Y+++
Sbjct: 343  LQMLQIWDYRSLDNLKDIQARSPDA--YPKYMTSWIPYDLSPPEMEILYMIAGLSFYSMH 400

Query: 454  KLYSNRPIQMNPFLLPMISLWKNLTCVVLLGLEIDRLEEEQETFNTPVMVRATIRGASAL 513
            K++S++P ++NPFL  M+  W+ L+  ++LGL+IDR EE Q  + TPV+V A IRGASAL
Sbjct: 401  KMHSDKPPRLNPFLPMMLRAWRGLSSALVLGLQIDRFEEMQMLYGTPVIVSAVIRGASAL 460

Query: 514  RSVLATIINGHARYKSHDFKHEPINLFMSPHGRKLCNGALYADLRSHAATMLALGIXXXX 573
            RS++ATI+NGH   K HDFKH+P   FMSPHGRKLCNGALY     + A +L  G+    
Sbjct: 461  RSIIATILNGHVDEKLHDFKHQPFGGFMSPHGRKLCNGALYTYEMYYFAALLPSGMDYDE 520

Query: 574  XXXXXXXXQPGDRFDEDVKYMFDYEFDDYNEVDTELMADDEL------EDIESRERIKEV 627
                    Q GDR DEDV+YMFDYE+ DYN+ DT  + D +L       ++E + R + +
Sbjct: 521  IVELLTDIQKGDRIDEDVRYMFDYEYFDYNDADTSKLTDGKLMFTSTKNELEQKNRFRML 580

Query: 628  RGYYKRCHCVFDDDSLVPENXXXXXXXXXXXXTKKHLQDSHEDQLPPQQNVVMSTTSKPL 687
            RG YKRC C F D+    ++                  D +      +     S +S  +
Sbjct: 581  RGLYKRCLCKFSDEDDNDDDDDDDDDDDYNGEKSVVGLDENGQINEAETPQTFSESSNAV 640

Query: 688  AVRS----RD---------TVEFDFNGRDWRDIPRGLNFYYTDAYIFVTKLHADVVHYLM 734
            A  S    RD         T  +D NG DWRDIPRGLN YY D Y F++KL    +  L+
Sbjct: 641  AFTSLMTHRDSQNDFVSHLTTGYDKNGDDWRDIPRGLNLYYMDDYQFLSKLDKVSLFELL 700

Query: 735  KEATRKKLERNHASFILRSIATCVKLEQEEAIVRRALGNQDGDKSSNATTIKTENELTSD 794
            +    + +  + A  +LRSIATCVKLEQE+ +++          +S    +K     T +
Sbjct: 701  RRLPDRNVTFSQACTVLRSIATCVKLEQEQILLKLITA------TSAEVDLKVLPFSTDE 754

Query: 795  FIYEKWCEDSLFEKMMYH---NSDLVWRMMDEMLMCSGYRRVLIWFITHLEINHSVIHYI 851
             I   + +D    K       N  L W++ DE++M  G+RR+LI+ +TH     S IHY+
Sbjct: 755  VITAIFNDDGGIIKPFPFSGCNDSLGWKIFDELMMSHGHRRLLIYHLTHRSYTFSSIHYV 814

Query: 852  FELVMGLRGNI--TYEDDEEKSKNLDALDGLAQGSSTSELTLPFSRQGPIILSSIEVNML 909
            +EL+ GLRGN   +Y+ +  K+K L  L     G       + FSRQG I LS+IE  ML
Sbjct: 815  YELLFGLRGNPARSYDLESTKNKQLGILSWTPTGEFERVAAIEFSRQGVIELSAIEKKML 874

Query: 910  LQEFFT----------NAAIFFSSKLRXXXXXXXXXXXXXXXXXXXXXVPPHVIGLMKLV 959
            LQEFF           N A F +  ++                         + G +K+V
Sbjct: 875  LQEFFVGVSSGLLGEYNDAGFEAFSIKNPSKVYVDDYGEEFFSATSRKA--EMSGKVKMV 932

Query: 960  CFMVDTLMQKKKFDFTDSE-YIFELQTLLMNWIGIVPEARDLFFKLKSQIVATSQDTQEQ 1018
            CF+++ ++  K+F+F   E Y++EL+  LM W     EA  ++  LKS+ +    D   +
Sbjct: 933  CFILEEVLNDKEFEFVPHEDYVYELKRFLMQWSTFSAEACSMYALLKSKALGKVLDLGTE 992

Query: 1019 G-------------TPV-----KESEKD---DIDAPDTLEMNDTMSEHNKKLMMLIPPGT 1057
            G              PV     K S+ D   D +   ++E  D  S  +++   ++P  +
Sbjct: 993  GLDDRPNTDPDDQLLPVDFDKLKLSDIDDRWDTETDTSIENGDKTSIMSERFSRMLPVQS 1052

Query: 1058 TNERNALTALRGFIGKYSLTNKTAVFGRKIIYQDDEIMGMYMTDKEMMYREFLAEFGIDY 1117
             + +      R  + KY LT  T + GR  +   D I+ + +   + ++REFLA F IDY
Sbjct: 1053 LDGQPVDKVFRHLLQKYPLTEGTPIHGRITLEYHDHILPLDIRTHQSLHREFLAVFDIDY 1112

Query: 1118 NDIV 1121
             DI+
Sbjct: 1113 LDIL 1116

>NDAI0J02350 Chr10 complement(575858..577852) [1995 bp, 664 aa] {ON}
            Anc_4.264 YLR401C
          Length = 664

 Score = 36.2 bits (82), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 41/91 (45%), Gaps = 4/91 (4%)

Query: 963  VDTLMQKKKFDFTDSEYIFELQTLLMNWI-GIVPEARDLFFKLKSQIVATSQDTQEQGTP 1021
            V+ +    KFD     + FE    ++N I  I  E RD+    K+Q +   +D QE+ T 
Sbjct: 182  VNVISYDAKFDLIKRRFKFEKSDHVLNIIDAIQQENRDVMKPEKTQPIHDDKDEQEEET- 240

Query: 1022 VKESEKDDIDAPDTLEMNDTMSEHNKKLMML 1052
                EK++  AP  L+    + EH  K   L
Sbjct: 241  --NGEKNERVAPQVLQREKELEEHRNKQKEL 269

>ZYRO0G13684g Chr7 (1092969..1097843) [4875 bp, 1624 aa] {ON}
           similar to uniprot|P52593 Saccharomyces cerevisiae
           YML103C NUP188 Subunit of the nuclear pore complex (NPC)
          Length = 1624

 Score = 35.8 bits (81), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 29/97 (29%), Positives = 50/97 (51%), Gaps = 13/97 (13%)

Query: 367 PEITADLVQPLNKDTWTLHICFNLQKIINATLSRLNCDDFTRLNEINNSDDSVDWRKNLY 426
           P I +D V  +  + +T  IC NL  I+  TLS+++ D    ++E+ +     +W++   
Sbjct: 143 PVIQSDFVSIIATNNFT--ICENLISILQNTLSKIDAD----ISEVTDELTGREWQE--- 193

Query: 427 KWLPQGLNTQDLELIYMVDILATYTIYKLYSNRPIQM 463
             L Q   +QD  LI++ +IL T T   L +N P  +
Sbjct: 194 --LWQLKKSQD--LIFVTNILRTLTYLTLNTNTPTHI 226

>SAKL0G07458g Chr7 complement(609418..620595) [11178 bp, 3725 aa] {ON}
            highly similar to uniprot|P38811 Saccharomyces cerevisiae
            YHR099W TRA1 Histone acetyltransferase component putative
            ortholog of human TRRAP which is an essential cofactor of
            c-Myc
          Length = 3725

 Score = 33.5 bits (75), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 31/122 (25%), Positives = 54/122 (44%), Gaps = 13/122 (10%)

Query: 741  KLERNHASFILRSIATCVKLEQEEAIVRRALGNQDGDKSSNATTIKTENELTSDFIYEKW 800
            KL     +FI  +I T   + Q  + +  AL     DK  +A+    +N + S FIYE +
Sbjct: 1744 KLSHPFHNFIYDNIVTSNDMGQRNSYMMSALVFSTSDKPLDASVFVLKNIVNSTFIYEGF 1803

Query: 801  CEDSLFEKMMYHNS------------DLVWRMMDEMLMCSGYRRVLIWFITHLEINHSVI 848
               SL E M+  N             D +WR  +E+L+ +   R  ++    L+++  +I
Sbjct: 1804 KSGSL-ENMIESNEANKLPEWLEFIRDKIWRGSNEVLVSNVAGRYDVFRFELLQLSAILI 1862

Query: 849  HY 850
             +
Sbjct: 1863 KW 1864

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.136    0.409 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 119,770,042
Number of extensions: 5321454
Number of successful extensions: 15843
Number of sequences better than 10.0: 29
Number of HSP's gapped: 16020
Number of HSP's successfully gapped: 44
Length of query: 1132
Length of database: 53,481,399
Length adjustment: 120
Effective length of query: 1012
Effective length of database: 39,721,479
Effective search space: 40198136748
Effective search space used: 40198136748
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 71 (32.0 bits)