Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0F02574gna 1ON28928915560.0
Kwal_47.18893na 1ON2892869881e-135
KLTH0G02420gna 1ON2892889841e-134
ABL209Cna 2ON3102747213e-94
ZYRO0G17600g7.468ON2832686862e-89
TDEL0C033207.468ON2832686838e-89
KAFR0G009207.468ON2862756699e-87
KNAG0D013707.468ON2822686654e-86
KLTH0G05786g7.468ON2862836568e-85
Smik_10.3847.468ON2822686542e-84
NCAS0H005607.468ON2842686509e-84
Suva_12.1847.468ON2822686437e-83
KLLA0F03256g7.468ON2852816403e-82
Kwal_47.182197.468ON2932836395e-82
YJR096W7.468ON2822686369e-82
SAKL0F14278g7.468ON2862696352e-81
Skud_10.3187.468ON2822686307e-81
Kpol_1013.827.468ON2852686291e-80
Ecym_7160na 2ON2712636062e-77
CAGL0C04543g7.468ON2872796012e-76
Kwal_33.13276na 3ON3023005232e-64
KLTH0F01892gna 3ON3022985223e-64
NDAI0C016005.434ON3133134162e-48
NCAS0H020605.434ON3223114147e-48
SAKL0G02530g5.434ON3122914111e-47
Kpol_1062.295.434ON3112904023e-46
KNAG0C049105.434ON3133103972e-45
KLLA0B14707gsingletonON3102883962e-45
CAGL0A02816g5.434ON3103103935e-45
YOR120W (GCY1)5.434ON3123213928e-45
Smik_15.2985.434ON3123113892e-44
TBLA0A02825singletonON3112923893e-44
TDEL0D00230singletonON3123083883e-44
Kwal_47.18084na 4ON3092763858e-44
Suva_8.1735.434ON3123113805e-43
TBLA0A065105.434ON3123103806e-43
KLTH0E00220gsingletonON3063093797e-43
KLTH0A00528gsingletonON3063093797e-43
Skud_15.2835.434ON3123113781e-42
KLLA0D10109gsingletonON3092873771e-42
CAGL0I01100g5.434ON3103143772e-42
YDR368W (YPR1)5.434ON3122933744e-42
ZYRO0F10032g5.434ON3102903735e-42
KLTH0E15532gsingletonON3092883727e-42
Smik_4.6345.434ON3122893674e-41
Suva_2.5405.434ON3122933641e-40
Skud_4.6375.434ON3122913631e-40
KLTH0A03476gna 4ON3082873613e-40
KAFR0E03850singletonON3112873474e-38
SAKL0G01914g5.409ON3293053414e-37
SAKL0C10626gsingletonON3222933405e-37
TPHA0G00210singletonON3112773388e-37
AER401W5.434ON3132893388e-37
TDEL0E019105.434ON3112923352e-36
TBLA0A02835singletonON3112923342e-36
TDEL0E021505.409ON3293043301e-35
KAFR0E038405.434ON3103103291e-35
KLTH0F16060g5.434ON3092903273e-35
YHR104W (GRE3)5.409ON3273023266e-35
KLTH0F16610g5.409ON3293053241e-34
KLLA0E21627g5.409ON3293183241e-34
NDAI0B056705.434ON3183163231e-34
Smik_8.1825.409ON3273023241e-34
Suva_15.3005.409ON3272863223e-34
CAGL0I01122g5.409ON3262853205e-34
Kwal_55.215365.409ON3293113197e-34
NCAS0F033805.434ON3133123188e-34
NDAI0D016005.409ON3273153188e-34
TPHA0E017605.434ON3103093161e-33
TBLA0F01720singletonON3263153171e-33
KAFR0G013503.108ON3242953161e-33
Skud_8.1655.409ON3273023152e-33
KAFR0C05320singletonON3272903101e-32
Ecym_55085.409ON3262993073e-32
ACL107C5.409ON3543203069e-32
Kwal_55.214265.434ON3082903021e-31
TPHA0E018605.409ON3262853012e-31
TBLA0A00630singletonON3283162996e-31
KNAG0B03780singletonON3263182971e-30
TDEL0D051603.108ON3252792942e-30
SAKL0C09922g3.108ON3222792942e-30
ZYRO0A06336g5.409ON3272902934e-30
KAFR0B012007.285ON3152882915e-30
KLTH0G00638gna 5ON3132842863e-29
NDAI0A070003.108ON3203042854e-29
Suva_4.3983.108ON3443112857e-29
Kwal_56.226113.108ON3213052812e-28
NCAS0A066605.409ON3263152812e-28
KNAG0C041107.285ON3112862793e-28
Smik_2.289singletonON3442892803e-28
KLTH0C10010g3.108ON3212922794e-28
KLLA0F05775g7.285ON3092862784e-28
Kpol_1020.137.285ON3132852775e-28
Smik_4.1137.285ON3122872767e-28
Skud_2.2763.108ON3442922771e-27
Smik_2.2883.108ON3442892761e-27
NCAS0I024203.108ON3202772723e-27
ZYRO0B06138g3.108ON3283082716e-27
NCAS0A137407.285ON3092822662e-26
Skud_4.1317.285ON3122862662e-26
YBR149W (ARA1)3.108ON3442892672e-26
YDL124W7.285ON3122852653e-26
KNAG0K020703.108ON3232762653e-26
KLLA0F02728g3.108ON3302942611e-25
SAKL0F00704gna 5ON3152472565e-25
TDEL0D02790singletonON3292832489e-24
Kwal_47.19278na 5ON3142522471e-23
ZYRO0C09196g7.285ON3123032461e-23
NDAI0A023007.285ON3132872461e-23
ZYRO0E09614gna 5ON3082482442e-23
Kpol_381.8singletonON3092432443e-23
CAGL0J09394g7.285ON3112492321e-21
Kwal_33.13274singletonON108942164e-21
TBLA0F019807.285ON3022822275e-21
SAKL0F09746g7.285ON3122912232e-20
Ecym_32647.285ON3112412199e-20
TBLA0E05040singletonON3423091324e-08
NDAI0J00730singletonON3432961307e-08
KLTH0E01474gsingletonON3131941235e-07
TDEL0A08000singletonON3191991226e-07
TBLA0G00960singletonON3212991226e-07
Suva_12.272singletonON2651871163e-06
SAKL0E00286gsingletonON3383041173e-06
NDAI0C01480singletonON3432981164e-06
CAGL0E05192gsingletonON3452971067e-05
TBLA0G01120singletonON3432971067e-05
Suva_9.17singletonON3081791059e-05
Smik_3.208singletonON3443011059e-05
NCAS0J01740singletonON3453211051e-04
CAGL0E05214gsingletonON3463061041e-04
KLTH0A08052gsingletonON3383121041e-04
SAKL0C14058gsingletonON3151931022e-04
Kwal_47.16887singletonON3132161004e-04
KNAG0L01270singletonON3432241004e-04
NCAS0C019908.565ON343297995e-04
ABR094W2.604ON359143988e-04
NCAS0F04070singletonON344300970.001
SAKL0E00264gsingletonON315199970.001
NCAS0C02450singletonON343298960.001
TPHA0H00110singletonON345224960.002
KLLA0F19360gsingletonON344296950.002
Kpol_400.9singletonON341339940.003
KAFR0F03890singletonON319306930.003
CAGL0E05236gsingletonON344297930.003
NDAI0H02960singletonON344312920.004
ZYRO0D02816gsingletonON343296920.004
NCAS0D03150na 6ON338295920.005
Suva_4.1227.285ON206148870.010
NDAI0G01600singletonON344313870.017
Kpol_449.4singletonON341316850.036
KNAG0L01560singletonON340304840.037
KAFR0J00220singletonON343303840.042
NCAS0A03110singletonON344299840.047
KAFR0C04240singletonON343326830.051
NDAI0D00600singletonON327210830.054
SAKL0H09438g8.565ON342309830.059
NDAI0G04890singletonON343304810.098
KLTH0D02002g7.65ON24775790.12
Suva_16.2248.565ON342298800.13
AAR033W3.462ON341119780.21
Kwal_26.83772.604ON338131780.23
Skud_3.179singletonON344285750.50
KLTH0D08844g2.604ON340131750.59
Kpol_1013.232.604ON324262740.73
NDAI0A046103.462ON348261740.77
TDEL0C053003.393ON42683740.86
Smik_16.1498.565ON342289730.92
NDAI0I01760na 6ON339295721.1
Kwal_47.166964.370ON143043721.5
KLTH0G07304g5.261ON1672114721.7
KLTH0D13750g3.462ON338155711.7
YPL088W8.565ON342298684.0
Kwal_33.13275singletonOFF6769624.7
NCAS0I02160singletonON344313675.3
Skud_16.1958.565ON342298675.4
ZYRO0F04840gsingletonON379307676.1
Suva_2.2678.254ON67281676.2
TPHA0J015205.684ON36861666.5
TDEL0C06010singletonON344313658.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0F02574g
         (289 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0F02574g Chr6 complement(220827..221696) [870 bp, 289 aa] {O...   603   0.0  
Kwal_47.18893 s47 (1017098..1017967) [870 bp, 289 aa] {ON} YJR09...   385   e-135
KLTH0G02420g Chr7 complement(188767..189636) [870 bp, 289 aa] {O...   383   e-134
ABL209C Chr2 complement(11410..12342) [933 bp, 310 aa] {ON} Synt...   282   3e-94
ZYRO0G17600g Chr7 (1455426..1456277) [852 bp, 283 aa] {ON} highl...   268   2e-89
TDEL0C03320 Chr3 (591171..592022) [852 bp, 283 aa] {ON} Anc_7.46...   267   8e-89
KAFR0G00920 Chr7 complement(215664..216524) [861 bp, 286 aa] {ON...   262   9e-87
KNAG0D01370 Chr4 complement(230193..231041) [849 bp, 282 aa] {ON...   260   4e-86
KLTH0G05786g Chr7 complement(460135..460995) [861 bp, 286 aa] {O...   257   8e-85
Smik_10.384 Chr10 (600097..600945) [849 bp, 282 aa] {ON} YJR096W...   256   2e-84
NCAS0H00560 Chr8 complement(96020..96874) [855 bp, 284 aa] {ON} ...   254   9e-84
Suva_12.184 Chr12 (289608..290456) [849 bp, 282 aa] {ON} YJR096W...   252   7e-83
KLLA0F03256g Chr6 (306731..307588) [858 bp, 285 aa] {ON} highly ...   251   3e-82
Kwal_47.18219 s47 (737925..738806) [882 bp, 293 aa] {ON} YJR096W...   250   5e-82
YJR096W Chr10 (611195..612043) [849 bp, 282 aa] {ON} Putative xy...   249   9e-82
SAKL0F14278g Chr6 (1143922..1144782) [861 bp, 286 aa] {ON} highl...   249   2e-81
Skud_10.318 Chr10 (568560..569408) [849 bp, 282 aa] {ON} YJR096W...   247   7e-81
Kpol_1013.82 s1013 complement(200564..201421) [858 bp, 285 aa] {...   246   1e-80
Ecym_7160 Chr7 (334780..335595) [816 bp, 271 aa] {ON} similar to...   238   2e-77
CAGL0C04543g Chr3 (434137..435000) [864 bp, 287 aa] {ON} highly ...   236   2e-76
Kwal_33.13276 s33 (153537..154445) [909 bp, 302 aa] {ON} YDL124W...   206   2e-64
KLTH0F01892g Chr6 (149177..150085) [909 bp, 302 aa] {ON} similar...   205   3e-64
NDAI0C01600 Chr3 complement(342011..342952) [942 bp, 313 aa] {ON...   164   2e-48
NCAS0H02060 Chr8 (400615..401583) [969 bp, 322 aa] {ON} Anc_5.434     164   7e-48
SAKL0G02530g Chr7 (208952..209890) [939 bp, 312 aa] {ON} similar...   162   1e-47
Kpol_1062.29 s1062 complement(63895..64830) [936 bp, 311 aa] {ON...   159   3e-46
KNAG0C04910 Chr3 complement(949367..950308) [942 bp, 313 aa] {ON...   157   2e-45
KLLA0B14707g Chr2 complement(1291951..1292883) [933 bp, 310 aa] ...   157   2e-45
CAGL0A02816g Chr1 (296851..297783) [933 bp, 310 aa] {ON} highly ...   155   5e-45
YOR120W Chr15 (551114..552052) [939 bp, 312 aa] {ON}  GCY1Putati...   155   8e-45
Smik_15.298 Chr15 (512239..513177) [939 bp, 312 aa] {ON} YOR120W...   154   2e-44
TBLA0A02825 Chr1 complement(681691..682626) [936 bp, 311 aa] {ON}     154   3e-44
TDEL0D00230 Chr4 (37458..38396) [939 bp, 312 aa] {ON}  possible ...   154   3e-44
Kwal_47.18084 s47 complement(677816..678745) [930 bp, 309 aa] {O...   152   8e-44
Suva_8.173 Chr8 (308911..309849) [939 bp, 312 aa] {ON} YOR120W (...   150   5e-43
TBLA0A06510 Chr1 complement(1597737..1598675) [939 bp, 312 aa] {...   150   6e-43
KLTH0E00220g Chr5 complement(12415..13335) [921 bp, 306 aa] {ON}...   150   7e-43
KLTH0A00528g Chr1 complement(46253..47173) [921 bp, 306 aa] {ON}...   150   7e-43
Skud_15.283 Chr15 (507542..508480) [939 bp, 312 aa] {ON} YOR120W...   150   1e-42
KLLA0D10109g Chr4 (854495..855424) [930 bp, 309 aa] {ON} similar...   149   1e-42
CAGL0I01100g Chr9 complement(91693..92625) [933 bp, 310 aa] {ON}...   149   2e-42
YDR368W Chr4 (1213904..1214842) [939 bp, 312 aa] {ON}  YPR1NADPH...   148   4e-42
ZYRO0F10032g Chr6 (813814..814746) [933 bp, 310 aa] {ON} uniprot...   148   5e-42
KLTH0E15532g Chr5 complement(1380466..1381395) [930 bp, 309 aa] ...   147   7e-42
Smik_4.634 Chr4 (1133924..1134862) [939 bp, 312 aa] {ON} YDR368W...   145   4e-41
Suva_2.540 Chr2 (964433..965371) [939 bp, 312 aa] {ON} YDR368W (...   144   1e-40
Skud_4.637 Chr4 (1136769..1137707) [939 bp, 312 aa] {ON} YDR368W...   144   1e-40
KLTH0A03476g Chr1 complement(298735..299661) [927 bp, 308 aa] {O...   143   3e-40
KAFR0E03850 Chr5 complement(764595..765530) [936 bp, 311 aa] {ON}     138   4e-38
SAKL0G01914g Chr7 (162612..163601) [990 bp, 329 aa] {ON} highly ...   135   4e-37
SAKL0C10626g Chr3 (962421..963389) [969 bp, 322 aa] {ON} similar...   135   5e-37
TPHA0G00210 Chr7 (31978..32913) [936 bp, 311 aa] {ON}                 134   8e-37
AER401W Chr5 (1406905..1407846) [942 bp, 313 aa] {ON} Syntenic h...   134   8e-37
TDEL0E01910 Chr5 complement(361621..362556) [936 bp, 311 aa] {ON...   133   2e-36
TBLA0A02835 Chr1 complement(683118..684053) [936 bp, 311 aa] {ON}     133   2e-36
TDEL0E02150 Chr5 complement(403001..403990) [990 bp, 329 aa] {ON...   131   1e-35
KAFR0E03840 Chr5 complement(763027..763959) [933 bp, 310 aa] {ON...   131   1e-35
KLTH0F16060g Chr6 complement(1304479..1305408) [930 bp, 309 aa] ...   130   3e-35
YHR104W Chr8 (323409..324392) [984 bp, 327 aa] {ON}  GRE3Aldose ...   130   6e-35
KLTH0F16610g Chr6 complement(1346319..1347308) [990 bp, 329 aa] ...   129   1e-34
KLLA0E21627g Chr5 complement(1929294..1930283) [990 bp, 329 aa] ...   129   1e-34
NDAI0B05670 Chr2 (1383187..1384143) [957 bp, 318 aa] {ON} Anc_5....   129   1e-34
Smik_8.182 Chr8 (299804..300787) [984 bp, 327 aa] {ON} YHR104W (...   129   1e-34
Suva_15.300 Chr15 (525715..526698) [984 bp, 327 aa] {ON} YHR104W...   128   3e-34
CAGL0I01122g Chr9 (93934..94914) [981 bp, 326 aa] {ON} highly si...   127   5e-34
Kwal_55.21536 s55 complement(877191..878180) [990 bp, 329 aa] {O...   127   7e-34
NCAS0F03380 Chr6 (682072..683013) [942 bp, 313 aa] {ON} Anc_5.434     127   8e-34
NDAI0D01600 Chr4 (382637..383620) [984 bp, 327 aa] {ON}               127   8e-34
TPHA0E01760 Chr5 complement(354862..355794) [933 bp, 310 aa] {ON...   126   1e-33
TBLA0F01720 Chr6 complement(430289..431269) [981 bp, 326 aa] {ON}     126   1e-33
KAFR0G01350 Chr7 (304389..305363) [975 bp, 324 aa] {ON} Anc_3.10...   126   1e-33
Skud_8.165 Chr8 (297201..298184) [984 bp, 327 aa] {ON} YHR104W (...   125   2e-33
KAFR0C05320 Chr3 complement(1065934..1066917) [984 bp, 327 aa] {...   124   1e-32
Ecym_5508 Chr5 (1035144..1036124) [981 bp, 326 aa] {ON} similar ...   122   3e-32
ACL107C Chr3 complement(152564..153628) [1065 bp, 354 aa] {ON} S...   122   9e-32
Kwal_55.21426 s55 complement(832981..833907) [927 bp, 308 aa] {O...   120   1e-31
TPHA0E01860 Chr5 complement(373074..374054) [981 bp, 326 aa] {ON...   120   2e-31
TBLA0A00630 Chr1 complement(126399..127385) [987 bp, 328 aa] {ON}     119   6e-31
KNAG0B03780 Chr2 (725307..726287) [981 bp, 326 aa] {ON}               119   1e-30
TDEL0D05160 Chr4 complement(935981..936958) [978 bp, 325 aa] {ON...   117   2e-30
SAKL0C09922g Chr3 (897779..898747) [969 bp, 322 aa] {ON} similar...   117   2e-30
ZYRO0A06336g Chr1 complement(505818..506801) [984 bp, 327 aa] {O...   117   4e-30
KAFR0B01200 Chr2 (224411..225358) [948 bp, 315 aa] {ON} Anc_7.28...   116   5e-30
KLTH0G00638g Chr7 (43280..44221) [942 bp, 313 aa] {ON} similar t...   114   3e-29
NDAI0A07000 Chr1 complement(1596632..1597594) [963 bp, 320 aa] {...   114   4e-29
Suva_4.398 Chr4 (709192..710226) [1035 bp, 344 aa] {ON} YBR149W ...   114   7e-29
Kwal_56.22611 s56 complement(202750..203715) [966 bp, 321 aa] {O...   112   2e-28
NCAS0A06660 Chr1 (1316398..1317378) [981 bp, 326 aa] {ON}             112   2e-28
KNAG0C04110 Chr3 (806389..807324) [936 bp, 311 aa] {ON} Anc_7.28...   112   3e-28
Smik_2.289 Chr2 (526189..527223) [1035 bp, 344 aa] {ON} YBR149W ...   112   3e-28
KLTH0C10010g Chr3 (829145..830110) [966 bp, 321 aa] {ON} similar...   112   4e-28
KLLA0F05775g Chr6 (560270..561199) [930 bp, 309 aa] {ON} highly ...   111   4e-28
Kpol_1020.13 s1020 (27790..28731) [942 bp, 313 aa] {ON} (27790.....   111   5e-28
Smik_4.113 Chr4 (216885..217823) [939 bp, 312 aa] {ON} YDL124W (...   110   7e-28
Skud_2.276 Chr2 (507436..508470) [1035 bp, 344 aa] {ON} YBR149W ...   111   1e-27
Smik_2.288 Chr2 (524564..525598) [1035 bp, 344 aa] {ON} YBR149W ...   110   1e-27
NCAS0I02420 Chr9 complement(454156..455118) [963 bp, 320 aa] {ON...   109   3e-27
ZYRO0B06138g Chr2 complement(491830..492816) [987 bp, 328 aa] {O...   108   6e-27
NCAS0A13740 Chr1 complement(2699208..2700137) [930 bp, 309 aa] {...   107   2e-26
Skud_4.131 Chr4 (235946..236884) [939 bp, 312 aa] {ON} YDL124W (...   107   2e-26
YBR149W Chr2 (539987..541021) [1035 bp, 344 aa] {ON}  ARA1NADP+ ...   107   2e-26
YDL124W Chr4 (240259..241197) [939 bp, 312 aa] {ON} NADPH-depend...   106   3e-26
KNAG0K02070 Chr11 complement(419556..420527) [972 bp, 323 aa] {O...   106   3e-26
KLLA0F02728g Chr6 (249240..250232) [993 bp, 330 aa] {ON} similar...   105   1e-25
SAKL0F00704g Chr6 (60941..61888) [948 bp, 315 aa] {ON} similar t...   103   5e-25
TDEL0D02790 Chr4 complement(533517..534506) [990 bp, 329 aa] {ON}     100   9e-24
Kwal_47.19278 s47 complement(1169418..1170362) [945 bp, 314 aa] ...   100   1e-23
ZYRO0C09196g Chr3 complement(698826..699764) [939 bp, 312 aa] {O...    99   1e-23
NDAI0A02300 Chr1 (516594..517535) [942 bp, 313 aa] {ON} Anc_7.285      99   1e-23
ZYRO0E09614g Chr5 complement(765913..766839) [927 bp, 308 aa] {O...    99   2e-23
Kpol_381.8 s381 complement(20844..21359,21366..21695,21698..2178...    99   3e-23
CAGL0J09394g Chr10 (925839..926774) [936 bp, 311 aa] {ON} simila...    94   1e-21
Kwal_33.13274 s33 (151643..151969) [327 bp, 108 aa] {ON} YJR096W...    88   4e-21
TBLA0F01980 Chr6 (493378..494286) [909 bp, 302 aa] {ON} Anc_7.28...    92   5e-21
SAKL0F09746g Chr6 complement(746292..747230) [939 bp, 312 aa] {O...    91   2e-20
Ecym_3264 Chr3 complement(503010..503945) [936 bp, 311 aa] {ON} ...    89   9e-20
TBLA0E05040 Chr5 (1303453..1304481) [1029 bp, 342 aa] {ON}             55   4e-08
NDAI0J00730 Chr10 complement(155561..156592) [1032 bp, 343 aa] {...    55   7e-08
KLTH0E01474g Chr5 complement(143734..144675) [942 bp, 313 aa] {O...    52   5e-07
TDEL0A08000 Chr1 (1399350..1400309) [960 bp, 319 aa] {ON}              52   6e-07
TBLA0G00960 Chr7 complement(244386..245351) [966 bp, 321 aa] {ON}      52   6e-07
Suva_12.272 Chr12 complement(441543..442262,442266..442340) [795...    49   3e-06
SAKL0E00286g Chr5 complement(13788..14804) [1017 bp, 338 aa] {ON...    50   3e-06
NDAI0C01480 Chr3 (312131..313162) [1032 bp, 343 aa] {ON}               49   4e-06
CAGL0E05192g Chr5 complement(506831..507868) [1038 bp, 345 aa] {...    45   7e-05
TBLA0G01120 Chr7 complement(285827..286858) [1032 bp, 343 aa] {O...    45   7e-05
Suva_9.17 Chr9 (18179..19105) [927 bp, 308 aa] {ON} YNL331C (REAL)     45   9e-05
Smik_3.208 Chr3 (305264..306298) [1035 bp, 344 aa] {ON} YPL088W ...    45   9e-05
NCAS0J01740 Chr10 complement(321825..322862) [1038 bp, 345 aa] {...    45   1e-04
CAGL0E05214g Chr5 complement(508275..509315) [1041 bp, 346 aa] {...    45   1e-04
KLTH0A08052g Chr1 complement(685177..686193) [1017 bp, 338 aa] {...    45   1e-04
SAKL0C14058g Chr3 (1248968..1249915) [948 bp, 315 aa] {ON} conse...    44   2e-04
Kwal_47.16887 s47 complement(158953..159894) [942 bp, 313 aa] {O...    43   4e-04
KNAG0L01270 Chr12 (230125..231156) [1032 bp, 343 aa] {ON}              43   4e-04
NCAS0C01990 Chr3 (365857..366888) [1032 bp, 343 aa] {ON} Anc_8.565     43   5e-04
ABR094W Chr2 (555932..557011) [1080 bp, 359 aa] {ON} Syntenic ho...    42   8e-04
NCAS0F04070 Chr6 complement(811712..812746) [1035 bp, 344 aa] {O...    42   0.001
SAKL0E00264g Chr5 complement(12234..13181) [948 bp, 315 aa] {ON}...    42   0.001
NCAS0C02450 Chr3 complement(455582..456613) [1032 bp, 343 aa] {O...    42   0.001
TPHA0H00110 Chr8 (10204..11241) [1038 bp, 345 aa] {ON}                 42   0.002
KLLA0F19360g Chr6 (1792778..1793812) [1035 bp, 344 aa] {ON} high...    41   0.002
Kpol_400.9 s400 complement(19154..20179) [1026 bp, 341 aa] {ON} ...    41   0.003
KAFR0F03890 Chr6 complement(761303..762262) [960 bp, 319 aa] {ON}      40   0.003
CAGL0E05236g Chr5 complement(509715..510749) [1035 bp, 344 aa] {...    40   0.003
NDAI0H02960 Chr8 (721089..722123) [1035 bp, 344 aa] {ON}               40   0.004
ZYRO0D02816g Chr4 (221712..222743) [1032 bp, 343 aa] {ON} simila...    40   0.004
NCAS0D03150 Chr4 complement(592701..593717) [1017 bp, 338 aa] {O...    40   0.005
Suva_4.122 Chr4 (228898..228945,228942..229163,229167..229517) [...    38   0.010
NDAI0G01600 Chr7 (349960..350994) [1035 bp, 344 aa] {ON}               38   0.017
Kpol_449.4 s449 (14334..15359) [1026 bp, 341 aa] {ON} (14334..15...    37   0.036
KNAG0L01560 Chr12 (276747..277769) [1023 bp, 340 aa] {ON}              37   0.037
KAFR0J00220 Chr10 complement(37107..38138) [1032 bp, 343 aa] {ON}      37   0.042
NCAS0A03110 Chr1 complement(609267..610301) [1035 bp, 344 aa] {O...    37   0.047
KAFR0C04240 Chr3 (842806..843837) [1032 bp, 343 aa] {ON}               37   0.051
NDAI0D00600 Chr4 (131820..132803) [984 bp, 327 aa] {ON}                37   0.054
SAKL0H09438g Chr8 (803426..804454) [1029 bp, 342 aa] {ON} highly...    37   0.059
NDAI0G04890 Chr7 (1178096..1179127) [1032 bp, 343 aa] {ON}             36   0.098
KLTH0D02002g Chr4 complement(196550..197293) [744 bp, 247 aa] {O...    35   0.12 
Suva_16.224 Chr16 (392092..393120) [1029 bp, 342 aa] {ON} YPL088...    35   0.13 
AAR033W Chr1 (401423..402448) [1026 bp, 341 aa] {ON} Syntenic ho...    35   0.21 
Kwal_26.8377 s26 (759190..760206) [1017 bp, 338 aa] {ON} YMR041C...    35   0.23 
Skud_3.179 Chr3 (292171..293205) [1035 bp, 344 aa] {ON} YPL088W ...    33   0.50 
KLTH0D08844g Chr4 (738727..739749) [1023 bp, 340 aa] {ON} simila...    33   0.59 
Kpol_1013.23 s1013 complement(54054..55028) [975 bp, 324 aa] {ON...    33   0.73 
NDAI0A04610 Chr1 complement(1035715..1036761) [1047 bp, 348 aa] ...    33   0.77 
TDEL0C05300 Chr3 complement(943838..945118) [1281 bp, 426 aa] {O...    33   0.86 
Smik_16.149 Chr16 (265088..266116) [1029 bp, 342 aa] {ON} YPL088...    33   0.92 
NDAI0I01760 Chr9 (413802..414821) [1020 bp, 339 aa] {ON}               32   1.1  
Kwal_47.16696 s47 complement(67984..72276) [4293 bp, 1430 aa] {O...    32   1.5  
KLTH0G07304g Chr7 (585983..591001) [5019 bp, 1672 aa] {ON} simil...    32   1.7  
KLTH0D13750g Chr4 complement(1120534..1121550) [1017 bp, 338 aa]...    32   1.7  
YPL088W Chr16 (381965..382993) [1029 bp, 342 aa] {ON} Putative a...    31   4.0  
Kwal_33.13275 s33 (152348..152551) [204 bp, 67 aa] {OFF} [contig...    28   4.7  
NCAS0I02160 Chr9 (407406..408440) [1035 bp, 344 aa] {ON}               30   5.3  
Skud_16.195 Chr16 (353315..354343) [1029 bp, 342 aa] {ON} YPL088...    30   5.4  
ZYRO0F04840g Chr6 (406288..407427) [1140 bp, 379 aa] {ON} highly...    30   6.1  
Suva_2.267 Chr2 complement(463458..465476) [2019 bp, 672 aa] {ON...    30   6.2  
TPHA0J01520 Chr10 complement(349327..350433) [1107 bp, 368 aa] {...    30   6.5  
TDEL0C06010 Chr3 complement(1082207..1083241) [1035 bp, 344 aa] ...    30   8.1  

>SAKL0F02574g Chr6 complement(220827..221696) [870 bp, 289 aa] {ON}
           similar to uniprot|P47137 Saccharomyces cerevisiae
           YJR096W
          Length = 289

 Score =  603 bits (1556), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/289 (100%), Positives = 289/289 (100%)

Query: 1   MRFTPGTTHALKNGVKMPCLGLGLYQTPKEETTNIVHNALKLGYRQVDSAQLYGNEREAC 60
           MRFTPGTTHALKNGVKMPCLGLGLYQTPKEETTNIVHNALKLGYRQVDSAQLYGNEREAC
Sbjct: 1   MRFTPGTTHALKNGVKMPCLGLGLYQTPKEETTNIVHNALKLGYRQVDSAQLYGNEREAC 60

Query: 61  LGITKFLEESPKVSRSDIFFTTKIKTQDQGYESAKKSIEESLNRVKELDYIDLFLIHAPL 120
           LGITKFLEESPKVSRSDIFFTTKIKTQDQGYESAKKSIEESLNRVKELDYIDLFLIHAPL
Sbjct: 61  LGITKFLEESPKVSRSDIFFTTKIKTQDQGYESAKKSIEESLNRVKELDYIDLFLIHAPL 120

Query: 121 TNKEKRLGTWKAFQEYYETGKIKAIGVSNYGIQHLEEMYQWDGLKIDPMVNQYELNPWLT 180
           TNKEKRLGTWKAFQEYYETGKIKAIGVSNYGIQHLEEMYQWDGLKIDPMVNQYELNPWLT
Sbjct: 121 TNKEKRLGTWKAFQEYYETGKIKAIGVSNYGIQHLEEMYQWDGLKIDPMVNQYELNPWLT 180

Query: 181 RKELSNYCHQKGMVIQAYSPLTRARRLQDPELVKLVEDSYPEQTSAQILVNWSLQMGFVP 240
           RKELSNYCHQKGMVIQAYSPLTRARRLQDPELVKLVEDSYPEQTSAQILVNWSLQMGFVP
Sbjct: 181 RKELSNYCHQKGMVIQAYSPLTRARRLQDPELVKLVEDSYPEQTSAQILVNWSLQMGFVP 240

Query: 241 LVKTVHEDRLKENIKSCDFELSSADLKKLTHDDQYYLSQPKWDPIKYEG 289
           LVKTVHEDRLKENIKSCDFELSSADLKKLTHDDQYYLSQPKWDPIKYEG
Sbjct: 241 LVKTVHEDRLKENIKSCDFELSSADLKKLTHDDQYYLSQPKWDPIKYEG 289

>Kwal_47.18893 s47 (1017098..1017967) [870 bp, 289 aa] {ON} YJR096W
           - Hypothetical ORF [contig 189] FULL
          Length = 289

 Score =  385 bits (988), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 176/286 (61%), Positives = 221/286 (77%)

Query: 1   MRFTPGTTHALKNGVKMPCLGLGLYQTPKEETTNIVHNALKLGYRQVDSAQLYGNEREAC 60
           M  TP TT  L NGVK+P L LG+Y+ PKEET + V  ALK GYR VD AQLYGNERE  
Sbjct: 1   MNLTPSTTKTLTNGVKIPVLALGVYEAPKEETEHTVFTALKSGYRHVDCAQLYGNEREVG 60

Query: 61  LGITKFLEESPKVSRSDIFFTTKIKTQDQGYESAKKSIEESLNRVKELDYIDLFLIHAPL 120
           LGI KFL+E+P VSRS+IF+TTK+   + GYE AKKSI +SL  VKE++YIDL LIH P+
Sbjct: 61  LGIAKFLKETPNVSRSEIFYTTKVSGDNHGYEKAKKSIIKSLEDVKEIEYIDLLLIHNPI 120

Query: 121 TNKEKRLGTWKAFQEYYETGKIKAIGVSNYGIQHLEEMYQWDGLKIDPMVNQYELNPWLT 180
              E+RLGTWKA QE Y  GK++AIGVSNY I+HLEE+Y W+GLK++PMVNQ+ELNPWLT
Sbjct: 121 AATEERLGTWKALQEAYAEGKVRAIGVSNYSIKHLEELYNWEGLKVEPMVNQFELNPWLT 180

Query: 181 RKELSNYCHQKGMVIQAYSPLTRARRLQDPELVKLVEDSYPEQTSAQILVNWSLQMGFVP 240
           RKEL  YC +KGMV++A+SPLTR ++  DP+L +L++ SYP QT AQIL+ WSLQMGF+P
Sbjct: 181 RKELCEYCEKKGMVLEAFSPLTRGQKFSDPQLQELIKTSYPNQTPAQILIRWSLQMGFIP 240

Query: 241 LVKTVHEDRLKENIKSCDFELSSADLKKLTHDDQYYLSQPKWDPIK 286
           L K+ +  R   N+++ DFE+S  D+K LTHDD Y+L+   +DPIK
Sbjct: 241 LPKSSNSKRQISNLQALDFEISDKDMKALTHDDTYFLATEDFDPIK 286

>KLTH0G02420g Chr7 complement(188767..189636) [870 bp, 289 aa] {ON}
           similar to uniprot|P47137 Saccharomyces cerevisiae
           YJR096W
          Length = 289

 Score =  383 bits (984), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 172/288 (59%), Positives = 224/288 (77%)

Query: 1   MRFTPGTTHALKNGVKMPCLGLGLYQTPKEETTNIVHNALKLGYRQVDSAQLYGNEREAC 60
           M  T  TT  L NGVK+P LG G Y+TPKE+  +IVH A K GYR VD+AQLY NERE  
Sbjct: 1   MSITASTTKTLTNGVKIPVLGFGTYETPKEKAESIVHAAFKQGYRHVDTAQLYENERECA 60

Query: 61  LGITKFLEESPKVSRSDIFFTTKIKTQDQGYESAKKSIEESLNRVKELDYIDLFLIHAPL 120
             + KFL+ESPKVSR  +F+TTK+   + GYE AKKSI ESL   KEL+Y+DLFLIH P 
Sbjct: 61  TAVAKFLKESPKVSRDQVFYTTKVAGDNHGYEKAKKSIIESLEMAKELEYVDLFLIHNPC 120

Query: 121 TNKEKRLGTWKAFQEYYETGKIKAIGVSNYGIQHLEEMYQWDGLKIDPMVNQYELNPWLT 180
              EKRLGT+KA QE+Y+ GKIKAIGVS+Y I+HLEE+Y W+GL++ PMVNQ+ELNPWLT
Sbjct: 121 AETEKRLGTYKALQEFYKAGKIKAIGVSSYSIKHLEELYSWEGLEVKPMVNQFELNPWLT 180

Query: 181 RKELSNYCHQKGMVIQAYSPLTRARRLQDPELVKLVEDSYPEQTSAQILVNWSLQMGFVP 240
           RK+L  YC ++ +VI+A+SP+TR++R  DP + KL+++SYP +T AQ+L+ WSLQMGFVP
Sbjct: 181 RKDLVKYCKERDLVIEAFSPITRSKRFSDPVVQKLLKESYPGRTPAQLLIRWSLQMGFVP 240

Query: 241 LVKTVHEDRLKENIKSCDFELSSADLKKLTHDDQYYLSQPKWDPIKYE 288
           L K+VHEDR + N+ + DFE+S+ D+K LTHD +++L+QP +DPI+ E
Sbjct: 241 LPKSVHEDRAESNLHALDFEISAEDMKTLTHDGEHFLAQPGFDPIETE 288

>ABL209C Chr2 complement(11410..12342) [933 bp, 310 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJR096W
          Length = 310

 Score =  282 bits (721), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 130/274 (47%), Positives = 187/274 (68%), Gaps = 2/274 (0%)

Query: 11  LKNGVKMPCLGLGLYQTPKEETTNIVHNALKLGYRQVDSAQLYGNEREACLGITKFLEES 70
           L +G ++P +GLG+YQ  ++   ++V+ AL++GYR  DSAQ Y NE     GI  +L+ +
Sbjct: 15  LSDGTQIPSVGLGVYQVSEQTVQDLVYEALEVGYRLFDSAQAYHNEDGVARGIAAWLKHA 74

Query: 71  PKVSRSDIFFTTKIKTQDQGYESAKKSIEESLNRVKELDYIDLFLIHAPLTNKEKRLGTW 130
           P   R D++FTTKI TQ+ GYE+ KKS+E+SL+    L YIDL L+HAP++++ +RLGTW
Sbjct: 75  PGRRREDVYFTTKINTQNHGYEATKKSLEKSLHAAGPLGYIDLVLVHAPMSDRTRRLGTW 134

Query: 131 KAFQEYYETGKIKAIGVSNYGIQHLEEMYQWDGLKIDPMVNQYELNPWLTRKELSNYCHQ 190
           +A +E    G++++IGVSNYG QHL E+  W+GLKI P+VNQ E+NPWL R+EL  YC +
Sbjct: 135 QALEEAVVEGQVRSIGVSNYGQQHLSELLGWEGLKIRPVVNQVEINPWLCRQELVQYCRE 194

Query: 191 KGMVIQAYSPLTRARRLQDPELVKLVEDSYPEQTSAQILVNWSLQMGFVPLVKTVHEDRL 250
             + +QA+SPL R +RL DP L K+      ++  AQILV WS+QMGF+ L K   ++RL
Sbjct: 195 NNIAVQAFSPLMRGKRLDDPILQKVAHQY--DKGVAQILVRWSIQMGFIVLPKAAKKERL 252

Query: 251 KENIKSCDFELSSADLKKLTHDDQYYLSQPKWDP 284
             N    DFELS+  + +LTH D Y+++ P   P
Sbjct: 253 APNFDIWDFELSAETMSELTHSDDYFVTVPGGIP 286

>ZYRO0G17600g Chr7 (1455426..1456277) [852 bp, 283 aa] {ON} highly
           similar to uniprot|P47137 Saccharomyces cerevisiae
           YJR096W
          Length = 283

 Score =  268 bits (686), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 126/268 (47%), Positives = 185/268 (69%), Gaps = 3/268 (1%)

Query: 9   HALKNGVKMPCLGLGLYQTPKEETTNIVHNALKLGYRQVDSAQLYGNEREACLGITKFLE 68
           + + NG+K+P L LG Y  P+ +T N+V+ ALK GYR  D+A LYGNE+E   GI K+L+
Sbjct: 7   YTMVNGIKIPSLALGCYDIPRSQTANVVYEALKRGYRHFDTAVLYGNEKEVGEGIYKWLK 66

Query: 69  ESPKVS-RSDIFFTTKIKTQDQGYESAKKSIEESLNRVKELDYIDLFLIHAPLTNKEKRL 127
           E P  + R D+F+TTK+     GY  AK+ I E +N+VKEL YIDL LIH+PL+   +RL
Sbjct: 67  EDPANNKREDVFYTTKLWNSQNGYSPAKRGISECMNKVKELGYIDLLLIHSPLSGPRRRL 126

Query: 128 GTWKAFQEYYETGKIKAIGVSNYGIQHLEEMYQWDGLKIDPMVNQYELNPWLTRKELSNY 187
            T++A QE  + G +K+IGVSNYG QH+EE+Y+WD LK  P+ NQ E++PW  R++L+++
Sbjct: 127 ETYQAMQEAVDDGIVKSIGVSNYGKQHIEELYKWDKLKHKPVANQIEISPWCMREDLTSW 186

Query: 188 CHQKGMVIQAYSPLTRARRLQDPELVKLVEDSYPEQTSAQILVNWSLQMGFVPLVKTVHE 247
           C  KG++++A+SPLT   +L++P LV L +     + + Q+L+ WSLQ G +PL KT + 
Sbjct: 187 CQSKGLIVEAFSPLTHGYKLKEPGLVSLAKKL--GRDTGQVLIRWSLQRGLLPLPKTQNP 244

Query: 248 DRLKENIKSCDFELSSADLKKLTHDDQY 275
            RL  N++  DFEL+  D+K+L H + Y
Sbjct: 245 ARLSSNLEVYDFELTPEDVKELDHPEAY 272

>TDEL0C03320 Chr3 (591171..592022) [852 bp, 283 aa] {ON} Anc_7.468
           YJR096W
          Length = 283

 Score =  267 bits (683), Expect = 8e-89,   Method: Compositional matrix adjust.
 Identities = 128/268 (47%), Positives = 185/268 (69%), Gaps = 3/268 (1%)

Query: 9   HALKNGVKMPCLGLGLYQTPKEETTNIVHNALKLGYRQVDSAQLYGNEREACLGITKFLE 68
           + L NGVK+P L LG Y  PK  T NIV+ ALK GYR  D+A LY NER+   GI ++L+
Sbjct: 7   YTLSNGVKIPSLALGTYDLPKSTTANIVYEALKCGYRHFDTAVLYNNERKVGEGIYQWLQ 66

Query: 69  ESPKVS-RSDIFFTTKIKTQDQGYESAKKSIEESLNRVKELDYIDLFLIHAPLTNKEKRL 127
           E PK + R D+F+TTK+     GY+ AK++I+E L +V++L YIDL LIH+PL+   KRL
Sbjct: 67  EDPKNNKREDVFYTTKLWNSQNGYQPAKQAIKECLQKVEKLGYIDLLLIHSPLSGSRKRL 126

Query: 128 GTWKAFQEYYETGKIKAIGVSNYGIQHLEEMYQWDGLKIDPMVNQYELNPWLTRKELSNY 187
            T+KA QE  + G +K+IGVSNYG  HLEE+  W+GLK  P+VNQ E++PW  R+EL+ +
Sbjct: 127 ETYKAMQEAVDEGIVKSIGVSNYGQHHLEELLSWEGLKYKPVVNQIEISPWCMRQELAQW 186

Query: 188 CHQKGMVIQAYSPLTRARRLQDPELVKLVEDSYPEQTSAQILVNWSLQMGFVPLVKTVHE 247
           C  +G+V++ Y+PLT   +L+DP+LVK+ E+    + + Q+L+ WSLQ G++PL KT + 
Sbjct: 187 CQSQGIVVEDYAPLTHGYKLKDPQLVKVAEEV--GKNTGQVLIRWSLQHGYLPLPKTSNV 244

Query: 248 DRLKENIKSCDFELSSADLKKLTHDDQY 275
           DRL  N+   DF+L+ + +K   H + +
Sbjct: 245 DRLPGNLDVYDFKLTESQIKAFEHPEAH 272

>KAFR0G00920 Chr7 complement(215664..216524) [861 bp, 286 aa] {ON}
           Anc_7.468 YJR096W
          Length = 286

 Score =  262 bits (669), Expect = 9e-87,   Method: Compositional matrix adjust.
 Identities = 121/275 (44%), Positives = 184/275 (66%)

Query: 1   MRFTPGTTHALKNGVKMPCLGLGLYQTPKEETTNIVHNALKLGYRQVDSAQLYGNEREAC 60
           M+ +   T+ L +   +P + LG Y  P  ETT IV NAL +GYR  D+A LY NE E  
Sbjct: 1   MKLSIQKTYKLSSNYYIPTVALGTYDLPSSETTEIVENALDVGYRHFDTAVLYDNEEEVA 60

Query: 61  LGITKFLEESPKVSRSDIFFTTKIKTQDQGYESAKKSIEESLNRVKELDYIDLFLIHAPL 120
            GI+ +L   P+  R +IF+TTK+     GY++AK++I E +++V++L YIDL L+H+P+
Sbjct: 61  QGISNWLIRHPETKRDEIFYTTKLWNSQFGYQNAKRAIRECVDKVQDLKYIDLLLMHSPI 120

Query: 121 TNKEKRLGTWKAFQEYYETGKIKAIGVSNYGIQHLEEMYQWDGLKIDPMVNQYELNPWLT 180
              + R  TW+A QE  + G +K+IGVSN+GI+HL+E++QWDGLK  P+VNQ E++PWL 
Sbjct: 121 GGPQIREETWRAMQEAVDEGIVKSIGVSNFGIKHLKELFQWDGLKYRPVVNQIEISPWLM 180

Query: 181 RKELSNYCHQKGMVIQAYSPLTRARRLQDPELVKLVEDSYPEQTSAQILVNWSLQMGFVP 240
           R+EL+++C  +G+V++AY+PLT   ++  P+L+K+  +    + + QIL+ WSLQ G+VP
Sbjct: 181 RQELADFCKMEGLVVEAYAPLTHGYKINHPDLIKISNELNNTKNTGQILIRWSLQHGYVP 240

Query: 241 LVKTVHEDRLKENIKSCDFELSSADLKKLTHDDQY 275
           L KT    RL+ N+   DFEL+   +K L H + Y
Sbjct: 241 LPKTKTIGRLESNLDVYDFELTEDQMKFLDHPEAY 275

>KNAG0D01370 Chr4 complement(230193..231041) [849 bp, 282 aa] {ON}
           Anc_7.468 YJR096W
          Length = 282

 Score =  260 bits (665), Expect = 4e-86,   Method: Compositional matrix adjust.
 Identities = 124/268 (46%), Positives = 178/268 (66%), Gaps = 2/268 (0%)

Query: 8   THALKNGVKMPCLGLGLYQTPKEETTNIVHNALKLGYRQVDSAQLYGNEREACLGITKFL 67
           ++ L +G  +P +GLG Y  P   TT IV  AL++GYR +D+A LYGNE E   G   FL
Sbjct: 6   SYKLASGFNIPTIGLGTYDLPPSNTTAIVEAALEVGYRHLDTAVLYGNEAEVAQGAMNFL 65

Query: 68  EESPKVSRSDIFFTTKIKTQDQGYESAKKSIEESLNRVKELDYIDLFLIHAPLTNKEKRL 127
              P VSR DIF+TTK+     GYE AK++I E +  +  L YIDL L+H+P+  K+ R 
Sbjct: 66  GRHPDVSREDIFYTTKLWNSQFGYEKAKRAIRECVECIGGLGYIDLLLMHSPIGGKQVRR 125

Query: 128 GTWKAFQEYYETGKIKAIGVSNYGIQHLEEMYQWDGLKIDPMVNQYELNPWLTRKELSNY 187
           GTWKA QE  + G +++IGVS+YG +HLE++++W  LK  P VNQ E++PW+ R++L++Y
Sbjct: 126 GTWKAMQEAVDDGLVRSIGVSSYGQRHLEDLFEWSELKHAPAVNQIEISPWIMRQQLADY 185

Query: 188 CHQKGMVIQAYSPLTRARRLQDPELVKLVEDSYPEQTSAQILVNWSLQMGFVPLVKTVHE 247
           C  KG+V++AYSPLT   +L DP+L+K+ E++   +   Q+L+ WSLQ G+VPL KT   
Sbjct: 186 CKSKGIVVEAYSPLTHGYKLDDPDLLKVAEET--GKNPGQVLLRWSLQHGYVPLPKTKTV 243

Query: 248 DRLKENIKSCDFELSSADLKKLTHDDQY 275
            RL+ N+   D+ELS   +K L H + Y
Sbjct: 244 SRLQLNLDVFDWELSPEHMKLLDHPEAY 271

>KLTH0G05786g Chr7 complement(460135..460995) [861 bp, 286 aa] {ON}
           highly similar to uniprot|P47137 Saccharomyces
           cerevisiae YJR096W
          Length = 286

 Score =  257 bits (656), Expect = 8e-85,   Method: Compositional matrix adjust.
 Identities = 123/283 (43%), Positives = 191/283 (67%), Gaps = 12/283 (4%)

Query: 8   THALKNGVKMPCLGLGLYQTPKEETTNIVHNALKLGYRQVDSAQLYGNEREACLGITKFL 67
            + L +G  +P LGLG Y  P+ ET  +V+ ALK GYR +D+A LYGNERE   G+ K+L
Sbjct: 9   AYKLSSGYVLPSLGLGTYDIPRAETAEVVYQALKAGYRHLDTAVLYGNEREVGEGVEKWL 68

Query: 68  EESPKVSRS-DIFFTTKIKTQDQGYESAKKSIEESLNRVKELDYIDLFLIHAPLTNKEKR 126
           +E PK  R  D+F+TTK+     GY +AK++I+E L++V+ L YID+ LIH+PL+   +R
Sbjct: 69  KEDPKNHRRHDVFYTTKLWNSQNGYSNAKRAIQECLDKVRPLGYIDMLLIHSPLSGTRRR 128

Query: 127 LGTWKAFQEYYETGKIKAIGVSNYGIQHLEEMYQWDGLKIDPMVNQYELNPWLTRKELSN 186
           L T+KA QE  + G +++IGVSNYG  H++E+  W+ LK  P+VNQ E++PW+ R++L++
Sbjct: 129 LETYKAMQEAVDAGIVRSIGVSNYGKHHIDELLAWEELKHKPVVNQIEISPWVMRQDLAD 188

Query: 187 YCHQKGMVIQAYSPLTRARRLQDPELVKLVEDSYPEQTSAQILVNWSLQMGFVPLVKTVH 246
           YC  KG+V++A+SPLT   +++ P +V++ E+    + + Q+L+ WSLQ G+VPL K+  
Sbjct: 189 YCKSKGLVVEAFSPLTHGYKIKHPNVVRVAEEV--GRNTGQVLIRWSLQHGYVPLPKSRS 246

Query: 247 EDRLKENIKSCDFELSSADLKKLTHDDQYYLSQPK-WDPIKYE 288
            +RLK N++  DFELS   +         +L QP+ ++P  +E
Sbjct: 247 VERLKGNLEVYDFELSPEQIT--------FLDQPQAYEPTDWE 281

>Smik_10.384 Chr10 (600097..600945) [849 bp, 282 aa] {ON} YJR096W
           (REAL)
          Length = 282

 Score =  256 bits (654), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 118/268 (44%), Positives = 181/268 (67%), Gaps = 3/268 (1%)

Query: 9   HALKNGVKMPCLGLGLYQTPKEETTNIVHNALKLGYRQVDSAQLYGNEREACLGITKFLE 68
           + L NG+K+P + LG Y+ P+ +T  IV+  +K GYR  D+A LYGNE+E   GIT++L 
Sbjct: 6   YKLSNGIKIPSIALGTYEIPRSQTAEIVYEGIKCGYRHFDTAVLYGNEKEVGDGITRWLN 65

Query: 69  ESPKVS-RSDIFFTTKIKTQDQGYESAKKSIEESLNRVKELDYIDLFLIHAPLTNKEKRL 127
           E PK + R+DIF+TTK+     GY  AK +I++ LN V  L+YIDL LIH+PL   + RL
Sbjct: 66  EDPKNNKRTDIFYTTKLWNSQNGYRKAKAAIQQCLNEVSGLEYIDLLLIHSPLEGSKLRL 125

Query: 128 GTWKAFQEYYETGKIKAIGVSNYGIQHLEEMYQWDGLKIDPMVNQYELNPWLTRKELSNY 187
            TW+A QE  + G +K+IGVSNYG +H++E+  W  L+  P+VNQ E++PW+ R+EL++Y
Sbjct: 126 ETWRAMQEAVDAGVVKSIGVSNYGRKHIDELLNWSELRHYPVVNQIEISPWIMRQELADY 185

Query: 188 CHQKGMVIQAYSPLTRARRLQDPELVKLVEDSYPEQTSAQILVNWSLQMGFVPLVKTVHE 247
           C  KG++++A++PL    ++ +P+L+ + ++   ++   Q+L+ WSLQ G++PL KT   
Sbjct: 186 CKSKGLIVEAFAPLCHGYKMTNPDLLIVCKEV--DRNPGQVLIRWSLQHGYLPLPKTRTV 243

Query: 248 DRLKENIKSCDFELSSADLKKLTHDDQY 275
            RL+ N+ +  FELS   +K L H D Y
Sbjct: 244 KRLEGNLAAYSFELSDEQMKTLDHPDAY 271

>NCAS0H00560 Chr8 complement(96020..96874) [855 bp, 284 aa] {ON}
           Anc_7.468
          Length = 284

 Score =  254 bits (650), Expect = 9e-84,   Method: Compositional matrix adjust.
 Identities = 118/268 (44%), Positives = 183/268 (68%), Gaps = 3/268 (1%)

Query: 9   HALKNGVKMPCLGLGLYQTPKEETTNIVHNALKLGYRQVDSAQLYGNEREACLGITKFLE 68
           +   NG ++P + LG Y  P+  T  IV+ ALK GYR  D+A LYGNE +   GI ++++
Sbjct: 8   YTFNNGNQIPSIALGTYDIPQSITAKIVYEALKAGYRHFDTAVLYGNEHQVGEGILQWIQ 67

Query: 69  ESPKVS-RSDIFFTTKIKTQDQGYESAKKSIEESLNRVKELDYIDLFLIHAPLTNKEKRL 127
           E P+ + RSD+F+TTK+     GY  A+ +I+E L +V  L YID+ LIH+PL  + KRL
Sbjct: 68  EDPQQNKRSDVFYTTKLWNSQNGYHQAQTAIKECLAKVHGLQYIDMLLIHSPLEGRTKRL 127

Query: 128 GTWKAFQEYYETGKIKAIGVSNYGIQHLEEMYQWDGLKIDPMVNQYELNPWLTRKELSNY 187
            TW+A QE  E+G +K IGVSNYG QH+EE+ QW+ L I P+VNQ E++PW+ R EL++Y
Sbjct: 128 ETWRAMQEAVESGLVKNIGVSNYGRQHVEELLQWERLTIKPVVNQIEISPWVMRSELADY 187

Query: 188 CHQKGMVIQAYSPLTRARRLQDPELVKLVEDSYPEQTSAQILVNWSLQMGFVPLVKTVHE 247
           C   G+V++A++PLT   +L D +LV++ ++    +++ Q+L+ WSLQ G++PL KT   
Sbjct: 188 CKSVGLVVEAFAPLTHGYKLHDADLVRVSKEV--GRSTVQVLIRWSLQHGYLPLPKTKTV 245

Query: 248 DRLKENIKSCDFELSSADLKKLTHDDQY 275
            RL+EN+++ +F+L++  ++ + H D Y
Sbjct: 246 KRLEENLEAYNFQLTTEQMQLIDHPDAY 273

>Suva_12.184 Chr12 (289608..290456) [849 bp, 282 aa] {ON} YJR096W
           (REAL)
          Length = 282

 Score =  252 bits (643), Expect = 7e-83,   Method: Compositional matrix adjust.
 Identities = 119/268 (44%), Positives = 178/268 (66%), Gaps = 3/268 (1%)

Query: 9   HALKNGVKMPCLGLGLYQTPKEETTNIVHNALKLGYRQVDSAQLYGNEREACLGITKFLE 68
           +   NG K+P + LG Y  P+ +T  IV+  +K GYR  D+A LYGNE+E   GITK+L 
Sbjct: 6   YKFSNGYKVPSIALGTYDIPRSQTAEIVYEGIKCGYRHFDTAVLYGNEKEVGDGITKWLH 65

Query: 69  ESPKVS-RSDIFFTTKIKTQDQGYESAKKSIEESLNRVKELDYIDLFLIHAPLTNKEKRL 127
           E P+ + R D+F+TTK+     GY+ AK +I++ LN V  L YIDL LIH+PL   + RL
Sbjct: 66  EDPENNKREDVFYTTKLWNSQNGYKRAKVAIQQCLNEVSGLKYIDLLLIHSPLEGSKLRL 125

Query: 128 GTWKAFQEYYETGKIKAIGVSNYGIQHLEEMYQWDGLKIDPMVNQYELNPWLTRKELSNY 187
            TW+A QE  + G +K+IGVSNYG +H++E+  W  LK  P+VNQ E++PW+ R+EL++Y
Sbjct: 126 ETWQAMQEAVDEGMVKSIGVSNYGKKHVDELLNWSQLKHKPVVNQIEISPWIMRQELADY 185

Query: 188 CHQKGMVIQAYSPLTRARRLQDPELVKLVEDSYPEQTSAQILVNWSLQMGFVPLVKTVHE 247
           C  K +V++A++PL    ++ DP+L+K+ ++   ++   Q+L+ WSLQ G++PL KT   
Sbjct: 186 CKSKNLVVEAFAPLCHGYKMTDPDLLKVCKEV--DRNPGQVLIRWSLQHGYLPLPKTKTV 243

Query: 248 DRLKENIKSCDFELSSADLKKLTHDDQY 275
            RL+ N+ + +FELS   +K L H D Y
Sbjct: 244 KRLESNLAAYNFELSDDQMKILDHPDAY 271

>KLLA0F03256g Chr6 (306731..307588) [858 bp, 285 aa] {ON} highly
           similar to uniprot|P47137 Saccharomyces cerevisiae
           YJR096W
          Length = 285

 Score =  251 bits (640), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 123/281 (43%), Positives = 185/281 (65%), Gaps = 6/281 (2%)

Query: 1   MRFTPGTTHALKNGVKMPCLGLGLYQTPKEETTNIVHNALKLGYRQVDSAQLYGNEREAC 60
           M  +   ++ L +G  +P +GLG Y+ P  +T  +VH AL++GYR  D+A LYGNE E  
Sbjct: 1   MELSVPKSYKLSSGYTIPSVGLGTYELPPNKTAYLVHQALEVGYRHFDTAVLYGNEYEVG 60

Query: 61  LGITKFLEESPKVS-RSDIFFTTKIKTQDQGYESAKKSIEESLNRVKELDYIDLFLIHAP 119
            GI K+L E+P  + R D+F+TTK+     GYE AKK+I+  L  V++L YIDL LIH+P
Sbjct: 61  QGIKKWLNENPAENKRGDVFYTTKLWDSQHGYEKAKKAIDHCLQEVEDLGYIDLLLIHSP 120

Query: 120 LTNKEKRLGTWKAFQEYYETGKIKAIGVSNYGIQHLEEMYQWDGLKIDPMVNQYELNPWL 179
           L  K+ RL T++A QE  + GK+++IGVSNYG QH+EE+  W+ LK  P+VNQ E++PW 
Sbjct: 121 LGGKKLRLETYEAMQEAVDAGKVRSIGVSNYGFQHIEELLNWEKLKYKPVVNQIEISPWC 180

Query: 180 TRKELSNYCHQKGMVIQAYSPLTRARRLQDPELVKLVEDSYPEQTSAQILVNWSLQMGFV 239
            R+EL+++C +KG++++AY+PLT   +L+DP+LVK+  +   +    Q L+ WSLQ G++
Sbjct: 181 MRQELADFCKKKGILVEAYAPLTHGTKLKDPDLVKVANEVGCD--VGQALIRWSLQKGYI 238

Query: 240 PLVKTVHEDRLKENIKSCDFELSSADLKKLTHDDQYYLSQP 280
           PL KT    RL  N+    FE ++  + +L   D+ Y  +P
Sbjct: 239 PLPKTQSVSRLASNLDVFSFEWTTDQMDQL---DKPYAYEP 276

>Kwal_47.18219 s47 (737925..738806) [882 bp, 293 aa] {ON} YJR096W -
           Hypothetical ORF [contig 197] FULL
          Length = 293

 Score =  250 bits (639), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 121/283 (42%), Positives = 191/283 (67%), Gaps = 12/283 (4%)

Query: 8   THALKNGVKMPCLGLGLYQTPKEETTNIVHNALKLGYRQVDSAQLYGNEREACLGITKFL 67
            + L +G  +P +GLG Y  P+ ET+ +V+ ALK GYR +D+A LYGNE E   GI K+L
Sbjct: 16  AYKLSSGYILPSIGLGTYDIPRAETSEVVYQALKSGYRHLDTAVLYGNEHEVGQGIQKWL 75

Query: 68  EESPKVS-RSDIFFTTKIKTQDQGYESAKKSIEESLNRVKELDYIDLFLIHAPLTNKEKR 126
           EE P+ + R D+F+TTK+     GY +AK++I+E + +V  L YIDL LIH+PL+   +R
Sbjct: 76  EEDPEHNKRQDVFYTTKLWNSQNGYSNAKRAIKECMEKVSPLGYIDLLLIHSPLSGTRRR 135

Query: 127 LGTWKAFQEYYETGKIKAIGVSNYGIQHLEEMYQWDGLKIDPMVNQYELNPWLTRKELSN 186
           L T+KA QE  + G +++IGVSNYG  H++E+  W  LK  P+VNQ E++PW+ R++L++
Sbjct: 136 LETYKAMQEAVDEGIVRSIGVSNYGKHHIDELLTWKELKHKPVVNQIEISPWIMRQDLAD 195

Query: 187 YCHQKGMVIQAYSPLTRARRLQDPELVKLVEDSYPEQTSAQILVNWSLQMGFVPLVKTVH 246
           YC  KG+V++A+SPLT   +L+ P+++ + +++  +  + ++L+ WSLQ G+VPL K+  
Sbjct: 196 YCKSKGLVVEAFSPLTHGYKLKHPDVLLVAKETGTD--AGRVLIRWSLQHGYVPLPKSRS 253

Query: 247 EDRLKENIKSCDFELSSADLKKLTHDDQYYLSQPK-WDPIKYE 288
            +RLK N+K+ DFELS   +         +L QP+ ++P  +E
Sbjct: 254 VERLKGNVKAYDFELSPEQVS--------FLDQPQAYEPTDWE 288

>YJR096W Chr10 (611195..612043) [849 bp, 282 aa] {ON} Putative
           xylose and arabinose reductase; member of the aldo-keto
           reductase (AKR) family; GFP-fusion protein is induced in
           response to the DNA-damaging agent MMS
          Length = 282

 Score =  249 bits (636), Expect = 9e-82,   Method: Compositional matrix adjust.
 Identities = 119/268 (44%), Positives = 176/268 (65%), Gaps = 3/268 (1%)

Query: 9   HALKNGVKMPCLGLGLYQTPKEETTNIVHNALKLGYRQVDSAQLYGNEREACLGITKFLE 68
           + L NG K+P + LG Y  P+ +T  IV+  +K GYR  D+A LYGNE+E   GI K+L 
Sbjct: 6   YKLSNGFKIPSIALGTYDIPRSQTAEIVYEGVKCGYRHFDTAVLYGNEKEVGDGIIKWLN 65

Query: 69  ESP-KVSRSDIFFTTKIKTQDQGYESAKKSIEESLNRVKELDYIDLFLIHAPLTNKEKRL 127
           E P    R +IF+TTK+     GY+ AK +I + LN V  L YIDL LIH+PL   + RL
Sbjct: 66  EDPGNHKREEIFYTTKLWNSQNGYKRAKAAIRQCLNEVSGLQYIDLLLIHSPLEGSKLRL 125

Query: 128 GTWKAFQEYYETGKIKAIGVSNYGIQHLEEMYQWDGLKIDPMVNQYELNPWLTRKELSNY 187
            TW+A QE  + G +K+IGVSNYG +H++E+  W  LK  P+VNQ E++PW+ R+EL++Y
Sbjct: 126 ETWRAMQEAVDEGLVKSIGVSNYGKKHIDELLNWPELKHKPVVNQIEISPWIMRQELADY 185

Query: 188 CHQKGMVIQAYSPLTRARRLQDPELVKLVEDSYPEQTSAQILVNWSLQMGFVPLVKTVHE 247
           C  KG+V++A++PL    ++ +P+L+K+ ++   ++   Q+L+ WSLQ G++PL KT   
Sbjct: 186 CKSKGLVVEAFAPLCHGYKMTNPDLLKVCKEV--DRNPGQVLIRWSLQHGYLPLPKTKTV 243

Query: 248 DRLKENIKSCDFELSSADLKKLTHDDQY 275
            RL+ N+ + +FELS   +K L H D Y
Sbjct: 244 KRLEGNLAAYNFELSDEQMKFLDHPDAY 271

>SAKL0F14278g Chr6 (1143922..1144782) [861 bp, 286 aa] {ON} highly
           similar to uniprot|P47137 Saccharomyces cerevisiae
           YJR096W
          Length = 286

 Score =  249 bits (635), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 116/269 (43%), Positives = 176/269 (65%), Gaps = 3/269 (1%)

Query: 8   THALKNGVKMPCLGLGLYQTPKEETTNIVHNALKLGYRQVDSAQLYGNEREACLGITKFL 67
            + L +G  +P +GLG Y  P   T+ IV+ ALK GYR +D+A LYGNERE   GI K+L
Sbjct: 9   AYKLSSGYTLPSIGLGTYDLPSNATSEIVYEALKCGYRHLDTAVLYGNEREVGEGILKWL 68

Query: 68  EESPKVS-RSDIFFTTKIKTQDQGYESAKKSIEESLNRVKELDYIDLFLIHAPLTNKEKR 126
           +E+P  + R D+F+ TK+     GY +AK++I+E   +V+ L YIDL LIH+PL+   KR
Sbjct: 69  KENPSSNKREDVFYATKLWNSQNGYNNAKRAIQECFEKVEGLGYIDLLLIHSPLSGSRKR 128

Query: 127 LGTWKAFQEYYETGKIKAIGVSNYGIQHLEEMYQWDGLKIDPMVNQYELNPWLTRKELSN 186
           L T+KA QE  + G +++IGVSNYG+ H++E+  W+ LK  P VNQ E++PWL R+EL++
Sbjct: 129 LETYKAMQEAVDKGIVRSIGVSNYGVHHIDELLNWNELKYKPFVNQIEISPWLMRQELAD 188

Query: 187 YCHQKGMVIQAYSPLTRARRLQDPELVKLVEDSYPEQTSAQILVNWSLQMGFVPLVKTVH 246
           YC  +G++++AY+PLT   ++  P ++++ +++     S Q+L+ WSLQ G+VPL KT  
Sbjct: 189 YCKSRGLIVEAYAPLTHGYKINHPNVLRVAKEA--GCNSGQVLIRWSLQHGYVPLPKTKS 246

Query: 247 EDRLKENIKSCDFELSSADLKKLTHDDQY 275
             RL  N+   + EL+   +  L   D Y
Sbjct: 247 VKRLPSNLDVYNIELTQEQMDFLDQPDAY 275

>Skud_10.318 Chr10 (568560..569408) [849 bp, 282 aa] {ON} YJR096W
           (REAL)
          Length = 282

 Score =  247 bits (630), Expect = 7e-81,   Method: Compositional matrix adjust.
 Identities = 116/268 (43%), Positives = 177/268 (66%), Gaps = 3/268 (1%)

Query: 9   HALKNGVKMPCLGLGLYQTPKEETTNIVHNALKLGYRQVDSAQLYGNEREACLGITKFLE 68
           + L NG ++P + LG Y  P+ +T  IV+  +K GYR  D+A LYGNE+E   GI K+L 
Sbjct: 6   YNLSNGYRIPSIALGTYDIPRSQTAEIVYEGIKCGYRHFDTAVLYGNEKEVGDGIIKWLN 65

Query: 69  ESPKVS-RSDIFFTTKIKTQDQGYESAKKSIEESLNRVKELDYIDLFLIHAPLTNKEKRL 127
           E+P+ + R  IF+TTK+     GY+ AK +I++ LN V  L YIDL LIH+PL   + RL
Sbjct: 66  ENPESNKREKIFYTTKLWNSQNGYKRAKAAIQQCLNEVSGLKYIDLLLIHSPLEGSKLRL 125

Query: 128 GTWKAFQEYYETGKIKAIGVSNYGIQHLEEMYQWDGLKIDPMVNQYELNPWLTRKELSNY 187
            TW+A QE  + G +K+IGVSNYG +H++E+  W  L   P+VNQ E++PW+ R+EL++Y
Sbjct: 126 ETWQAMQEAVDEGVVKSIGVSNYGKKHIDELLTWPDLTYKPVVNQIEISPWVMRQELADY 185

Query: 188 CHQKGMVIQAYSPLTRARRLQDPELVKLVEDSYPEQTSAQILVNWSLQMGFVPLVKTVHE 247
           C  KG++++A++PL    ++ +P+L+K+ ++   ++   Q+L+ WSLQ G++PL KT   
Sbjct: 186 CKSKGLIVEAFAPLCHGYKMTNPDLLKVCKEV--DRNPGQVLIRWSLQHGYLPLPKTKTV 243

Query: 248 DRLKENIKSCDFELSSADLKKLTHDDQY 275
            RL+ N+ + DFEL    +K L H D Y
Sbjct: 244 KRLEGNLAAYDFELLDKQMKILDHPDAY 271

>Kpol_1013.82 s1013 complement(200564..201421) [858 bp, 285 aa] {ON}
           complement(200564..201421) [858 nt, 286 aa]
          Length = 285

 Score =  246 bits (629), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 121/268 (45%), Positives = 172/268 (64%), Gaps = 3/268 (1%)

Query: 9   HALKNGVKMPCLGLGLYQTPKEETTNIVHNALKLGYRQVDSAQLYGNEREACLGITKFLE 68
           + L NG  +P +GLG Y  P   T N+V+ ALK GYR  D+A LYGNE E   GI ++L 
Sbjct: 9   YKLSNGYSIPSVGLGTYDIPNNVTANVVYEALKAGYRHFDTAVLYGNEEEVGQGIHRWLL 68

Query: 69  ESPKVSRSD-IFFTTKIKTQDQGYESAKKSIEESLNRVKELDYIDLFLIHAPLTNKEKRL 127
           E P+ +R + +F+TTK+     GYE A K+I+  L++VK L+YIDL LIH+PL   + RL
Sbjct: 69  EDPENNRREAVFYTTKLWNSQNGYEKATKAIKNCLDKVKALEYIDLLLIHSPLGGTKLRL 128

Query: 128 GTWKAFQEYYETGKIKAIGVSNYGIQHLEEMYQWDGLKIDPMVNQYELNPWLTRKELSNY 187
            TWKA QE  + G +K+IGVSNYG+ H++E+  W  LK  P+VNQ E++PWL R+EL++Y
Sbjct: 129 ETWKAMQEAVDHGMVKSIGVSNYGMHHIDELLTWQYLKYKPVVNQIEISPWLMRQELADY 188

Query: 188 CHQKGMVIQAYSPLTRARRLQDPELVKLVEDSYPEQTSAQILVNWSLQMGFVPLVKTVHE 247
           C    + ++ YSPLT   +L D +L K+  ++   +   Q+L+ WSLQ G++PL KT   
Sbjct: 189 CKSNSIFVECYSPLTHGYKLNDQDLKKVANET--GKNVGQVLIRWSLQHGYIPLPKTRTI 246

Query: 248 DRLKENIKSCDFELSSADLKKLTHDDQY 275
           +RLK N+   DF L+S  +  L H   Y
Sbjct: 247 NRLKTNLDVYDFNLTSDQMTILDHPLSY 274

>Ecym_7160 Chr7 (334780..335595) [816 bp, 271 aa] {ON} similar to
           Ashbya gossypii ABL209C
          Length = 271

 Score =  238 bits (606), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 119/263 (45%), Positives = 157/263 (59%), Gaps = 3/263 (1%)

Query: 8   THALKNGVKMPCLGLGLYQTPKEETTNIVHNALKLGYRQVDSAQLYGNEREACLGITKFL 67
           T+ L NG  MP LGLG Y  PK  T  +VH ALK GYR  D+A  YGNE E   GI  +L
Sbjct: 5   TYTLTNGCLMPSLGLGCYSIPKNTTAQVVHQALKCGYRHFDTAVFYGNETEVGEGIAAWL 64

Query: 68  EESPKVSR-SDIFFTTKIKTQDQGYESAKKSIEESLNRVKELDYIDLFLIHAPLTNKEKR 126
            E P  +R  D+F+ TK+     GY  AK +I++ L +V  L YIDL LIH+P     KR
Sbjct: 65  AEDPSSNRRQDVFYVTKLWNSQNGYTEAKTAIQQCLQKVAPLGYIDLLLIHSPACGSAKR 124

Query: 127 LGTWKAFQEYYETGKIKAIGVSNYGIQHLEEMYQWDGLKIDPMVNQYELNPWLTRKELSN 186
           L T++A QE  + G +K+IGVSNY   HL+E+Y    LK +P+VNQ E+ PWL R +L +
Sbjct: 125 LATYEAMQESVDAGIVKSIGVSNYERHHLQELYAMPNLKHNPVVNQIEVTPWLPRNDLVD 184

Query: 187 YCHQKGMVIQAYSPLTRARRLQDPELVKLVEDSYPEQTSAQILVNWSLQMGFVPLVKTVH 246
           YC   G+ IQAYSPL    R+ DP +  L        T AQIL+ WSL  G+ PL KT +
Sbjct: 185 YCKSIGLAIQAYSPLGCGDRVNDPYIASLATQK--NCTPAQILIAWSLAKGYAPLPKTQN 242

Query: 247 EDRLKENIKSCDFELSSADLKKL 269
             RL+ N+ S +  L++ +L  +
Sbjct: 243 IQRLQSNLDSYNVSLTAEELTNI 265

>CAGL0C04543g Chr3 (434137..435000) [864 bp, 287 aa] {ON} highly
           similar to uniprot|P47137 Saccharomyces cerevisiae
           YJR096w
          Length = 287

 Score =  236 bits (601), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 115/279 (41%), Positives = 173/279 (62%), Gaps = 10/279 (3%)

Query: 11  LKNGVKMPCLGLGLYQTPKEETTNIVHNALKLGYRQVDSAQLYGNEREACLGITKFL-EE 69
           L++G K+P L LG Y  P   T  +V  ALK GYR  D+A LYGNERE   GI  ++ E+
Sbjct: 13  LQDGRKIPSLALGTYDIPNSVTAKVVTEALKCGYRHFDTAVLYGNEREVGQGIVNWINED 72

Query: 70  SPKVSRSDIFFTTKIKTQDQGYESAKKSIEESLNRVKELDYIDLFLIHAPLTNKEKRLGT 129
                R D+F+TTK+     GY  AK++I+E + +V  L YID+ LIH+PL+ + +RL T
Sbjct: 73  KAHNKREDVFYTTKLWNSQNGYNEAKRAIKECMQKVSGLGYIDMLLIHSPLSGQRRRLET 132

Query: 130 WKAFQEYYETGKIKAIGVSNYGIQHLEEMYQWDGLKIDPMVNQYELNPWLTRKELSNYCH 189
           WKA QE  + G +K+IGVSNYG  H+EE+  WD LK  P+VNQ E++PW+ R+EL++YC 
Sbjct: 133 WKAMQEAVDEGIVKSIGVSNYGKHHIEELLGWDELKYKPVVNQIEISPWVMRQELADYCK 192

Query: 190 QKGMVIQAYSPLTRARRLQDPELVKLVEDSYPEQTSAQILVNWSLQMGFVPLVKTVHEDR 249
              +V++AY+P+    ++ DP L ++ +++       Q+L+ WSLQ G++PL KT    R
Sbjct: 193 SVNLVVEAYAPMAHGYKMNDPGLREISKET--GMNPGQLLIRWSLQHGYLPLPKTKTVAR 250

Query: 250 LKENIKSCDFELSSADLKKLTHDDQYYLSQPKWDPIKYE 288
           L  N+   + +L+   +K++ H + Y       DP  +E
Sbjct: 251 LASNLDVYNHKLTLDQVKRMDHPEAY-------DPTDWE 282

>Kwal_33.13276 s33 (153537..154445) [909 bp, 302 aa] {ON} YDL124W -
           Hypothetical ORF [contig 119] FULL
          Length = 302

 Score =  206 bits (523), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 121/300 (40%), Positives = 186/300 (62%), Gaps = 25/300 (8%)

Query: 7   TTHALKNGVKMPCLGLGLYQTPKEETTNIVHNALKLGYRQVDSAQLYGNEREACLGITKF 66
           T + L NG ++P +G G+Y+ PKE+T ++V++ALK GYR +D+A LY N++EA  G+ K+
Sbjct: 11  TRYKLNNGQQIPVIGFGVYEIPKEDTADLVYSALKDGYRHIDTAVLYKNQKEAAQGVRKY 70

Query: 67  LEESPKVSRSDIFFTTKIKTQDQGYESAKKSIEESLNRVKE-LDYIDLFLIHAPLTNKEK 125
           L+E+ + +R +I+FTTK+     G E  +K+++E    VKE + Y+DL L+H+P    ++
Sbjct: 71  LDETGE-ARENIWFTTKLWDSQFGREETEKALQEVAADVKEYIGYVDLLLLHSPRGGAKR 129

Query: 126 RLGTWKAF-QEYYETG----KIKAIGVSNYGIQHLEEMYQWDGLKIDPMVNQYELNPWLT 180
           RL TW    Q   E G    +IK+IGVSN+G+ HLEE+ +    K+ P+++Q EL+PWL 
Sbjct: 130 RLETWAILEQAVQEPGSKALEIKSIGVSNFGVDHLEELLK--VAKVKPVLDQLELHPWLP 187

Query: 181 RKELSNYCHQKGMVIQAYSPLTRARRLQDPELVKLVEDSYPEQTSAQILVNWSLQMGFVP 240
           R EL  Y  +K +  +AYSPLT+  RLQDPEL+ L  ++      A IL+ WS   GFV 
Sbjct: 188 RVELRKYLKEKDIFAEAYSPLTQGYRLQDPELLAL--EAKTGINKAVILLRWSFLQGFVV 245

Query: 241 LVKTVHEDRLKENIKSCDFELSSADLKKLTHDDQYY--LSQPK------W---DPIKYEG 289
           LVK+ + +R+++N+       S  D  K+  D+Q +  L +P+      W   DP  YEG
Sbjct: 246 LVKSSNPERIRQNLAVLP---SENDSWKVEIDEQLWKTLDKPEAKDVATWGQKDPTVYEG 302

>KLTH0F01892g Chr6 (149177..150085) [909 bp, 302 aa] {ON} similar to
           uniprot|P47137 Saccharomyces cerevisiae YJR096W
          Length = 302

 Score =  205 bits (522), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 115/298 (38%), Positives = 183/298 (61%), Gaps = 25/298 (8%)

Query: 7   TTHALKNGVKMPCLGLGLYQTPKEETTNIVHNALKLGYRQVDSAQLYGNEREACLGITKF 66
           T + L NG ++P +G G+Y  P EET   V+ AL+ GYR +D+A +Y N+++A  G+ +F
Sbjct: 11  TRYKLNNGTEVPVIGFGVYDIPVEETAQRVYTALQEGYRHIDTAVVYENQKQAAQGVHRF 70

Query: 67  LEESPKVSRSDIFFTTKIKTQDQGYESAKKSIEESLNRVKE-LDYIDLFLIHAPLTNKEK 125
           LEE+    R +++FTTK+    QG ++  +++EE    VKE + Y+DL L+H+PLT+ ++
Sbjct: 71  LEET-GTPREEVWFTTKLWNTQQGRDATPRALEEIAADVKEFIGYVDLLLLHSPLTDAQR 129

Query: 126 RLGTW----KAFQEYYETG-KIKAIGVSNYGIQHLEEMYQWDGLKIDPMVNQYELNPWLT 180
           RL TW    +A QE   +  +I+AIGVSN+G++HL+E+ +   +K  P+V+Q EL+PWL 
Sbjct: 130 RLETWAVLERAVQEPASSALEIRAIGVSNFGVRHLQELLEVATVK--PVVDQLELHPWLP 187

Query: 181 RKELSNYCHQKGMVIQAYSPLTRARRLQDPELVKLVEDSYPEQTSAQILVNWSLQMGFVP 240
           R EL  +  + G++ +AYSPLT+  RLQDPEL+ L  ++    +  +IL+ WS   GF  
Sbjct: 188 RAELRAFLRENGILAEAYSPLTQGVRLQDPELLAL--EAKSGLSKGEILLRWSFLQGFAV 245

Query: 241 LVKTVHEDRLKENIK-----------SCDFELSSADLKKLTHDDQYYLSQPKWDPIKY 287
           LVK+ +  R+++N+            S D EL  A  K  +HD   +  +   DP +Y
Sbjct: 246 LVKSNNPQRIRDNLAVLPAKTDSWKVSLDQELWDALDKPDSHDVATWGQK---DPTEY 300

>NDAI0C01600 Chr3 complement(342011..342952) [942 bp, 313 aa] {ON}
           Anc_5.434
          Length = 313

 Score =  164 bits (416), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 108/313 (34%), Positives = 173/313 (55%), Gaps = 47/313 (15%)

Query: 7   TTHALKNGVKMPCLGLGLYQTPKE-ETTNIVHNALKLGYRQVDSAQLYGNEREACLGITK 65
            T+ L  G  +P +GLG +Q+  E E    V NALK GYR +D+A +Y NE +    + K
Sbjct: 10  ATYKLNTGATIPAVGLGTWQSTNENEGYEAVMNALKAGYRHIDTAAIYKNEDQ----VGK 65

Query: 66  FLEESPKVSRSDIFFTTKI-KTQDQGYESAKKSIEESLNRVKELDYIDLFLIHAP----- 119
            + +S  + R +IF TTK+  TQ +  E+A   + +SL R+  LDY+DL+L+H P     
Sbjct: 66  AINDS-GIPREEIFVTTKLWGTQHRDPETA---LNQSLERLG-LDYVDLYLMHWPVAFKP 120

Query: 120 -------------LTNKEKRLG--------TWKAFQEYYETGKIKAIGVSNYGIQHLEEM 158
                        L N ++ L         TW+  QE  +TGK +A+GVSN+ I +L+ +
Sbjct: 121 DSIKDGNYSTMPMLPNGQRDLDLTTWNFVKTWELMQELPKTGKTRAVGVSNFSINNLKAL 180

Query: 159 YQWDGLKIDPMVNQYELNPWLTRKELSNYCHQKGMVIQAYSPL--TRARRLQDPELVKLV 216
               G K+ P  NQ E +P L + EL  +C +KG++++AYSPL  T A  L +P+++++ 
Sbjct: 181 LSSPGNKLVPAANQVEAHPLLPQDELQKFCKEKGIILEAYSPLGSTNAPILTEPKIIEIA 240

Query: 217 EDSYPEQTSAQILVNWSLQMGFVPLVKTVHEDRLKENIKSCDFELSSADLKKLTH----D 272
           +    +   AQ++++W +Q G V L K+VHE+R+K N ++  FELS  ++  L +     
Sbjct: 241 KKHNVQ--PAQVVISWHVQKGHVVLPKSVHEERIKANFQT--FELSKDEMDSLNNLSKEK 296

Query: 273 DQYYLSQPKWDPI 285
            +  + QP W P 
Sbjct: 297 GERRIVQPNWAPF 309

>NCAS0H02060 Chr8 (400615..401583) [969 bp, 322 aa] {ON} Anc_5.434
          Length = 322

 Score =  164 bits (414), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 104/311 (33%), Positives = 173/311 (55%), Gaps = 45/311 (14%)

Query: 7   TTHALKNGVKMPCLGLGLYQTPKE-ETTNIVHNALKLGYRQVDSAQLYGNEREACLGITK 65
           TT  L  G  +  +GLG +Q+  E E    V  ALK GYR +D+A +YGNE +    + K
Sbjct: 19  TTFKLNTGATISAVGLGTWQSTNENEGYEAVIAALKAGYRHIDTAAIYGNEGQ----VGK 74

Query: 66  FLEESPKVSRSDIFFTTKIKTQDQGYESAKKSIEESLNRVKELDYIDLFLIHAPLTNKEK 125
            + +S  V R +IF TTK+ +      +A   + +SL R+  LDY+DL+L+H P+T   +
Sbjct: 75  AINDS-GVPREEIFVTTKLWSTQHHDPAA--GLNDSLKRLG-LDYVDLYLMHWPVTLNPR 130

Query: 126 RLG--------------------------TWKAFQEYYETGKIKAIGVSNYGIQHLEEMY 159
            +                           TW+  QE  +TGK +A+GVSN+ I +L+++ 
Sbjct: 131 SIKDGNFLSIPLLPDGKRDVEIDTWDYVKTWELMQELPKTGKTRAVGVSNFSINNLKKVL 190

Query: 160 QWDGLKIDPMVNQYELNPWLTRKELSNYCHQKGMVIQAYSPL--TRARRLQDPELVKLVE 217
              G K+ P VNQ E++P L ++EL  +CH KG++++AYSPL  T A  L +P L+ L +
Sbjct: 191 SSPGNKVVPAVNQVEIHPLLPQEELLEWCHSKGILLEAYSPLGSTNAPILTEPVLINLAK 250

Query: 218 DSYPEQTSAQILVNWSLQMGFVPLVKTVHEDRLKENIKSCDFELSSADLKKLTH----DD 273
               +  +AQI+++W +Q G++ L K+VH +R++ N K+   +LS  +++++ +      
Sbjct: 251 KHGVQ--TAQIVISWHVQRGYIVLPKSVHAERIQANFKT--LKLSDEEMREINNISKEKG 306

Query: 274 QYYLSQPKWDP 284
           +  + QP W+P
Sbjct: 307 ERRIVQPHWEP 317

>SAKL0G02530g Chr7 (208952..209890) [939 bp, 312 aa] {ON} similar to
           uniprot|Q12458 Saccharomyces cerevisiae YDR368W YPR1
           2-methylbutyraldehyde reductase may be involved in
           isoleucine catabolism
          Length = 312

 Score =  162 bits (411), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 105/291 (36%), Positives = 165/291 (56%), Gaps = 40/291 (13%)

Query: 7   TTHALKNGVKMPCLGLGLYQTPKEETTNIVHNALKLGYRQVDSAQLYGNEREACLGITKF 66
            T  L  G  +P LGLG +++  EE  N V +A+KLGYR +DSA +YGNE      + K 
Sbjct: 10  ATVKLNTGAIIPQLGLGTWRSSDEEAYNSVLSAIKLGYRHIDSAAIYGNEEP----VGKA 65

Query: 67  LEESPKVSRSDIFFTTKIKTQDQGYESAKKSIEESLNRVKELDYIDLFLIHAPL------ 120
           + +S  V R+++F TTK+    Q   + +K+++ SL R+  LDY+DL+LIH P+      
Sbjct: 66  IRDS-GVPRNELFVTTKLWGTQQ--RNPEKALDASLKRLG-LDYVDLYLIHWPIAFKTDN 121

Query: 121 ----------TNKEKR----------LGTWKAFQEYYETGKIKAIGVSNYGIQHLEEMYQ 160
                     T K+ +          + TW+  QE   TGK KA+GVSN+ + +L+E+  
Sbjct: 122 IKDDDYLTVPTGKDGKADVDVKDWNFVKTWELVQELPATGKAKAVGVSNFSVNNLKELLA 181

Query: 161 WDGLKIDPMVNQYELNPWLTRKELSNYCHQKGMVIQAYSPL--TRARRLQDPELVKLVED 218
             G K+ P  NQ EL+P L + EL  +   KG+VI+AYSPL    +  L++P ++++ + 
Sbjct: 182 SPGNKLVPACNQVELHPLLPQDELIEFSKSKGIVIEAYSPLGSNGSPLLKEPVIIEVAKK 241

Query: 219 SYPEQTSAQILVNWSLQMGFVPLVKTVHEDRLKENIKSCDFELSSADLKKL 269
              E   AQ+L+NW +Q G+V L K+V+  R++ N K   F+LS  D+ ++
Sbjct: 242 YGVE--PAQVLINWGIQRGYVILPKSVNPKRVESNFKV--FDLSKEDVDRI 288

>Kpol_1062.29 s1062 complement(63895..64830) [936 bp, 311 aa] {ON}
           complement(63895..64830) [936 nt, 312 aa]
          Length = 311

 Score =  159 bits (402), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 105/290 (36%), Positives = 165/290 (56%), Gaps = 41/290 (14%)

Query: 11  LKNGVKMPCLGLGLYQTPKEETTNIVHNALKLGYRQVDSAQLYGNEREACLGITKFLEES 70
           L  G ++P +GLG +Q+ + +    V  ALK GYR +D A +Y NE E    + K + +S
Sbjct: 12  LNTGAELPAVGLGTWQSLENDAYKAVLTALKTGYRHIDGAAIYCNEGE----VGKAIRDS 67

Query: 71  PKVSRSDIFFTTKIKTQDQGYESAKKSIEESLNRVKELDYIDLFLIHAP----------- 119
             V R++IF TTK+    Q   + + ++E+SL R+  LDY+DL+LIH P           
Sbjct: 68  -GVPRNEIFVTTKLWGTQQ--RTPQLALEQSLERLG-LDYVDLYLIHWPIPLNPAQCEES 123

Query: 120 --------LTNKEKRLG--------TWKAFQEYYETGKIKAIGVSNYGIQHLEEMYQWDG 163
                   L N ++ +         TW+  QE   TGK KA+GVSN+ I +++E+    G
Sbjct: 124 GNYLTFPGLPNGKRDVDLDTWNFVKTWELMQELPATGKCKAVGVSNFSINNIKELLSSPG 183

Query: 164 LKIDPMVNQYELNPWLTRKELSNYCHQKGMVIQAYSPL--TRARRLQDPELVKLVEDSYP 221
            K+ P VNQ EL+P L + EL N+C +KG+V++AYSPL  T A  L++P LV+ +   Y 
Sbjct: 184 NKLVPAVNQIELHPLLPQVELVNFCKEKGIVVEAYSPLGGTGAAILKEP-LVEELAKKY- 241

Query: 222 EQTSAQILVNWSLQMGFVPLVKTVHEDRLKENIKSCDFELSSADLKKLTH 271
              +A ++V+W +Q G V L K+V E R+  N+++    L+  D++K+T+
Sbjct: 242 NIPAANLVVSWDVQRGVVVLPKSVTESRIISNLQT--LTLAPEDVEKITN 289

>KNAG0C04910 Chr3 complement(949367..950308) [942 bp, 313 aa] {ON}
           Anc_5.434 YOR120W
          Length = 313

 Score =  157 bits (397), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 102/310 (32%), Positives = 178/310 (57%), Gaps = 47/310 (15%)

Query: 11  LKNGVKMPCLGLGLYQTPKE-ETTNIVHNALKLGYRQVDSAQLYGNEREACLGITKFLEE 69
           L  G  +  +GLG +++    +  + V  AL+ GYR +D+A +YGNE E    + + + E
Sbjct: 14  LNTGATIRAIGLGTWRSAAATDAYDSVIAALRAGYRHIDTAAIYGNEAE----VGRAIRE 69

Query: 70  SPKVSRSDIFFTTKI-KTQDQGYESAKKSIEESLNRVKELDYIDLFLIHAP--------- 119
           S  V R +IF TTK+  TQ +  E A   +++SL R+  LDY+DL+L+H P         
Sbjct: 70  S-GVPRGEIFVTTKLWCTQHKEPELA---LDQSLKRLG-LDYVDLYLMHWPVRMRGENMP 124

Query: 120 ---------LTNKEKRLG--------TWKAFQEYYETGKIKAIGVSNYGIQHLEEMYQWD 162
                    L N ++ +         TW+  Q+  ETGK +AIGVSN+ I +L+++    
Sbjct: 125 EGDKIGFPTLPNGKRDIDITDWNFVKTWELMQKLPETGKTRAIGVSNFSINNLKDLLASP 184

Query: 163 GLKIDPMVNQYELNPWLTRKELSNYCHQKGMVIQAYSPLTRARR--LQDPELVKLVEDSY 220
           G KI P  NQ E++P L ++EL ++CH KG+VI+AYSPL  A    L++P ++++ + + 
Sbjct: 185 GNKIVPAANQVEMHPLLPQQELVDFCHGKGIVIEAYSPLGSADAPILKEPVIIEIAKKN- 243

Query: 221 PEQTSAQILVNWSLQMGFVPLVKTVHEDRLKENIKSCDFELSSADLKKLTHDDQY----Y 276
              ++AQ++++W++Q G++ L K+V+++R++ N+ +  F L+S D + + +  +      
Sbjct: 244 -GVSAAQVVISWNVQRGYIVLPKSVNKERIEANLLT--FTLTSEDFEAVNNISKVQGTKR 300

Query: 277 LSQPKWDPIK 286
           +  P W+P K
Sbjct: 301 IIDPDWEPFK 310

>KLLA0B14707g Chr2 complement(1291951..1292883) [933 bp, 310 aa]
           {ON} similar to uniprot|Q12458 Saccharomyces cerevisiae
           YDR368W YPR1 2-methylbutyraldehyde reductase may be
           involved in isoleucine catabolism
          Length = 310

 Score =  157 bits (396), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 102/288 (35%), Positives = 155/288 (53%), Gaps = 42/288 (14%)

Query: 11  LKNGVKMPCLGLGLYQTPKEETTNIVHNALKLGYRQVDSAQLYGNEREACLGITKFLEES 70
           L  G  +P +GLG +++P+E+  N V +AL+ GYR +D+A +YGNE     GI       
Sbjct: 12  LNTGASIPVVGLGTWKSPEEDAYNAVVSALQNGYRHIDTAAIYGNEEAVGKGI-----RD 66

Query: 71  PKVSRSDIFFTTKI-KTQDQGYESAKKSIEESLNRVKELDYIDLFLIHAPLTNKEKRLG- 128
             V R +IF TTK+  TQ +  E+A   ++ SL R+  LDY+DL+LIH P+      +  
Sbjct: 67  SGVPREEIFVTTKLWGTQQRDPEAA---LDLSLQRLG-LDYVDLYLIHWPVPLNASSITD 122

Query: 129 -------------------------TWKAFQEYYETGKIKAIGVSNYGIQHLEEMYQWDG 163
                                    TW+  Q   ++GK KAIGVSN+ I+++E +   + 
Sbjct: 123 GNYLTFPRTADGKIDIDIEEWNFIKTWEKMQHLPKSGKTKAIGVSNFSIKNIEALLAANP 182

Query: 164 LKIDPMVNQYELNPWLTRKELSNYCHQKGMVIQAYSPL--TRARRLQDPELVKLVEDSYP 221
             I P  NQ E++P L + EL +YC  KG++I+AYSPL  + +  L DP +  +      
Sbjct: 183 DFIVPAANQIEIHPQLPQTELIDYCKSKGILIEAYSPLGSSSSTILTDPTIEGIASKYNA 242

Query: 222 EQTSAQILVNWSLQMGFVPLVKTVHEDRLKENIKSCDFELSSADLKKL 269
           E   A IL++W    G+V L K+V+  R+K N+K  D  LS+ DL+K+
Sbjct: 243 EP--ANILISWGASRGYVVLPKSVNPQRIKTNLKLLD--LSTEDLEKI 286

>CAGL0A02816g Chr1 (296851..297783) [933 bp, 310 aa] {ON} highly
           similar to uniprot|Q12458 Saccharomyces cerevisiae
           YDR368w YPR1
          Length = 310

 Score =  155 bits (393), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 103/310 (33%), Positives = 164/310 (52%), Gaps = 44/310 (14%)

Query: 7   TTHALKNGVKMPCLGLGLYQTPKEETTNIVHNALKLGYRQVDSAQLYGNEREACLGITKF 66
            T  L  G ++P +GLG +++   +  + V  ALKLGYR +D+A +YGNE +    I   
Sbjct: 8   ATLKLNTGAEIPVVGLGTWRSAANDGYDSVLAALKLGYRHIDAAAIYGNEDQVGRAI--- 64

Query: 67  LEESPKVSRSDIFFTTKIKTQDQGYESAKKSIEESLNRVKELDYIDLFLIHAPLT----- 121
             +   V R +IF TTK+   +  + +  K+++ SL R+  LDY+DL+L+H P+      
Sbjct: 65  --KDSGVPRQEIFITTKLWGTE--HRNPAKALDSSLKRLG-LDYVDLYLMHWPVALKAHG 119

Query: 122 NKEKRL---------------------GTWKAFQEYYETGKIKAIGVSNYGIQHLEEMYQ 160
           ++EK L                      TW+  QE  +TGK KAIGVSN+ I +L+ +  
Sbjct: 120 SEEKDLLNIPKKPDGKTDIDIEDWDFIKTWELMQELPKTGKTKAIGVSNFSINNLKALKN 179

Query: 161 WDGLKIDPMVNQYELNPWLTRKELSNYCHQKGMVIQAYSPLTRARR--LQDPELVKLVED 218
                  P  NQ E++P   + EL  YC  + ++I+AYSP   A    L++PEL KL E 
Sbjct: 180 SPKFNTVPAANQVEIHPLFPQTELIEYCKSENILIEAYSPFGSADAPVLKEPELHKLAEK 239

Query: 219 SYPEQTSAQILVNWSLQMGFVPLVKTVHEDRLKENIKSCDFELSSADLKKLTH----DDQ 274
                ++AQ++++WS+Q G+V L K+VH +R++ N+K     L   D++ +T+      +
Sbjct: 240 Y--NISTAQLIISWSVQRGYVVLPKSVHAERIEANLKV--LTLKDEDMETITNLSKVKGE 295

Query: 275 YYLSQPKWDP 284
             L Q  W P
Sbjct: 296 KRLVQLDWSP 305

>YOR120W Chr15 (551114..552052) [939 bp, 312 aa] {ON}  GCY1Putative
           NADP(+) coupled glycerol dehydrogenase, proposed to be
           involved in an alternative pathway for glycerol
           catabolism; also has mRNA binding activity; member of
           the aldo-keto reductase (AKR) family
          Length = 312

 Score =  155 bits (392), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 106/321 (33%), Positives = 171/321 (53%), Gaps = 52/321 (16%)

Query: 5   PGTTH------ALKNGVKMPCLGLGLYQTPKEETTNIVHNALKLGYRQVDSAQLYGNERE 58
           P T H      +L  G ++P +GLG +Q+ + +    V  ALK GYR +D+A +Y NE +
Sbjct: 2   PATLHDSTKILSLNTGAQIPQIGLGTWQSKENDAYKAVLTALKDGYRHIDTAAIYRNEDQ 61

Query: 59  ACLGITKFLEESPKVSRSDIFFTTKI-KTQDQGYESAKKSIEESLNRVKELDYIDLFLIH 117
               I     +   V R +IF TTK+  TQ    E A   +++SL R+  LDY+DL+L+H
Sbjct: 62  VGQAI-----KDSGVPREEIFVTTKLWCTQHHEPEVA---LDQSLKRLG-LDYVDLYLMH 112

Query: 118 AP-------------LTNKEKRLG-------------TWKAFQEYYETGKIKAIGVSNYG 151
            P             L+   K+ G             TW+  QE  +TGK KA+GVSN+ 
Sbjct: 113 WPARLDPAYIKNEDILSVPTKKDGSRAVDITNWNFIKTWELMQELPKTGKTKAVGVSNFS 172

Query: 152 IQHLEEMYQWDGLKIDPMVNQYELNPWLTRKELSNYCHQKGMVIQAYSPL--TRARRLQD 209
           I +L+++    G K+ P  NQ E++P L + EL N+C  KG+V++AYSPL  T A  L++
Sbjct: 173 INNLKDLLASQGNKLTPAANQVEIHPLLPQDELINFCKSKGIVVEAYSPLGSTDAPLLKE 232

Query: 210 PELVKLVEDSYPEQTSAQILVNWSLQMGFVPLVKTVHEDRLKENIKSCDFELSSADLKKL 269
           P ++++ + +  +     ++++W +Q G+V L K+V+ DR+K N K   F LS+ D + +
Sbjct: 233 PVILEIAKKNNVQ--PGHVVISWHVQRGYVVLPKSVNPDRIKTNRKI--FTLSTEDFEAI 288

Query: 270 TH----DDQYYLSQPKWDPIK 286
            +      +  +  P W P +
Sbjct: 289 NNISKEKGEKRVVHPNWSPFE 309

>Smik_15.298 Chr15 (512239..513177) [939 bp, 312 aa] {ON} YOR120W
           (REAL)
          Length = 312

 Score =  154 bits (389), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 105/311 (33%), Positives = 168/311 (54%), Gaps = 44/311 (14%)

Query: 8   THALKNGVKMPCLGLGLYQTPKEETTNIVHNALKLGYRQVDSAQLYGNEREACLGITKFL 67
           T +L  G ++P +GLG +Q+   +    V  ALK GY+ +D+A +Y NE +    I    
Sbjct: 11  TLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKAGYKHIDTAAIYRNEDQVGQAI---- 66

Query: 68  EESPKVSRSDIFFTTKIKTQDQGYESAKKSIEESLNRVKELDYIDLFLIHAP-------- 119
            +   V R +IF TTK+ +  Q +E AK +++ESL R+  LDY+DL+LIH P        
Sbjct: 67  -KDSGVPREEIFVTTKLWST-QHHEPAK-ALDESLQRLG-LDYVDLYLIHWPARLDTNYI 122

Query: 120 -----LTNKEKRLG-------------TWKAFQEYYETGKIKAIGVSNYGIQHLEEMYQW 161
                L+   K  G             TW+  QE  +TGK KAIGVSN+ I +L+++   
Sbjct: 123 KDGDILSVPTKADGSRAVDVTNWNFIKTWELMQELPKTGKTKAIGVSNFSINNLKDLLAS 182

Query: 162 DGLKIDPMVNQYELNPWLTRKELSNYCHQKGMVIQAYSPL--TRARRLQDPELVKLVEDS 219
            G K+ P  NQ E++P L + EL N+C  K ++I+AYSPL  T A  L++P ++K+ + +
Sbjct: 183 PGNKLTPAANQVEIHPLLPQNELINFCKSKKIMIEAYSPLGSTDAPLLKEPTILKIAKKN 242

Query: 220 YPEQTSAQILVNWSLQMGFVPLVKTVHEDRLKENIKSCDFELSSADLKKLTH----DDQY 275
             +     ++++W  Q G+V L K+V+ DR++ N K   F LS+ D + + +      + 
Sbjct: 243 NVQ--PGHVVISWHAQRGYVVLPKSVNPDRIETNRKI--FTLSNEDFEAINNISKEKGEK 298

Query: 276 YLSQPKWDPIK 286
            +  P W P +
Sbjct: 299 RVVNPNWSPFE 309

>TBLA0A02825 Chr1 complement(681691..682626) [936 bp, 311 aa] {ON}
          Length = 311

 Score =  154 bits (389), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 97/292 (33%), Positives = 161/292 (55%), Gaps = 41/292 (14%)

Query: 8   THALKNGVKMPCLGLGLYQTPKEETTNIVHNALKLGYRQVDSAQLYGNEREACLGITKFL 67
           T  L  G  +P +GLG +++   +  + V  A K+GYR +D+A +YGNE +    + K +
Sbjct: 11  TVKLNTGANIPAIGLGTWRSENNDGYDSVIAAAKVGYRHIDTAAIYGNEDQ----VGKAI 66

Query: 68  EESPKVSRSDIFFTTKI-KTQDQGYESAKKSIEESLNRVKELDYIDLFLIHAPLTNKEKR 126
            E   V+RS++F TTK+  TQ +  E+A   + +SL R+  LDY+DL+LIH P+  K   
Sbjct: 67  NEC-GVTRSELFVTTKLWGTQQRDPETA---LNQSLKRLG-LDYVDLYLIHWPVAFKTDT 121

Query: 127 LG-------------------------TWKAFQEYYETGKIKAIGVSNYGIQHLEEMYQW 161
           +                          TW+  Q   +TGK KAIG+SN+ I +++E+   
Sbjct: 122 IKDGNLLTIPKKDGEADIDYPEWNFIKTWELMQNLLKTGKTKAIGISNFSINNIKELLAA 181

Query: 162 DGLKIDPMVNQYELNPWLTRKELSNYCHQKGMVIQAYSPL--TRARRLQDPELVKLVEDS 219
               + P  NQ E++P L + EL  +C +KG+VI+AYSPL    A  L+D  ++++ + +
Sbjct: 182 PTTTVTPACNQVEVHPLLPQDELIAFCKEKGIVIEAYSPLGGINAPVLKDETIIEIAKRN 241

Query: 220 YPEQTSAQILVNWSLQMGFVPLVKTVHEDRLKENIKSCDFELSSADLKKLTH 271
             +  + Q++ +W +Q G+V L K+V E R+  N+K+  F LS  D+ K+ +
Sbjct: 242 NVD--AGQVVTSWHVQRGYVVLPKSVKESRIISNLKT--FTLSDDDMTKINN 289

>TDEL0D00230 Chr4 (37458..38396) [939 bp, 312 aa] {ON}  possible
           pseudogene; NNN added to avoid internal stop codon
          Length = 312

 Score =  154 bits (388), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 104/308 (33%), Positives = 163/308 (52%), Gaps = 47/308 (15%)

Query: 11  LKNGVKMPCLGLGLYQTPKEETTNIVHNALKLGYRQVDSAQLYGNEREACLGITKFLEES 70
           L  G  +P +GLG +++ +E+    V +ALK GY+ +D+A +Y NER     + K + +S
Sbjct: 13  LNTGALLPAIGLGTWKSSEEDAYTAVLSALKAGYKHIDTAAIYRNER----AVGKAIRDS 68

Query: 71  PKVSRSDIFFTTKI-KTQDQGYESAKKSIEESLNRVKELDYIDLFLIHAPLTNKEKRL-- 127
             + R ++F TTK+  TQ   +   K +++ SL R+  LDY+DL+LIH P+  K  R+  
Sbjct: 69  -GIPRDELFITTKLWSTQ---HRDPKAALDGSLERLG-LDYVDLYLIHYPVAFKTDRIED 123

Query: 128 ------------------------GTWKAFQEYYETGKIKAIGVSNYGIQHLEEMYQWDG 163
                                    TW+  Q   E+GK KA+GVSN+ I +L+ + + D 
Sbjct: 124 GNPFCFPLLPNGKRDVDIVDWDFVKTWRLVQHLPESGKCKAVGVSNFSINNLKTLLESDE 183

Query: 164 LKIDPMVNQYELNPWLTRKELSNYCHQKGMVIQAYSPL--TRARRLQDPELVKLVEDSYP 221
               P VNQ E++P L + EL ++C  K +V++AYSPL  T ++ L D  L K+ E    
Sbjct: 184 KFAVPAVNQVEIHPQLPQTELIDFCKSKDIVVEAYSPLGSTGSQMLTDDTLQKIAEKXXD 243

Query: 222 EQTSAQILVNWSLQMGFVPLVKTVHEDRLKENIKSCDFELSSADLKKLTH-----DDQYY 276
            Q  AQIL+NW +  G+  L K+V   R++ N +  D  +   DL K+T+       + Y
Sbjct: 244 AQ-PAQILINWGISRGYCVLPKSVTPKRIEANARIID--IKKEDLLKVTNLIDILGPKRY 300

Query: 277 LSQPKWDP 284
           L +P W P
Sbjct: 301 L-EPDWSP 307

>Kwal_47.18084 s47 complement(677816..678745) [930 bp, 309 aa] {ON}
           YOR120W (GCY1) - Similar to mammalian aldo/keto
           reductases [contig 198] FULL
          Length = 309

 Score =  152 bits (385), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 95/276 (34%), Positives = 152/276 (55%), Gaps = 35/276 (12%)

Query: 11  LKNGVKMPCLGLGLYQTPKEETTNIVHNALKLGYRQVDSAQLYGNEREACLGITKFLEES 70
           L  G  +P LG G +++ +EE  N V +A+K GYR +DSA +YGNE  A +G  + + +S
Sbjct: 13  LNTGATIPLLGFGTWRSTEEEGYNAVLSAIKDGYRHIDSAAVYGNE--AAVG--RAIRDS 68

Query: 71  PKVSRSDIFFTTKIKTQDQGYESAKKSIEESLNRVKELDYIDLFLIHAPLTNKEKRLG-- 128
             V R ++F TTK+    Q      K++++SL R+  LDY+DL+LIH PL  K  R+   
Sbjct: 69  -GVPREELFVTTKLWNTQQ--REPAKALDQSLQRLG-LDYVDLYLIHWPLPIKTDRITDG 124

Query: 129 -----------------------TWKAFQEYYETGKIKAIGVSNYGIQHLEEMYQWDGLK 165
                                  TW+  QE   TGK +A+GVSN  +  LE++    G K
Sbjct: 125 NLFSIPTKEDGKPDVDTEWDYIKTWQLMQELPSTGKTRAVGVSNVSVSQLEKLLADKGNK 184

Query: 166 IDPMVNQYELNPWLTRKELSNYCHQKGMVIQAYSPL-TRARRLQDPELVKLVEDSYPEQT 224
           + P V Q E +P L + +L ++C +  ++++AYSPL ++   L D  ++K +   Y    
Sbjct: 185 VVPAVCQVETHPLLPQNKLLDFCTKHDILLEAYSPLGSQGSPLIDEPVIKEIAKKY-NAD 243

Query: 225 SAQILVNWSLQMGFVPLVKTVHEDRLKENIKSCDFE 260
            AQI+++W ++ G+V L K+V   R+K N+++ D E
Sbjct: 244 PAQIIISWDIKRGYVVLPKSVTPSRIKSNLQTLDLE 279

>Suva_8.173 Chr8 (308911..309849) [939 bp, 312 aa] {ON} YOR120W
           (REAL)
          Length = 312

 Score =  150 bits (380), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 101/311 (32%), Positives = 166/311 (53%), Gaps = 44/311 (14%)

Query: 8   THALKNGVKMPCLGLGLYQTPKEETTNIVHNALKLGYRQVDSAQLYGNEREACLGITKFL 67
           T  L  G K+P +GLG +Q+   +    V  ALK GYR +D+A +YGNE +    I    
Sbjct: 11  TLPLNTGAKIPQVGLGTWQSKDNDAYKSVVAALKDGYRHIDTAAIYGNEDQVGQAI---- 66

Query: 68  EESPKVSRSDIFFTTKIKTQDQGYESAKKSIEESLNRVKELDYIDLFLIHAP-------- 119
            +   V R +IF TTK+    Q +E AK ++++SL R+  LDY+DL+L+H P        
Sbjct: 67  -KDSGVPREEIFVTTKLWCT-QHHEPAK-ALDQSLKRLG-LDYVDLYLMHWPVRLDPNYI 122

Query: 120 -------LTNKEKR-----------LGTWKAFQEYYETGKIKAIGVSNYGIQHLEEMYQW 161
                  +  KE             + TW+  QE  +T K +A+GVSN+ I +L+++   
Sbjct: 123 KDGHILSIPTKEDGSRPVDITNWNFIKTWELMQELPKTNKTRAVGVSNFSINNLKDLLAS 182

Query: 162 DGLKIDPMVNQYELNPWLTRKELSNYCHQKGMVIQAYSPL--TRARRLQDPELVKLVEDS 219
            G ++ P  NQ EL+P L + EL ++C  KG++++AYSPL  T A  L++P ++++ + +
Sbjct: 183 PGNQLTPAANQVELHPLLPQNELIDFCKSKGIMVEAYSPLGSTDAPLLKEPVVLEIAKKN 242

Query: 220 YPEQTSAQILVNWSLQMGFVPLVKTVHEDRLKENIKSCDFELSSADLKKLTH----DDQY 275
             +     ++++W  Q G+V L K+V+ DR+K N K   F LS  D + + +      + 
Sbjct: 243 NVQ--PGHVVISWHAQRGYVVLPKSVNPDRIKTNRKV--FTLSDEDFEAINNISKEKGEK 298

Query: 276 YLSQPKWDPIK 286
            +  P W P +
Sbjct: 299 RVVNPDWSPFE 309

>TBLA0A06510 Chr1 complement(1597737..1598675) [939 bp, 312 aa] {ON}
           Anc_5.434 YOR120W
          Length = 312

 Score =  150 bits (380), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 100/310 (32%), Positives = 161/310 (51%), Gaps = 44/310 (14%)

Query: 7   TTHALKNGVKMPCLGLGLYQTPKEETTNIVHNALKLGYRQVDSAQLYGNEREACLGITKF 66
           T   L NG K+P +GLG +++ + +  N V  ALK GYR +D+A +Y NE E    I   
Sbjct: 10  TYVTLNNGEKIPSVGLGTWKSQENDGYNSVIYALKAGYRHIDTAAIYRNEGEVGRAI--- 66

Query: 67  LEESPKVSRSDIFFTTKIKTQDQGYESAKKSIEESLNRVKELDYIDLFLIHAPLTNKEK- 125
             +   V R  IF TTK+   +  +++ K+++E SL R+  LDY+DL+L+H P+    + 
Sbjct: 67  --KDSGVPRDQIFITTKLWCTE--FQNPKRALESSLKRLG-LDYVDLYLMHWPVVLNPRY 121

Query: 126 -------------------------RLGTWKAFQEYYETGKIKAIGVSNYGIQHLEEMYQ 160
                                     + TW+  QE   TG  +++GVSN+ I +LE++  
Sbjct: 122 IKDDDYLVVPRLPDGTRDVDMETWDYIKTWELVQELPATGLTRSVGVSNFSINNLEKVLS 181

Query: 161 WDGLKIDPMVNQYELNPWLTRKELSNYCHQKGMVIQAYSPL--TRARRLQDPELVKLVED 218
             G K+ P VNQ EL+P L + EL  YC  K + ++AYSP     A  L+   +V +   
Sbjct: 182 SPGNKLTPAVNQVELHPLLPQFELQKYCDSKKIKLEAYSPFGSDNAPNLKQKTIVDIAAK 241

Query: 219 SYPEQTSAQILVNWSLQMGFVPLVKTVHEDRLKENIKSCDFELSSADLKKLTH----DDQ 274
           +    + AQ++ +W +Q   V L K+VHE+R+  N K   F+LS  D+ ++      + +
Sbjct: 242 N--GVSPAQVITSWIVQRDIVVLPKSVHEERVISNFKV--FDLSKEDIAEIDALAKVNGE 297

Query: 275 YYLSQPKWDP 284
             +++P WDP
Sbjct: 298 KRINKPDWDP 307

>KLTH0E00220g Chr5 complement(12415..13335) [921 bp, 306 aa] {ON}
           similar to uniprot|P14065 Saccharomyces cerevisiae
           YOR120W GCY1 Putative NADP( ) coupled glycerol
           dehydrogenase proposed to be involved in an alternative
           pathway for glycerol catabolism
          Length = 306

 Score =  150 bits (379), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 107/309 (34%), Positives = 170/309 (55%), Gaps = 50/309 (16%)

Query: 11  LKNGVKMPCLGLGLYQTPKEETTNIVHNALKLGYRQVDSAQLYGNEREACLGITKFLEES 70
           +  G  +P LGLG ++    +T   V  AL+ GYR +D+A +Y NE  A +G  + + +S
Sbjct: 8   MNTGKPIPVLGLGTWKAADGDTYRAVLAALESGYRHIDTAAIYRNE--AAVG--RAIRDS 63

Query: 71  PKVSRSDIFFTTKI-KTQDQGYESAKKSIEESLNRVKELDYIDLFLIHAPLTNKEKRLG- 128
             V R  IF TTK+  TQ +  +SA   +  SL R+  LDY+DL+L+H P+  K   +  
Sbjct: 64  -GVPREKIFVTTKLWCTQQRDPQSA---LNASLERLG-LDYVDLYLMHFPVALKTDLIKD 118

Query: 129 -------------------------TWKAFQEYYETGKIKAIGVSNYGIQHLEEMYQWD- 162
                                    TW+  Q+  ++GK KAIGVSN+ I+++EE+ + + 
Sbjct: 119 GNVLSIPVRADGARDVDIDGWSFVKTWQLMQDLPKSGKTKAIGVSNFSIKNIEEILKPEL 178

Query: 163 GLKIDPMVNQYELNPWLTRKELSNYCHQKGMVIQAYSPL--TRARRLQDPELVKLVEDSY 220
           GL + P  NQ E++P L + EL  YC  KG++++AYSPL  + +  L DP+L+KL E   
Sbjct: 179 GLSV-PAANQIEIHPQLPQDELIEYCKSKGIIVEAYSPLGSSESSMLTDPDLIKLAEKHQ 237

Query: 221 PEQTSAQILVNWSLQMGFVPLVKTVHEDRLKENIKSCDFELSSADLKKLTH-----DDQY 275
            E   AQIL++W +  G+  L K+V+  R++ N+K    +LSS D+++++        + 
Sbjct: 238 VE--PAQILISWGVTRGYCILPKSVNSKRVQSNLKIV--KLSSNDVQQISKILEKLGSKR 293

Query: 276 YLSQPKWDP 284
           Y+S P W P
Sbjct: 294 YVS-PSWAP 301

>KLTH0A00528g Chr1 complement(46253..47173) [921 bp, 306 aa] {ON}
           similar to uniprot|P14065 Saccharomyces cerevisiae
           YOR120W GCY1 Putative NADP( ) coupled glycerol
           dehydrogenase proposed to be involved in an alternative
           pathway for glycerol catabolism
          Length = 306

 Score =  150 bits (379), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 107/309 (34%), Positives = 170/309 (55%), Gaps = 50/309 (16%)

Query: 11  LKNGVKMPCLGLGLYQTPKEETTNIVHNALKLGYRQVDSAQLYGNEREACLGITKFLEES 70
           +  G  +P LGLG ++    +T   V  AL+ GYR +D+A +Y NE  A +G  + + +S
Sbjct: 8   MNTGKPIPVLGLGTWKAADGDTYRAVLAALESGYRHIDTAAIYRNE--AAVG--RAIRDS 63

Query: 71  PKVSRSDIFFTTKI-KTQDQGYESAKKSIEESLNRVKELDYIDLFLIHAPLTNKEKRLG- 128
             V R  IF TTK+  TQ +  +SA   +  SL R+  LDY+DL+L+H P+  K   +  
Sbjct: 64  -GVPREKIFVTTKLWCTQQRDPQSA---LNASLERLG-LDYVDLYLMHFPVALKTDLIKD 118

Query: 129 -------------------------TWKAFQEYYETGKIKAIGVSNYGIQHLEEMYQWD- 162
                                    TW+  Q+  ++GK KAIGVSN+ I+++EE+ + + 
Sbjct: 119 GNVLSIPVRADGARDVDIDGWSFVKTWQLMQDLPKSGKTKAIGVSNFSIKNIEEILKPEL 178

Query: 163 GLKIDPMVNQYELNPWLTRKELSNYCHQKGMVIQAYSPL--TRARRLQDPELVKLVEDSY 220
           GL + P  NQ E++P L + EL  YC  KG++++AYSPL  + +  L DP+L+KL E   
Sbjct: 179 GLSV-PAANQIEIHPQLPQDELIEYCKSKGIIVEAYSPLGSSESSMLTDPDLIKLAEKHQ 237

Query: 221 PEQTSAQILVNWSLQMGFVPLVKTVHEDRLKENIKSCDFELSSADLKKLTH-----DDQY 275
            E   AQIL++W +  G+  L K+V+  R++ N+K    +LSS D+++++        + 
Sbjct: 238 VE--PAQILISWGVTRGYCILPKSVNSKRVQSNLKIV--KLSSNDVQQISKILEKLGSKR 293

Query: 276 YLSQPKWDP 284
           Y+S P W P
Sbjct: 294 YVS-PSWAP 301

>Skud_15.283 Chr15 (507542..508480) [939 bp, 312 aa] {ON} YOR120W
           (REAL)
          Length = 312

 Score =  150 bits (378), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 103/311 (33%), Positives = 165/311 (53%), Gaps = 44/311 (14%)

Query: 8   THALKNGVKMPCLGLGLYQTPKEETTNIVHNALKLGYRQVDSAQLYGNEREACLGITKFL 67
           T +L  G ++P +GLG +Q+   +    V  ALK GYR +D+A +Y NE +    I    
Sbjct: 11  TLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKDGYRHIDTAAIYRNEDQVGQAI---- 66

Query: 68  EESPKVSRSDIFFTTKIKTQDQGYESAKKSIEESLNRVKELDYIDLFLIHAP-------- 119
                V R  IF TTK+    Q +E AK ++++SL R+  LDY+DL+L+H P        
Sbjct: 67  -RDSGVPREKIFVTTKLWCT-QHHEPAK-ALDQSLRRLG-LDYVDLYLMHWPVRLDPDYI 122

Query: 120 -----LTNKEKRLG-------------TWKAFQEYYETGKIKAIGVSNYGIQHLEEMYQW 161
                L+   K+ G             TW+  QE  +TGK KA+GVSN+ I +L+++   
Sbjct: 123 KDGNILSVPTKQDGSRAVDITNWNFIKTWELMQELPKTGKAKAVGVSNFSINNLKDLLAS 182

Query: 162 DGLKIDPMVNQYELNPWLTRKELSNYCHQKGMVIQAYSPL--TRARRLQDPELVKLVEDS 219
            G K+ P  NQ E++P L + EL ++C  KG++I+ YSPL  T A  L++P ++++ + +
Sbjct: 183 KGNKLTPAANQVEIHPLLPQNELIDFCRGKGIMIEGYSPLGSTDAPLLKEPVILEIAKKN 242

Query: 220 YPEQTSAQILVNWSLQMGFVPLVKTVHEDRLKENIKSCDFELSSADLKKLT----HDDQY 275
             +   A ++++W  Q G+V L K+V+ DR+K N K   F LS  D + +        + 
Sbjct: 243 NVQ--PAHVVISWHAQRGYVVLPKSVNPDRVKANRKI--FTLSDEDFEAINGISKAKGEK 298

Query: 276 YLSQPKWDPIK 286
            +  P W P +
Sbjct: 299 RVVHPNWSPFE 309

>KLLA0D10109g Chr4 (854495..855424) [930 bp, 309 aa] {ON} similar to
           uniprot|P14065 Saccharomyces cerevisiae YOR120W GCY1
           Putative NADP( ) coupled glycerol dehydrogenase proposed
           to be involved in an alternative pathway for glycerol
           catabolism
          Length = 309

 Score =  149 bits (377), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 97/287 (33%), Positives = 145/287 (50%), Gaps = 40/287 (13%)

Query: 11  LKNGVKMPCLGLGLYQTPKEETTNIVHNALKLGYRQVDSAQLYGNEREACLGITKFLEES 70
           L  G  +P LG G + +   +    V  ALK GYR +D+A +YGNE     GI       
Sbjct: 13  LNTGASIPQLGFGTWPSSHADAYTAVITALKTGYRHIDAAAMYGNEAAVGKGI-----RD 67

Query: 71  PKVSRSDIFFTTKI-KTQDQGYESAKKSIEESLNRVKELDYIDLFLIHAPL--------- 120
             + R +IF TTK+  TQ +   SA   ++ESL R+  LDY+DLFLIH P+         
Sbjct: 68  SGIPREEIFVTTKLWNTQQRDPASA---LDESLERLG-LDYVDLFLIHWPVPLKPVGGPE 123

Query: 121 ---------------TNKEKRLGTWKAFQEYYETGKIKAIGVSNYGIQHLEEMYQWDGLK 165
                          T     + TW+  Q   +TGK +A+GVSN+ I++LE++       
Sbjct: 124 NLLKYPTPGIKPQIDTEDWSFIKTWELMQTLPKTGKTRAVGVSNFSIKNLEDLLNSSPDV 183

Query: 166 IDPMVNQYELNPWLTRKELSNYCHQKGMVIQAYSPL--TRARRLQDPELVKLVEDSYPEQ 223
           + P VNQ+E++P L + EL NYC  KG+V++AY PL  + +  L DP + + + D Y   
Sbjct: 184 LVPAVNQFEIHPQLPQTELINYCKSKGIVVEAYCPLGSSSSAMLSDPTIAE-IADKY-HV 241

Query: 224 TSAQILVNWSLQMGFVPLVKTVHEDRLKENIKSCDFELSSADLKKLT 270
             A +L+NW +  G+  L K+    R+  N       LS  D +++T
Sbjct: 242 KPANVLINWGISRGYCVLPKSFTPARIASN--KTPVHLSREDTERIT 286

>CAGL0I01100g Chr9 complement(91693..92625) [933 bp, 310 aa] {ON}
           highly similar to uniprot|P14065 Saccharomyces
           cerevisiae YOR120w GCY1 or uniprot|Q12458 Saccharomyces
           cerevisiae YDR368w YPR1
          Length = 310

 Score =  149 bits (377), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 104/314 (33%), Positives = 173/314 (55%), Gaps = 49/314 (15%)

Query: 7   TTHALKNGVKMPCLGLGLYQTPKEETTNIVHNALKLGYRQVDSAQLYGNEREACLGITKF 66
           +T  L  G  +P +GLG +Q+ + E  N    ALK GYR +D+A +Y NE E    I + 
Sbjct: 9   STLKLNTGAHIPVIGLGTWQSSENEGYNATLEALKAGYRHIDTAAIYKNEEE----IGRA 64

Query: 67  LEESPKVSRSDIFFTTKI-KTQDQGYESAKKSIEESLNRVKELDYIDLFLIHAPLTNK-- 123
           + +S  + R+++F TTK+  TQ   + +  +++++SL R+  LDY+DL+L+H P+  K  
Sbjct: 65  IRDS-NIPRNELFVTTKLWGTQ---HRNPTEALDQSLKRLG-LDYVDLYLMHWPVALKTD 119

Query: 124 -----------EKRLG-------------TWKAFQEYYETGKIKAIGVSNYGIQHLEEMY 159
                      E+  G             TW+  QE  +  K +AIGVSN+ I +L+E+ 
Sbjct: 120 LIKDGNLLQIPEREDGSRDVDLEDWNFVKTWELMQELPKE-KARAIGVSNFSINNLKELL 178

Query: 160 QWDGLKIDPMVNQYELNPWLTRKELSNYCHQKGMVIQAYSPL--TRARRLQDPELVKLVE 217
              G K+ P  NQ E++P L + EL N+C +KG+V++AYSPL  T A  L++ E+ ++ +
Sbjct: 179 NSKGNKVVPAANQIEIHPLLPQDELINFCKEKGIVLEAYSPLGSTDAPILKEEEITEIAK 238

Query: 218 DSYPEQTSAQILVNWSLQMGFVPLVKTVHEDRLKENIKSCDFELSSADLKKLT-----HD 272
            +     + Q++++W  Q G+V L K+V  +R+  N ++  F+LS  D   L+     H 
Sbjct: 239 KN--GVNAGQLVISWHAQRGYVVLPKSVKPERIHGNQET--FKLSDEDFATLSNYAKKHG 294

Query: 273 DQYYLSQPKWDPIK 286
           ++  +S P W P K
Sbjct: 295 ERRVVS-PNWGPFK 307

>YDR368W Chr4 (1213904..1214842) [939 bp, 312 aa] {ON}
           YPR1NADPH-dependent aldo-keto reductase, reduces
           multiple substrates including 2-methylbutyraldehyde and
           D,L-glyceraldehyde, expression is induced by osmotic and
           oxidative stress; functionally redundant with other
           aldo-keto reductases
          Length = 312

 Score =  148 bits (374), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 94/293 (32%), Positives = 153/293 (52%), Gaps = 40/293 (13%)

Query: 7   TTHALKNGVKMPCLGLGLYQTPKEETTNIVHNALKLGYRQVDSAQLYGNEREACLGITKF 66
            T  L  G  +P LG G +++      + V  ALK GYR +D+A +Y NE E    I   
Sbjct: 10  ATLKLNTGASIPVLGFGTWRSVDNNGYHSVIAALKAGYRHIDAAAIYLNEEEVGRAI--- 66

Query: 67  LEESPKVSRSDIFFTTKIKTQDQGYESAKKSIEESLNRVKELDYIDLFLIHAPLTNKEKR 126
             +   V R +IF TTK+   +Q     + ++ +SL R+  LDY+DL+L+H P+  K  R
Sbjct: 67  --KDSGVPREEIFITTKLWGTEQ--RDPEAALNKSLKRLG-LDYVDLYLMHWPVPLKTDR 121

Query: 127 --------------------------LGTWKAFQEYYETGKIKAIGVSNYGIQHLEEMYQ 160
                                     + TW+  QE  +TGK KA+GVSN+ I +++E+ +
Sbjct: 122 VTDGNVLCIPTLEDGTVDIDTKEWNFIKTWELMQELPKTGKTKAVGVSNFSINNIKELLE 181

Query: 161 WDGLKIDPMVNQYELNPWLTRKELSNYCHQKGMVIQAYSPLTRARR--LQDPELVKLVED 218
               K+ P  NQ E++P L + EL  +C +KG+V++AYSP   A    L++  ++ + + 
Sbjct: 182 SPNNKVVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAKK 241

Query: 219 SYPEQTSAQILVNWSLQMGFVPLVKTVHEDRLKENIKSCDFELSSADLKKLTH 271
              E   AQ++++WS+Q G+V L K+V+ +R+  N K   F L   D K +++
Sbjct: 242 HGVE--PAQLIISWSIQRGYVVLAKSVNPERIVSNFKI--FTLPEDDFKTISN 290

>ZYRO0F10032g Chr6 (813814..814746) [933 bp, 310 aa] {ON}
           uniprot|Q9HGX9 Zygosaccharomyces rouxii ZGCY2 Glycerol
           dehydrogenase
          Length = 310

 Score =  148 bits (373), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 95/290 (32%), Positives = 161/290 (55%), Gaps = 39/290 (13%)

Query: 7   TTHALKNGVKMPCLGLGLYQTPKEETTNIVHNALKLGYRQVDSAQLYGNEREACLGITKF 66
           +T  L  G  +P +GLG +++ + E    V  ALK GYR +D A +YGNE E    + K 
Sbjct: 9   STLKLNTGQTIPQVGLGTWRSKENEGYKAVIEALKAGYRHIDGAAVYGNEGE----VGKA 64

Query: 67  LEESPKVSRSDIFFTTKIKTQDQGYESAKKSIEESLNRVKELDYIDLFLIHAPLTNKEKR 126
           +++S  V R++IF TTK+    Q   + ++++++SL R+  LDY+DL+LIH P+  + + 
Sbjct: 65  IQDS-GVPRNEIFLTTKLWCTQQ--RNPQEALDQSLQRLG-LDYVDLYLIHWPVPLRTEN 120

Query: 127 LG-------------------------TWKAFQEYYETGKIKAIGVSNYGIQHLEEMYQW 161
           +                          TW+  Q+  E+GK KAIGVSN+ + +L+++   
Sbjct: 121 IKDGNLFQFAEKPDGSKDVDLEWNFIKTWELMQKLLESGKTKAIGVSNFSVNNLKDLLAA 180

Query: 162 DGLKIDPMVNQYELNPWLTRKELSNYCHQKGMVIQAYSPLT--RARRLQDPELVKLVEDS 219
              K+ P VNQ EL+P L +++L  +  + G+VI+AYSPL    A  L DP + ++ + +
Sbjct: 181 PTTKVTPAVNQVELHPLLPQEDLIKFGKENGIVIEAYSPLGGENAPILSDPTVQEIAKAN 240

Query: 220 YPEQTSAQILVNWSLQMGFVPLVKTVHEDRLKENIKSCDFELSSADLKKL 269
             E  +  ++++W++Q G V L K+V   R+  N+K     LS +D+ K+
Sbjct: 241 GVE--AGHVVISWAVQKGLVTLPKSVTPSRIVGNLKV--LTLSDSDVAKV 286

>KLTH0E15532g Chr5 complement(1380466..1381395) [930 bp, 309 aa]
           {ON} similar to uniprot|Q12458 Saccharomyces cerevisiae
           YDR368W YPR1 2-methylbutyraldehyde reductase may be
           involved in isoleucine catabolism
          Length = 309

 Score =  147 bits (372), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 92/288 (31%), Positives = 157/288 (54%), Gaps = 39/288 (13%)

Query: 11  LKNGVKMPCLGLGLYQTPKEETTNIVHNALKLGYRQVDSAQLYGNEREACLGITKFLEES 70
           L+ G  +P LG G +++ +E+  N V  ALK+GYR +D+A +YGNE  A +G  + + +S
Sbjct: 13  LRTGATIPLLGFGTWRSTEEDGYNAVLTALKVGYRHIDTAAVYGNE--AAVG--RAIRDS 68

Query: 71  PKVSRSDIFFTTKI-KTQDQGYESAKKSIEESLNRVKELDYIDLFLIHAPLTNKEKRLG- 128
             V R  +F TTK+  TQ   +   + ++++SL R+  LDY+DL+LIH PL  + +R+  
Sbjct: 69  -GVPRDQLFVTTKLWNTQ---HRDPRLALDQSLQRLG-LDYVDLYLIHWPLPLRTQRITD 123

Query: 129 ------------------------TWKAFQEYYETGKIKAIGVSNYGIQHLEEMYQWDGL 164
                                   TW+  Q+  +T K +A+GVSN+ +  L+ +    G 
Sbjct: 124 GNLFTVPTKEDGKPDVDEQWSYVKTWEMMQDLPDTSKTRAVGVSNFSVTQLQNLLAASGT 183

Query: 165 KIDPMVNQYELNPWLTRKELSNYCHQKGMVIQAYSPL-TRARRLQDPELVKLVEDSYPEQ 223
           K+ P VNQ E +P L + +L  +C +  ++++AYSPL ++   L +   VK +   +   
Sbjct: 184 KVIPAVNQVETHPLLPQDKLYKFCSENNILLEAYSPLGSQGSPLVEEPAVKEIASKH-NA 242

Query: 224 TSAQILVNWSLQMGFVPLVKTVHEDRLKENIKSCDFELSSADLKKLTH 271
             AQ+L++W ++ G+V L K+V   R++ N K  D  L+  D  K+ +
Sbjct: 243 DPAQVLISWGIKRGYVILPKSVTPSRIESNFKIVD--LTDDDFAKINN 288

>Smik_4.634 Chr4 (1133924..1134862) [939 bp, 312 aa] {ON} YDR368W
           (REAL)
          Length = 312

 Score =  145 bits (367), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 92/289 (31%), Positives = 150/289 (51%), Gaps = 40/289 (13%)

Query: 11  LKNGVKMPCLGLGLYQTPKEETTNIVHNALKLGYRQVDSAQLYGNEREACLGITKFLEES 70
           L  G  +P LG G +++ +    + V  ALK GYR +D+A +Y NE E    I     + 
Sbjct: 14  LNTGASIPVLGFGTWRSVENNGYHSVIAALKAGYRHIDAAAIYLNEEEVGRAI-----KD 68

Query: 71  PKVSRSDIFFTTKIKTQDQGYESAKKSIEESLNRVKELDYIDLFLIHAPL---------- 120
             V R DIF TTK+   +Q     + ++ ESL R+  LDY+DL+L+H P+          
Sbjct: 69  SGVPREDIFITTKLWGTEQ--RDPEAALNESLKRLG-LDYVDLYLMHWPVPLKTETITDG 125

Query: 121 ----------------TNKEKRLGTWKAFQEYYETGKIKAIGVSNYGIQHLEEMYQWDGL 164
                           T +   + TW   QE  +TGK KA+GVSN+ I +++ + +    
Sbjct: 126 NVLCIPTLDDGTVDVDTREWNFIKTWDLMQELPKTGKTKAVGVSNFSINNIKALLESPSN 185

Query: 165 KIDPMVNQYELNPWLTRKELSNYCHQKGMVIQAYSPL--TRARRLQDPELVKLVEDSYPE 222
           K+ P  NQ E++P L + EL  +C +KG+V++AYSP     A  L++  ++ + +     
Sbjct: 186 KLVPAANQIEIHPLLPQNELIAFCKEKGIVVEAYSPFGSVNAPLLEEQAIIDMAKKH--G 243

Query: 223 QTSAQILVNWSLQMGFVPLVKTVHEDRLKENIKSCDFELSSADLKKLTH 271
              AQ++++WS+Q G+V L K+V+ +R+  N K   F L   D K +++
Sbjct: 244 VAPAQLIISWSIQRGYVVLAKSVNPERIVSNFKI--FTLPEDDFKIISN 290

>Suva_2.540 Chr2 (964433..965371) [939 bp, 312 aa] {ON} YDR368W
           (REAL)
          Length = 312

 Score =  144 bits (364), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 93/293 (31%), Positives = 157/293 (53%), Gaps = 40/293 (13%)

Query: 7   TTHALKNGVKMPCLGLGLYQTPKEETTNIVHNALKLGYRQVDSAQLYGNEREACLGITKF 66
            T  L  G  +P LG G +++      + V  ALK GYR +D+A +Y NE E    + K 
Sbjct: 10  ATLKLNTGASIPVLGFGTWRSVDNSGYHSVIAALKAGYRHIDAAAIYLNEEE----VGKA 65

Query: 67  LEESPKVSRSDIFFTTKIKTQDQGYESAKKSIEESLNRVKELDYIDLFLIHAPL------ 120
           +++S  V R +IF TTK+   +Q     + ++++SL R+  LDY+DL+L+H P+      
Sbjct: 66  IKDS-GVPREEIFITTKLWGTEQ--RDPEAALDKSLKRLG-LDYVDLYLMHWPVPLKTDT 121

Query: 121 --------------------TNKEKRLGTWKAFQEYYETGKIKAIGVSNYGIQHLEEMYQ 160
                               T +   + TW   Q+  +TGK KA+GVSN+ I +++E+ +
Sbjct: 122 ITDGDFLCIPTLEDGTIDVDTKEWNFVKTWDLMQKLPKTGKTKAVGVSNFSINNIKELLK 181

Query: 161 WDGLKIDPMVNQYELNPWLTRKELSNYCHQKGMVIQAYSPLTRARR--LQDPELVKLVED 218
               K+ P  NQ E++P L + EL  +C +KG+V++AYSP   A    L++  ++ + + 
Sbjct: 182 SPSNKLVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAKK 241

Query: 219 SYPEQTSAQILVNWSLQMGFVPLVKTVHEDRLKENIKSCDFELSSADLKKLTH 271
              E   AQ++++WS+Q G+V L K+V+ +R+  N K   F L   D K +++
Sbjct: 242 HGVE--PAQLIISWSIQRGYVVLAKSVNPERVVSNFKI--FTLPEDDFKTISN 290

>Skud_4.637 Chr4 (1136769..1137707) [939 bp, 312 aa] {ON} YDR368W
           (REAL)
          Length = 312

 Score =  144 bits (363), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 91/291 (31%), Positives = 151/291 (51%), Gaps = 40/291 (13%)

Query: 7   TTHALKNGVKMPCLGLGLYQTPKEETTNIVHNALKLGYRQVDSAQLYGNEREACLGITKF 66
            T  L  G  +P LG G +++      + V  ALK GYR +D+A +Y NE E    I   
Sbjct: 10  ATLKLNTGASIPALGFGTWRSVDNNGYHSVIAALKTGYRHIDAAAIYLNEEEVGRAI--- 66

Query: 67  LEESPKVSRSDIFFTTKIKTQDQGYESAKKSIEESLNRVKELDYIDLFLIHAPL------ 120
             +   ++R +IF TTK+   +Q     + ++ ESL R+  LDY+DL+L+H P+      
Sbjct: 67  --KDSGIAREEIFITTKLWGTEQ--RDPEAALNESLKRLG-LDYVDLYLMHWPVPLKTDT 121

Query: 121 --------------------TNKEKRLGTWKAFQEYYETGKIKAIGVSNYGIQHLEEMYQ 160
                               T +   + TW   QE  +TGK +A+GVSN+ I +++E+ +
Sbjct: 122 VTDGNVLCIPTLEDGTVDVDTKEWNFIKTWDLMQELPKTGKTRAVGVSNFSINNIKELLK 181

Query: 161 WDGLKIDPMVNQYELNPWLTRKELSNYCHQKGMVIQAYSPLTRARR--LQDPELVKLVED 218
               K+ P  NQ E++P L + EL  +C +KG+V++AYSP   A    L++  ++ + + 
Sbjct: 182 SPSNKLVPATNQVEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAKK 241

Query: 219 SYPEQTSAQILVNWSLQMGFVPLVKTVHEDRLKENIKSCDFELSSADLKKL 269
              E +  Q++++WS+Q G+V L K+V+ +R+  N K   F L   D K +
Sbjct: 242 HGVEPS--QLIISWSIQRGYVVLAKSVNPERVVSNFKI--FTLPEDDFKAI 288

>KLTH0A03476g Chr1 complement(298735..299661) [927 bp, 308 aa] {ON}
           similar to uniprot|Q12458 Saccharomyces cerevisiae
           YDR368W YPR1 2-methylbutyraldehyde reductase may be
           involved in isoleucine catabolism
          Length = 308

 Score =  143 bits (361), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 92/287 (32%), Positives = 152/287 (52%), Gaps = 41/287 (14%)

Query: 11  LKNGVKMPCLGLGLYQTPKEETTNIVHNALKLGYRQVDSAQLYGNEREACLGITKFLEES 70
           L  G  +P +GLG Y +  E     V +A+K+GYR +D A LY NE      I       
Sbjct: 13  LNTGASIPLVGLGTYLSEDETGYKAVLHAIKVGYRHIDCAALYKNEDFVGRAI-----RD 67

Query: 71  PKVSRSDIFFTTKI-KTQDQGYESAKKSIEESLNRVKELDYIDLFLIHAPLTNKEKRLG- 128
             V R ++F TTK+  TQ   +    K++EESL+R+  LDY+DLFL+H P   + +R+  
Sbjct: 68  SGVPREELFVTTKVWNTQ---HREPAKALEESLSRLG-LDYVDLFLMHWPQALRTERITD 123

Query: 129 ------------------------TWKAFQEYYETGKIKAIGVSNYGIQHLEEMYQWDGL 164
                                   TW   Q+   +GK KA+GVSN+ ++ LE++    G 
Sbjct: 124 GNMITVPKREDEKPDVDTEWNYIKTWHLMQDLPASGKTKAVGVSNFSVKQLEKLLADPGS 183

Query: 165 KIDPMVNQYELNPWLTRKELSNYCHQKGMVIQAYSPL--TRARRLQDPELVKLVEDSYPE 222
           K+ P  NQ E++P L +  L ++C +K +++ AYSPL   +A  L DP ++++      +
Sbjct: 184 KVVPACNQVEVHPLLPQIPLYDFCKKKNIMLAAYSPLGSQKAPLLDDPVILEIAAKH--K 241

Query: 223 QTSAQILVNWSLQMGFVPLVKTVHEDRLKENIKSCDFELSSADLKKL 269
              AQI++ W ++ G+V L K+V   R++ N++  +  L+ ++L+K+
Sbjct: 242 ADPAQIIIGWDVKRGYVALPKSVTPSRIESNLQIVN--LTDSELEKI 286

>KAFR0E03850 Chr5 complement(764595..765530) [936 bp, 311 aa] {ON} 
          Length = 311

 Score =  138 bits (347), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 92/287 (32%), Positives = 157/287 (54%), Gaps = 43/287 (14%)

Query: 14  GVKMPCLGLGLYQ-TPKEETTNIVHNALKLGYRQVDSAQLYGNEREACLGITKFLEESPK 72
           G  +P LGLG ++ T  +E  N V +AL+ GYR +D+A +Y NE      + + + ES  
Sbjct: 17  GASLPILGLGTWRATDDQEGYNAVKSALEAGYRHIDTAAIYQNEEV----VGRAIRES-G 71

Query: 73  VSRSDIFFTTKI-KTQDQGYESAKKSIEESLNRVKELDYIDLFLIHAPLTNKEKR----- 126
           + R +IF TTK+  TQ +   +A   +++SL R+  LDY+DL+L+H P+  + K      
Sbjct: 72  IPRDEIFVTTKLWGTQHRDPAAA---LDQSLERLG-LDYVDLYLMHWPVPMEAKYSKSSS 127

Query: 127 --------------------LGTWKAFQEYYETGKIKAIGVSNYGIQHLEEMYQWDGLKI 166
                               + TW+  QE  +T K +AIGVSN+ I ++ ++ +  G KI
Sbjct: 128 LLEFPYRPDGSLAVESDWDFIKTWELMQELPKT-KTRAIGVSNFSINNINDLLKSPGNKI 186

Query: 167 DPMVNQYELNPWLTRKELSNYCHQKGMVIQAYSPL--TRARRLQDPELVKLVEDSYPEQT 224
            P  NQ EL+P L + EL  +C +KG+V++AYSP     A  L +  ++++ +    + +
Sbjct: 187 VPAANQVELHPLLPQAELVTFCQEKGIVVEAYSPFGSVSAPLLSEQAIIEVAKKH--DVS 244

Query: 225 SAQILVNWSLQMGFVPLVKTVHEDRLKENIKSCDFELSSADLKKLTH 271
           +AQ++++W ++ G   L K+VH++R+  N K+  F L   D   + +
Sbjct: 245 AAQVILSWHIKRGIAVLPKSVHKERVVSNFKT--FSLPEDDFATINN 289

>SAKL0G01914g Chr7 (162612..163601) [990 bp, 329 aa] {ON} highly
           similar to uniprot|P38715 Saccharomyces cerevisiae
           YHR104W GRE3 Aldose reductase involved in methylglyoxal
           d-xylose and arabinose metabolism stress induced
           (osmotic ionic oxidative heat shock starvation and heavy
           metals) regulated by the HOG pathway
          Length = 329

 Score =  135 bits (341), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 96/305 (31%), Positives = 159/305 (52%), Gaps = 47/305 (15%)

Query: 8   THALKNGVKMPCLGLGLYQTPKEETTNIVHNALKLGYRQVDSAQLYGNEREACLGITKFL 67
           T  L NG++MP +GLG ++ P +   + V+ A+KLGYR  D AQ YGNE+E   GI K +
Sbjct: 7   TVTLNNGLEMPLIGLGCWKIPNDVCASQVYEAIKLGYRLFDGAQDYGNEKEVGQGIKKAI 66

Query: 68  EESPKVSRSDIFFTTKIKTQDQGYESAKKSIEESLNRVKELDYIDLFLIHAPLTNK---- 123
            E   V R D+F  +K+       ++ K +++++L+ +  LDY+DLF IH PL  K    
Sbjct: 67  AEG-IVKREDLFVVSKLWNSFHHPDNVKLALKKTLDDIG-LDYLDLFYIHFPLAFKFVPF 124

Query: 124 --------------EKR----------LGTWKAFQEYYETGKIKAIGVSNYGIQHLEEMY 159
                         EK           + T++A ++  + G IK+IG+SN+    ++++ 
Sbjct: 125 EEKYPPGFYTGAEDEKNGVISQEDVPLIDTYRALEKCVDEGLIKSIGISNFNGSLVQDLL 184

Query: 160 QWDGLKIDPMVNQYELNPWLTRKELSNYCHQKGMVIQAYSPLTRARRLQ-DPEL------ 212
           +  G +I P+  Q E +P+LT++ L  YC   G+ + AYS       ++ D EL      
Sbjct: 185 R--GARIKPVALQIEHHPYLTQENLVKYCKNVGIQVVAYSSFGPQSFIELDSELAKTTPT 242

Query: 213 ------VKLVEDSYPEQTSAQILVNWSLQMGFVPLVKTVHEDRLKENIKSCD-FELSSAD 265
                 VKL+ +++   TS Q+L+ W+ Q G   + K+  ++RL EN+   D   LS  +
Sbjct: 243 LFRNDTVKLIANNHKVSTS-QVLLRWATQRGVAVIPKSSKKERLLENLTINDSLTLSDKE 301

Query: 266 LKKLT 270
           LK ++
Sbjct: 302 LKAIS 306

>SAKL0C10626g Chr3 (962421..963389) [969 bp, 322 aa] {ON} similar to
           uniprot|P38115 Saccharomyces cerevisiae YBR149W ARA1
           Large subunit of NADP dependent arabinose dehydrogenase
           involved in carbohydrate metabolism small subunit is
           unidentified
          Length = 322

 Score =  135 bits (340), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 97/293 (33%), Positives = 163/293 (55%), Gaps = 44/293 (15%)

Query: 11  LKNGVKMPCLGLGLYQTPKE--ETTNIVHNALKLGYRQVDSAQLYGNEREACLGITKFLE 68
           L  G K+P LGLG    P++  +T + V +A+K GYR +D+A +YG+E      + +  E
Sbjct: 13  LNTGAKIPSLGLGTVNPPEKMPQTKDAVKHAVKNGYRLIDTAWMYGSEPYIGEALQELFE 72

Query: 69  ESPKVSRSDIFFTTKIKTQDQGYESAKKSIEESLNRVKELDYIDLFLIHAPLT------- 121
           E   V R D+F TTK+      Y + ++S++ESL ++K LDY+DL L H PL        
Sbjct: 73  EG-VVKREDLFITTKVWPCH--YNTVEQSLQESLKQLK-LDYVDLLLQHWPLCFVKQYDE 128

Query: 122 -------------------NKEKRLGTWKAFQEYYE--TGKIKAIGVSNYGIQHLEEMYQ 160
                               K   L TWK  ++ Y+  +G+++ IGVSNY +++LE + +
Sbjct: 129 HGKLKSHPVDPKSGDIVLDEKGDYLTTWKQLEKVYKDGSGRVRNIGVSNYPVEYLERLLK 188

Query: 161 WDGLKIDPMVNQYELNPWLTRKELSNYCHQKGMVIQAYSPL--TRARRLQDPELVKLVED 218
               ++ P++NQ EL+P L ++ELS YC+  G++++++SPL  +    L+ P LVK +  
Sbjct: 189 --ETEVVPVLNQVELHPLLPQEELSEYCNSHGILMESFSPLGSSGTPHLEHP-LVKELSK 245

Query: 219 SYPEQTSAQILVNWSLQMGFVPLVKTVHEDRLKENIKSCDF-ELSSADLKKLT 270
            Y +     +L+N+ ++ G V + ++++  R+   IK+ DF  LS  DL KL+
Sbjct: 246 KY-DCEPGSVLLNYHVRKGNVVVPRSLNHGRI---IKNADFVALSEEDLDKLS 294

>TPHA0G00210 Chr7 (31978..32913) [936 bp, 311 aa] {ON} 
          Length = 311

 Score =  134 bits (338), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 86/277 (31%), Positives = 142/277 (51%), Gaps = 39/277 (14%)

Query: 8   THALKNGVKMPCLGLGLYQTPKEETTNIVHNALKLGYRQVDSAQLYGNEREACLGITKFL 67
           T+A+    K+P + LG ++    E    V  ALK GYR +D A +Y NE E    + K +
Sbjct: 11  TYAIGKDTKIPAVALGTWKAAPNEVYTAVLEALKAGYRHIDGAAIYCNEEE----VGKAI 66

Query: 68  EESPKVSRSDIFFTTKIKTQDQGYESAKKSIEESLNRVKELDYIDLFLIHAPLTNKEKRL 127
            +S  + R DIF TTK+   +Q   +  ++++ SL R+  LDY+DL+L+H P+  K   +
Sbjct: 67  RDS-GIPRKDIFVTTKLWGTEQ--RNPLRALDSSLKRLG-LDYVDLYLMHWPVALKADSI 122

Query: 128 G--------------------------TWKAFQEYYETGKIKAIGVSNYGIQHLEEMYQW 161
                                      TW+  QE   T K KAIGVSN+ I +L E+   
Sbjct: 123 TDNDLLTIPKLPSGKTDIDIENWNFIKTWELMQEL-PTSKAKAIGVSNFSINNLNELLAA 181

Query: 162 DGLKIDPMVNQYELNPWLTRKELSNYCHQKGMVIQAYSPL--TRARRLQDPELVKLVEDS 219
              K  P  NQ+E++P L + EL  YC  K ++++AY PL  +    + +P + ++   +
Sbjct: 182 PTTKTIPAANQFEIHPLLPQNELIKYCQDKKIIVEAYCPLGGSNVPLVTNPVITEIA--T 239

Query: 220 YPEQTSAQILVNWSLQMGFVPLVKTVHEDRLKENIKS 256
                + Q+L++W +Q G+V L K+V ++R+  N ++
Sbjct: 240 KLGVNAGQLLISWGIQRGYVVLPKSVRKERIVTNFQT 276

>AER401W Chr5 (1406905..1407846) [942 bp, 313 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR368W (YPR1) and
           YOR120W (GCY1)
          Length = 313

 Score =  134 bits (338), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 99/289 (34%), Positives = 153/289 (52%), Gaps = 39/289 (13%)

Query: 8   THALKNGVKMPCLGLGLYQTPKEETTNIVHNALKLGYRQVDSAQLYGNEREACLGITKFL 67
           T  L  G K+P  GLG +Q+  ++ ++ V  ALK GY+ +D+A  Y NE      + K +
Sbjct: 13  TVTLNTGAKIPLFGLGTWQSTDDDASSAVAAALKHGYKHIDTASFYKNEEL----VGKAV 68

Query: 68  EESPKVSRSDIFFTTKIKTQDQGYESAKKSIEESLNRVKELDYIDLFLIHAPLTNKEKR- 126
           +ES  + R ++F TTK+   DQ  + A  +++ SL ++   +Y+DL L+H P+  KE   
Sbjct: 69  KES-GIPREELFITTKV-WNDQQRDPAG-ALDLSLKKLGT-EYVDLLLMHWPVPFKEPEN 124

Query: 127 ------------------------LGTWKAFQEYYETGKIKAIGVSNYGIQHLEEMYQWD 162
                                   + TW   Q+   TGK+KAIGVSN+ I +LEE+   +
Sbjct: 125 STLDAYKVPRGPDGKVTRDEEWDFVKTWHLMQKLLGTGKVKAIGVSNFSINNLEELLNAE 184

Query: 163 GLKIDPMVNQYELNPWLTRKELSNYCHQKGMVIQAYSPL--TRARRLQDPELVKLVEDSY 220
           G  + P VNQ EL+  L + EL  YC +KG+V++AYSPL  + A  L+D  + K+ E   
Sbjct: 185 GTTVVPAVNQVELHIRLPQLELVEYCQKKGIVVEAYSPLGSSSAPLLKDATVNKVAEKY- 243

Query: 221 PEQTSAQILVNWSLQMGFVPLVKTVHEDRLKENIKSCDFELSSADLKKL 269
              T A +L+N+    G V L K+V E R+  N +   F++   D+K L
Sbjct: 244 -GVTPAHVLLNYVANRGIVVLPKSVKESRIISNFEY--FKMDEEDIKLL 289

>TDEL0E01910 Chr5 complement(361621..362556) [936 bp, 311 aa] {ON}
           Anc_5.434 YOR120W
          Length = 311

 Score =  133 bits (335), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 88/292 (30%), Positives = 157/292 (53%), Gaps = 39/292 (13%)

Query: 7   TTHALKNGVKMPCLGLGLYQTPKEETTNIVHNALKLGYRQVDSAQLYGNEREACLGITKF 66
           +T  L  G  +P +GLG +++ + +    V  ALK GYR +D A +Y NE E    + K 
Sbjct: 10  STVKLNTGYTIPQVGLGTWRSKEGDGYKAVTAALKAGYRHIDGAAIYLNEEE----VGKA 65

Query: 67  LEESPKVSRSDIFFTTKIKTQDQGYESAKKSIEESLNRVKELDYIDLFLIHAPLTNKEKR 126
           + +S  + R ++F TTK+    Q   + ++++E+SL R+  L+Y+DL+L+H P+  K KR
Sbjct: 66  IRDS-GIPREELFITTKLWNTQQ--RNPQEALEQSLERLG-LEYVDLYLMHWPVPLKTKR 121

Query: 127 LG-------------------------TWKAFQEYYETGKIKAIGVSNYGIQHLEEMYQW 161
           +                          TW+  QE  +T K +++GVSN+ I +L+E+   
Sbjct: 122 ITDGNLLSSPAKEDGKPDVDTEWDFVKTWELMQELPKTKKARSVGVSNFSINNLKELLAS 181

Query: 162 DGLKIDPMVNQYELNPWLTRKELSNYCHQKGMVIQAYSPLT--RARRLQDPELVKLVEDS 219
            G K+ P V Q E++P L +  L ++C +  + ++AYSPL    A  L DP ++K + D 
Sbjct: 182 PGNKLVPAVLQVEIHPLLPQYALCDFCKEHNIQVEAYSPLGGHGAPVLDDP-IIKQIADR 240

Query: 220 YPEQTSAQILVNWSLQMGFVPLVKTVHEDRLKENIKSCDFELSSADLKKLTH 271
           +    +  ++V+W +Q G V L K+   +R+  N+++  F+LS  ++  + +
Sbjct: 241 H-NADAGNVVVSWGVQRGIVTLPKSTTPERVVSNLRT--FKLSDEEMGSINN 289

>TBLA0A02835 Chr1 complement(683118..684053) [936 bp, 311 aa] {ON}
          Length = 311

 Score =  133 bits (334), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 95/292 (32%), Positives = 160/292 (54%), Gaps = 41/292 (14%)

Query: 8   THALKNGVKMPCLGLGLYQTPKEETTNIVHNALKLGYRQVDSAQLYGNEREACLGITKFL 67
           T  L NG K+P +GLG Y + + E    V  A K GYR VD+A  Y NE +    + K +
Sbjct: 11  TITLNNGTKIPVIGLGTYLSKQNEVYEAVVTAAKAGYRHVDTAAFYKNEEQ----VGKAV 66

Query: 68  EESPKVSRSDIFFTTKI-KTQDQGYESAKKSIEESLNRVKELDYIDLFLIHAPLTNKEKR 126
           ++   V RS+++ TTK+  T+ +  E+A   +++SL R+  L+YIDL+L+H P+T K   
Sbjct: 67  KDC-GVPRSEMYVTTKVWPTELRDPEAA---LDKSLKRLG-LEYIDLYLMHWPVTLKTDT 121

Query: 127 LG-------------------------TWKAFQEYYETGKIKAIGVSNYGIQHLEEMYQW 161
           +                           W+A Q+  ++GK+K+IGVSN+ I +++E+   
Sbjct: 122 IKDGELMCIPRLPDGNADVDKDWTFVQAWEAMQKLLKSGKVKSIGVSNFSINNIKELLAA 181

Query: 162 DGLKIDPMVNQYELNPWLTRKELSNYCHQKGMVIQAYSPL--TRARRLQDPELVKLVEDS 219
               + P+VNQ E+ P L   EL  +C  K ++ QAY P   + A  ++D  +V++ + +
Sbjct: 182 PTTTVVPVVNQVEVQPLLPNDELIEFCRSKDIITQAYCPFGGSEAPLIKDATVVEIAKGN 241

Query: 220 YPEQTSAQILVNWSLQMGFVPLVKTVHEDRLKENIKSCDFELSSADLKKLTH 271
             +  + Q++ +W +Q G+V L K+V E R+  N+K+  F LS AD+ K+ +
Sbjct: 242 GVD--AGQVITSWHVQRGYVVLPKSVKESRIISNLKT--FTLSDADMTKMNN 289

>TDEL0E02150 Chr5 complement(403001..403990) [990 bp, 329 aa] {ON}
           Anc_5.409 YHR104W
          Length = 329

 Score =  131 bits (330), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 86/304 (28%), Positives = 160/304 (52%), Gaps = 47/304 (15%)

Query: 10  ALKNGVKMPCLGLGLYQTPKEETTNIVHNALKLGYRQVDSAQLYGNEREACLGITKFLEE 69
            L NG+KMP +GLG ++ P E   + V+ A+K+GYR  D AQ YGNE+E   GI K ++E
Sbjct: 6   TLNNGMKMPLVGLGCWKIPNEVCASQVYEAIKIGYRLFDGAQDYGNEKEVGQGIRKAIDE 65

Query: 70  SPKVSRSDIFFTTKIKTQDQGYESAKKSIEESLNRVKELDYIDLFLIHAPLTNK------ 123
              V R ++F  +K+       ++ K +++ +L+ +K LDY+DLF IH P+  K      
Sbjct: 66  G-IVKREELFVVSKLWNSFHDPKNVKAALQRTLDDMK-LDYLDLFYIHFPIALKFVPFKE 123

Query: 124 ------------EKR----------LGTWKAFQEYYETGKIKAIGVSNYGIQHLEEMYQW 161
                       EK+          + T++A ++  + G IK+IG+SN+    + ++ + 
Sbjct: 124 KYPPGLYTGSQDEKQGTMSEENVPIIDTYRALEQLVDEGLIKSIGISNFSGSIIMDLLR- 182

Query: 162 DGLKIDPMVNQYELNPWLTRKELSNYCHQKGMVIQAYSPL--------------TRARRL 207
            G +I P+  Q E +P+LT++ L +Y   +G+ + AYS                T     
Sbjct: 183 -GCRIKPVALQIEHHPYLTQERLVHYVKLQGLQVVAYSSFGPQSFIEMGSDLAKTTPPLF 241

Query: 208 QDPELVKLVEDSYPEQTSAQILVNWSLQMGFVPLVKTVHEDRLKENIKSCD-FELSSADL 266
           ++P+++++ ++   E + +Q+L+ W+ Q     + K+  ++RL +N+   D   L+  +L
Sbjct: 242 ENPKIIEIAKNHGKEISPSQVLLRWATQNNVAVIPKSSKKERLHDNLHIDDKLTLTDQEL 301

Query: 267 KKLT 270
           K+++
Sbjct: 302 KEIS 305

>KAFR0E03840 Chr5 complement(763027..763959) [933 bp, 310 aa] {ON}
           Anc_5.434 YOR120W
          Length = 310

 Score =  131 bits (329), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 92/310 (29%), Positives = 161/310 (51%), Gaps = 44/310 (14%)

Query: 8   THALKNGVKMPCLGLGLYQ-TPKEETTNIVHNALKLGYRQVDSAQLYGNEREACLGITKF 66
           T  L +G ++P +GLG +Q T + +  N V  AL  GYR +D+A +Y NE +    I   
Sbjct: 11  TLKLNDGSQIPIVGLGTWQATDERDAYNAVRAALDAGYRHIDTAAIYKNEVQVGEAI--- 67

Query: 67  LEESPKVSRSDIFFTTKIKTQDQGYESAKKSIEESLNRVKELDYIDLFLIHAPLT----- 121
                 V R +IF TTK+   +  +   + +++ESL R+  LDY+DL+L+H P++     
Sbjct: 68  --RDSGVPREEIFVTTKL--WNAQHHEPEVALDESLQRLG-LDYVDLYLMHWPVSLDKSY 122

Query: 122 NKEKRL-------------------GTWKAFQEYYETGKIKAIGVSNYGIQHLEEMYQWD 162
            KE  L                    TW+  Q+  +  K+++IGVSN+ + +L+++ +  
Sbjct: 123 MKESPLELMKRPDGTRPVETDWTFINTWELMQKLPK-NKVRSIGVSNFSVNNLKDLLKAP 181

Query: 163 GLKIDPMVNQYELNPWLTRKELSNYCHQKGMVIQAYSPL--TRARRLQDPELVKLVEDSY 220
              + P +NQ EL+P L + EL +YC Q  + ++AYSPL  T A  L +P ++ + + + 
Sbjct: 182 TTNVVPTINQVELHPLLPQYELVDYCQQNKIEVEAYSPLGSTSAPLLSEPIVIDVAKKNG 241

Query: 221 PEQTSAQILVNWSLQMGFVPLVKTVHEDRLKENIKSCDFELSSADLKKLTHDDQ----YY 276
            +   A ++++W +Q   + L K+VH +R+  N+K+  F L   D   +    Q      
Sbjct: 242 VQ--PAHVVLSWIVQRNIIVLPKSVHAERVAANLKT--FTLPEEDFDAIGKISQQRGERR 297

Query: 277 LSQPKWDPIK 286
           ++ P ++P K
Sbjct: 298 INNPNFEPFK 307

>KLTH0F16060g Chr6 complement(1304479..1305408) [930 bp, 309 aa]
           {ON} similar to uniprot|Q12458 Saccharomyces cerevisiae
           YDR368W YPR1 2-methylbutyraldehyde reductase may be
           involved in isoleucine catabolism
          Length = 309

 Score =  130 bits (327), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 84/290 (28%), Positives = 149/290 (51%), Gaps = 39/290 (13%)

Query: 7   TTHALKNGVKMPCLGLGLYQTPKEETTNIVHNALKLGYRQVDSAQLYGNEREACLGITKF 66
            T  L  G ++P LGLG +++ KE   N    A+K GYR +D A +  NE+     I   
Sbjct: 10  ATAKLNTGAQIPLLGLGTWRSTKENGYNATLAAIKAGYRHIDIAAVCMNEQVVGRAI--- 66

Query: 67  LEESPKVSRSDIFFTTKIKTQDQGYESAKKSIEESLNRVKELDYIDLFLIHAPLTNKEKR 126
                 V R ++F TTK+      +   K ++ +SL R+  LDY+DL+++H P+  + ++
Sbjct: 67  --RDSGVPREELFVTTKLWCTQ--HRDPKTALSQSLKRLG-LDYVDLYMMHWPVAFRSEQ 121

Query: 127 LG-------------------------TWKAFQEYYETGKIKAIGVSNYGIQHLEEMYQW 161
           +                          TW+  QE   TGK  A+GV+N+ +  L+++   
Sbjct: 122 VKHTNYMLIPKRKDGQPDVDEGWDYVKTWELMQELPATGKTNALGVANFSVSQLKKLIDS 181

Query: 162 DGLKIDPMVNQYELNPWLTRKELSNYCHQKGMVIQAYSPLTR--ARRLQDPELVKLVEDS 219
            G KI P  +Q E +P+L + ++ ++C +  ++++AYSPL    A  L +P + ++ +  
Sbjct: 182 PGNKIVPAASQLETHPFLPQNKMLSFCKKNNILMEAYSPLGSEGAPLLDEPVVREISKKL 241

Query: 220 YPEQTSAQILVNWSLQMGFVPLVKTVHEDRLKENIKSCDFELSSADLKKL 269
           + E   AQ+LV+W LQ G   LVK+    R++ N+ +  F++   DL+++
Sbjct: 242 HVE--PAQLLVSWGLQRGHAVLVKSKTPSRIEANLHT--FDIPEGDLRRI 287

>YHR104W Chr8 (323409..324392) [984 bp, 327 aa] {ON}  GRE3Aldose
           reductase involved in methylglyoxal, d-xylose,
           arabinose, and galactose metabolism; stress induced
           (osmotic, ionic, oxidative, heat shock, starvation and
           heavy metals); regulated by the HOG pathway
          Length = 327

 Score =  130 bits (326), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 89/302 (29%), Positives = 157/302 (51%), Gaps = 46/302 (15%)

Query: 11  LKNGVKMPCLGLGLYQTPKEETTNIVHNALKLGYRQVDSAQLYGNEREACLGITKFLEES 70
           L NG+KMP +GLG ++  K+   N ++ A+KLGYR  D A  YGNE+E   GI K + E 
Sbjct: 7   LNNGLKMPLVGLGCWKIDKKVCANQIYEAIKLGYRLFDGACDYGNEKEVGEGIRKAISEG 66

Query: 71  PKVSRSDIFFTTKIKTQDQGYESAKKSIEESLNRVKELDYIDLFLIHAPLTNK------- 123
             VSR DIF  +K+       +  K +++++L+ +  LDY+DL+ IH P+  K       
Sbjct: 67  -LVSRKDIFVVSKLWNNFHHPDHVKLALKKTLSDMG-LDYLDLYYIHFPIAFKYVPFEEK 124

Query: 124 -----------EKR----------LGTWKAFQEYYETGKIKAIGVSNYGIQHLEEMYQWD 162
                      EK+          + T++A +E  + G IK+IGVSN+    ++++ +  
Sbjct: 125 YPPGFYTGADDEKKGHITEAHVPIIDTYRALEECVDEGLIKSIGVSNFQGSLIQDLLR-- 182

Query: 163 GLKIDPMVNQYELNPWLTRKELSNYCHQKGMVIQAYSPLTRARRLQ-------------D 209
           G +I P+  Q E +P+LT++ L  +C    + + AYS       ++             +
Sbjct: 183 GCRIKPVALQIEHHPYLTQEHLVEFCKLHDIQVVAYSSFGPQSFIEMDLQLAKTTPTLFE 242

Query: 210 PELVKLVEDSYPEQTSAQILVNWSLQMGFVPLVKTVHEDRLKENIK-SCDFELSSADLKK 268
            +++K V  ++P  T++Q+L+ W+ Q G   + K+  ++RL  N++    F L+  +LK 
Sbjct: 243 NDVIKKVSQNHPGSTTSQVLLRWATQRGIAVIPKSSKKERLLGNLEIEKKFTLTEQELKD 302

Query: 269 LT 270
           ++
Sbjct: 303 IS 304

>KLTH0F16610g Chr6 complement(1346319..1347308) [990 bp, 329 aa]
           {ON} highly similar to uniprot|P38715 Saccharomyces
           cerevisiae YHR104W GRE3 Aldose reductase involved in
           methylglyoxal d-xylose and arabinose metabolism stress
           induced (osmotic ionic oxidative heat shock starvation
           and heavy metals) regulated by the HOG pathway
          Length = 329

 Score =  129 bits (324), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 96/305 (31%), Positives = 159/305 (52%), Gaps = 47/305 (15%)

Query: 8   THALKNGVKMPCLGLGLYQTPKEETTNIVHNALKLGYRQVDSAQLYGNEREACLGITKFL 67
           T  L NG++MP +GLG ++ P E   + V+ A+KLGYR  D AQ YGNE+E   GI K +
Sbjct: 7   TVKLNNGLEMPLVGLGCWKIPNEVCASQVYEAIKLGYRLFDGAQDYGNEKEVGQGIRKAI 66

Query: 68  EESPKVSRSDIFFTTKIKTQDQGYESAKKSIEESLNRVKELDYIDLFLIHAPLTNK---- 123
           +E   V R D+F  +K+       ++ KK+++ +L  +  L+Y+DLF IH PL  K    
Sbjct: 67  DEG-IVKREDLFVVSKLWNSYHDPKNVKKALKRTLQDLG-LEYLDLFYIHFPLAFKFVPF 124

Query: 124 --------------EKR----------LGTWKAFQEYYETGKIKAIGVSNYGIQHLEEMY 159
                         EK+          L T++A ++  + G IKAIGVSN+    L ++ 
Sbjct: 125 EERYPPGFYTGAEDEKKGVISLEKVTVLDTYRALEQCVDEGLIKAIGVSNFRGILLHDLL 184

Query: 160 QWDGLKIDPMVNQYELNPWLTRKELSNYCHQKGMVIQAYSPLTRARRLQ----------- 208
              G KI P   Q E +P+LT+++L  YC Q+G+ + AYS       L+           
Sbjct: 185 A--GAKIPPACLQIEHHPYLTQEKLVEYCKQQGIQVVAYSSFGPQSFLEMDSQLAKSTPT 242

Query: 209 --DPELVKLVEDSYPEQTSAQILVNWSLQMGFVPLVKTVHEDRLKENIKSCD-FELSSAD 265
             + ++VK V +++   TS ++L+ W+ Q     + K+  ++RL  N++  +   LS  +
Sbjct: 243 LFEHDVVKKVANNHGVSTS-EVLLRWATQRRVAIIPKSSKKERLLNNLQINEKLTLSDEE 301

Query: 266 LKKLT 270
           L++++
Sbjct: 302 LQEIS 306

>KLLA0E21627g Chr5 complement(1929294..1930283) [990 bp, 329 aa]
           {ON} highly similar to uniprot|P38715 Saccharomyces
           cerevisiae YHR104W GRE3 Aldose reductase involved in
           methylglyoxal d-xylose and arabinose metabolism stress
           induced (osmotic ionic oxidative heat shock starvation
           and heavy metals) regulated by the HOG pathway
          Length = 329

 Score =  129 bits (324), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 89/318 (27%), Positives = 160/318 (50%), Gaps = 47/318 (14%)

Query: 8   THALKNGVKMPCLGLGLYQTPKEETTNIVHNALKLGYRQVDSAQLYGNEREACLGITKFL 67
           T  L NG KMP +GLG ++ P +   + ++ A+K+GYR  D AQ Y NE+E   G+ + +
Sbjct: 7   TVTLNNGEKMPLVGLGCWKMPNDVCADQIYEAIKIGYRLFDGAQDYANEKEVGQGVNRAI 66

Query: 68  EESPKVSRSDIFFTTKIKTQDQGYESAKKSIEESLNRVKELDYIDLFLIHAPL------- 120
           +E   V R D+   +K+       ++  +++E +L+ + +LDY+D+F IH PL       
Sbjct: 67  KEG-LVKREDLVVVSKLWNSFHHPDNVPRALERTLSDL-QLDYVDIFYIHFPLAFKPVPF 124

Query: 121 ---------TNKEKR------------LGTWKAFQEYYETGKIKAIGVSNYGIQHLEEMY 159
                    T KE              L TW+A ++  + GKIK++G+SN+    ++++ 
Sbjct: 125 DEKYPPGFYTGKEDEAKGHIEEEQVPLLDTWRALEKLVDQGKIKSLGISNFSGALIQDLL 184

Query: 160 QWDGLKIDPMVNQYELNPWLTRKELSNYCHQKGMVIQAYSP--------LTRARRLQDPE 211
           +  G +I P+  Q E +P+LT++ L  Y    G+ + AYS         L   + L  P 
Sbjct: 185 R--GARIKPVALQIEHHPYLTQERLIKYVKNAGIQVVAYSSFGPVSFLELENKKALNTPT 242

Query: 212 L-----VKLVEDSYPEQTSAQILVNWSLQMGFVPLVKTVHEDRLKENIKSCD-FELSSAD 265
           L     +K +   + + T  Q+L+ W+ Q G   + K+  ++RL +N++  D   L+  +
Sbjct: 243 LFEHDTIKSIASKH-KVTPQQVLLRWATQNGIAIIPKSSKKERLLDNLRINDALTLTDDE 301

Query: 266 LKKLTHDDQYYLSQPKWD 283
           LK+++  +Q       W+
Sbjct: 302 LKQISGLNQNIRFNDPWE 319

>NDAI0B05670 Chr2 (1383187..1384143) [957 bp, 318 aa] {ON} Anc_5.434
          Length = 318

 Score =  129 bits (323), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 96/316 (30%), Positives = 157/316 (49%), Gaps = 57/316 (18%)

Query: 11  LKNGVKMPCLGLGLYQT-PKEETTNIVHNALKLGYRQVDSAQLYGNEREACLGITKFLEE 69
           L  G  +P +GLG +++    +  + V  ALK GYR +D+A +YGNE +    + K + +
Sbjct: 13  LSTGASIPQIGLGTWRSVGTNDAYHSVIAALKNGYRHIDTAAIYGNEAQ----VGKAIRD 68

Query: 70  SPKVSRSDIFFTTKI---KTQDQGYESAKKSIEESLNRVKELDYIDLFLIHAPLTNKEKR 126
           S  V R++IF T+K+   +T D      K ++ ++L R+  LDYIDL+L+H P+T   + 
Sbjct: 69  S-GVPRNEIFVTSKLWCAQTHD-----PKLALNQTLKRLG-LDYIDLYLMHWPVTFNPRS 121

Query: 127 -------------------------------LGTWKAFQEYYETGKIKAIGVSNYGIQHL 155
                                          + TW+  Q   E+GK KA+GVSN+ I +L
Sbjct: 122 IKDEDGSGDAFMTIPTDSNGNVDVEMDTWNFIKTWELMQHLPESGKTKAVGVSNFSINNL 181

Query: 156 EEMYQWDGLKIDPMVNQYELNPWLTRKELSNYCHQKGMVIQAYSPL--TRARRLQDPELV 213
            ++      K+ P  NQ EL+P L + EL  YC +K ++++AYSP     A  L+D E +
Sbjct: 182 NDLLAASTTKVVPAANQIELHPLLAQNELLQYCKEKNILVEAYSPFGSINAPILKD-ETI 240

Query: 214 KLVEDSYPEQTSAQILVNWSLQM-GFVPLVKTVHEDRLKENIKSCDFELSSADLKKLTH- 271
             +      Q   Q++++W +Q  G+V L K+VHE+R+  N K     L   D + + + 
Sbjct: 241 NAIAKKLDIQV-GQVVMSWHIQRGGYVVLPKSVHEERIIANRKVV--TLPDEDFQAINNL 297

Query: 272 ---DDQYYLSQPKWDP 284
                +  +  P W P
Sbjct: 298 VKEKGELRVVDPDWSP 313

>Smik_8.182 Chr8 (299804..300787) [984 bp, 327 aa] {ON} YHR104W
           (REAL)
          Length = 327

 Score =  129 bits (324), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 89/302 (29%), Positives = 160/302 (52%), Gaps = 46/302 (15%)

Query: 11  LKNGVKMPCLGLGLYQTPKEETTNIVHNALKLGYRQVDSAQLYGNEREACLGITKFLEES 70
           L NG+KMP +GLG ++  K+   N ++ A+KLGYR  D A  YGNE+E   GI + + E 
Sbjct: 7   LNNGLKMPLVGLGCWKIDKKVCANQIYEAIKLGYRLFDGACDYGNEKEVGEGIRRAISEG 66

Query: 71  PKVSRSDIFFTTKIKTQDQGYESAKKSIEESLNRVKELDYIDLFLIHAPLTNK------- 123
             V+R D+F  +K+       +  K +++++LN +  LDY+DL+ IH P+  K       
Sbjct: 67  -LVARKDVFVVSKLWNNFHHPDHVKLALKKTLNDMG-LDYLDLYYIHFPIAFKYVPFEEK 124

Query: 124 -----------EKR----------LGTWKAFQEYYETGKIKAIGVSNYGIQHLEEMYQWD 162
                      EK+          L T++A +E  + G IK+IG+SN+    ++++ +  
Sbjct: 125 YPPGFYTGVDDEKKGHITEAHVPILDTYRALEECVDEGLIKSIGISNFQGSLVQDLLR-- 182

Query: 163 GLKIDPMVNQYELNPWLTRKELSNYCHQKGMVIQAYSP----------LTRAR---RLQD 209
           G +I P+  Q E +P+LT++ L  +C    + + AYS           L  A+    L +
Sbjct: 183 GCRIKPVALQIEHHPYLTQEHLVEFCRLHNIQVVAYSSFGPQSFIEMDLQLAKTTPTLFE 242

Query: 210 PELVKLVEDSYPEQTSAQILVNWSLQMGFVPLVKTVHEDRLKENIK-SCDFELSSADLKK 268
            +++K +  ++P  T++Q+L+ W+ Q G   + K+  ++RL  N++    F L+  +LK+
Sbjct: 243 NDVIKKISLNHPGSTTSQVLLRWATQRGIAVIPKSSKKERLLGNLEIEKKFTLTEQELKE 302

Query: 269 LT 270
           ++
Sbjct: 303 IS 304

>Suva_15.300 Chr15 (525715..526698) [984 bp, 327 aa] {ON} YHR104W
           (REAL)
          Length = 327

 Score =  128 bits (322), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 87/286 (30%), Positives = 151/286 (52%), Gaps = 45/286 (15%)

Query: 11  LKNGVKMPCLGLGLYQTPKEETTNIVHNALKLGYRQVDSAQLYGNEREACLGITKFLEES 70
           L NG KMP +GLG ++   +   N ++ A+KLGYR  D A  YGNE+E   GI K + E 
Sbjct: 7   LNNGCKMPLVGLGCWKIDNKVCANQIYEAIKLGYRLFDGACDYGNEKEVGEGIRKAISEG 66

Query: 71  PKVSRSDIFFTTKIKTQDQGYESAKKSIEESLNRVKELDYIDLFLIHAPLTNK------- 123
             V+R DIF T+K+       +  K +++++L+ +  LDY+DL+ IH P+  K       
Sbjct: 67  -LVTRKDIFVTSKLWNNFHHPDHVKLALKKTLDDMG-LDYLDLYYIHFPIAFKYVPFEEK 124

Query: 124 -----------EKR----------LGTWKAFQEYYETGKIKAIGVSNYGIQHLEEMYQWD 162
                      +KR          + T++A +   + G IK+IG+SN+    ++++ +  
Sbjct: 125 YPPGFYTGAEDDKRGHITEAHVPIIDTYRALEACVDEGLIKSIGISNFQGSLVQDLLR-- 182

Query: 163 GLKIDPMVNQYELNPWLTRKELSNYCHQKGMVIQAYSP----------LTRARR---LQD 209
           G +I P+  Q E +P+LT++ L +YC    + + AYS           L  A+    L +
Sbjct: 183 GCRIKPVALQIEHHPYLTQEHLVDYCKLHDIQVVAYSSFGPQSFIEMDLGLAKSTPTLFE 242

Query: 210 PELVKLVEDSYPEQTSAQILVNWSLQMGFVPLVKTVHEDRLKENIK 255
            ++VK V +++P  T++Q+L+ W+ Q G   + K+  ++RL  N++
Sbjct: 243 NDVVKKVSENHPGSTTSQVLLRWATQRGIAVIPKSSKKERLLGNLE 288

>CAGL0I01122g Chr9 (93934..94914) [981 bp, 326 aa] {ON} highly
           similar to uniprot|P38715 Saccharomyces cerevisiae
           YHR104w GRE3 aldose reductase
          Length = 326

 Score =  127 bits (320), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 86/285 (30%), Positives = 148/285 (51%), Gaps = 46/285 (16%)

Query: 11  LKNGVKMPCLGLGLYQTPKEETTNIVHNALKLGYRQVDSAQLYGNEREACLGITKFLEES 70
           L NG+KMP +GLG ++ P +     V++A+K+GYR  D A+ YGNE+E   GI K ++E 
Sbjct: 7   LNNGLKMPLVGLGCWKIPNDVCAQQVYDAIKIGYRLFDGAEDYGNEKEVGQGIRKAIDEG 66

Query: 71  PKVSRSDIFFTTKIKTQDQGYESAKKSIEESLNRVKELDYIDLFLIHAPL---------- 120
             V R D+F  +K+       +  K +++ +L+ +  LDY+DLF IH P+          
Sbjct: 67  -VVKREDVFVVSKLWNSFHHPDHVKMALKRTLSDMG-LDYLDLFYIHFPIAFKYVPFEEK 124

Query: 121 ------TNKEKR------------LGTWKAFQEYYETGKIKAIGVSNYGIQHLEEMYQWD 162
                 T KE              + T++A ++  E G IK+IG+SN+    ++++ +  
Sbjct: 125 YPPGFYTGKEDEKNGHITEAHVPIIDTYRALEQCVEEGLIKSIGISNFSGSLVQDLLR-- 182

Query: 163 GLKIDPMVNQYELNPWLTRKELSNYCHQKGMVIQAYS------------PLTR-ARRLQD 209
             KI P+  Q E +P+LT++ L  YC   G+ + AYS            PL +    L  
Sbjct: 183 QCKIKPVALQVEHHPYLTQEHLVEYCKDNGIQVVAYSSFGPQSYIELNHPLAKNTPNLFH 242

Query: 210 PELVKLVEDSYPEQTSAQILVNWSLQMGFVPLVKTVHEDRLKENI 254
            + +K + +++   TS Q+L+ W+ Q G   + K+  ++RL++N+
Sbjct: 243 HDTIKQIANNHNVATS-QVLLRWATQRGIAIIPKSSKKERLQDNL 286

>Kwal_55.21536 s55 complement(877191..878180) [990 bp, 329 aa] {ON}
           YHR104W (GRE3) - a keto-aldose reductase [contig 128]
           FULL
          Length = 329

 Score =  127 bits (319), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 95/311 (30%), Positives = 161/311 (51%), Gaps = 46/311 (14%)

Query: 1   MRFTPGTTHALKNGVKMPCLGLGLYQTPKEETTNIVHNALKLGYRQVDSAQLYGNEREAC 60
           M +T  T   L NG++MP +GLG ++ P E   + V+ A+KLGYR  D AQ YGNE+E  
Sbjct: 1   MTYTSETVK-LNNGLQMPLVGLGCWKIPNEVCASQVYEAIKLGYRLFDGAQDYGNEKEVG 59

Query: 61  LGITKFLEESPKVSRSDIFFTTKIKTQDQGYESAKKSIEESLNRVKELDYIDLFLIHAPL 120
            GI K ++E   V R D+F  +K+       ++ KK+++ +L  + EL+Y+DLF IH PL
Sbjct: 60  QGIHKAIDEG-IVKREDLFVVSKLWNSYHDPKNVKKALKRTLEDM-ELEYLDLFYIHFPL 117

Query: 121 TNK-----EKR-----------------------LGTWKAFQEYYETGKIKAIGVSNYGI 152
             K     EK                        + T++A +E  + G IK+IG+SN+  
Sbjct: 118 AFKYVPFEEKYPPGFYTGAEDAKKGVISLEQVPIIDTYRALEECVKEGLIKSIGISNFRG 177

Query: 153 QHLEEMYQWDGLKIDPMVNQYELNPWLTRKELSNYCHQKGMVIQAYSPLTRARRLQ-DPE 211
             + ++    G  I P+  Q E +P+LT+++L  YC Q+ + + AYS       L+ D E
Sbjct: 178 ILIHDLLA--GATIKPVCLQIEHHPYLTQEKLIEYCAQEQIQVVAYSSFGPQSFLELDSE 235

Query: 212 LVKLVEDSYPEQ-----------TSAQILVNWSLQMGFVPLVKTVHEDRLKENIKSCD-F 259
           L K     +  +           +S+Q+L+ W+ Q     + K+  ++RL +N++  +  
Sbjct: 236 LAKSTPTLFEHEGIQKIATNHGVSSSQVLLRWATQRRIAIIPKSSKKERLLDNLQINEKL 295

Query: 260 ELSSADLKKLT 270
            L+ A+L++++
Sbjct: 296 TLTEAELQEIS 306

>NCAS0F03380 Chr6 (682072..683013) [942 bp, 313 aa] {ON} Anc_5.434
          Length = 313

 Score =  127 bits (318), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 91/312 (29%), Positives = 157/312 (50%), Gaps = 49/312 (15%)

Query: 8   THALKNGVKMPCLGLGLYQT-PKEETTNIVHNALKLGYRQVDSAQLYGNEREACLGITKF 66
           T  L  G  +P + LG +++    +  + V  ALK GYR +D+A +YGNE +    + K 
Sbjct: 11  TLKLNTGANIPEISLGTWRSLGATDGYDSVIAALKAGYRHIDTAAIYGNEDQ----VGKA 66

Query: 67  LEESPKVSRSDIFFTTKIKTQDQGYESAKKSIEESLNRVKELDYIDLFLIHAPLTNKEKR 126
           + +S  + R +IF T+K+    Q   +   +++++L+R+         + H P+T   + 
Sbjct: 67  IRDS-GIPREEIFVTSKLWNTQQ--HNPAGALKDTLSRLGLDYLDLYLM-HWPVTFNTRN 122

Query: 127 --------------------------LGTWKAFQEYYETGKIKAIGVSNYGIQHLEEMYQ 160
                                     + TW+  QE   TG  KA+GVSN+ I +L+E+  
Sbjct: 123 VKGTDFMVIPKNENGKPDIEMDTWNFVKTWELMQELPATGMTKAVGVSNFSINNLKELLT 182

Query: 161 WDGLKIDPMVNQYELNPWLTRKELSNYCHQKGMVIQAYSPL--TRARRLQDPELVKLVE- 217
             G K+ P  NQ E++P L   +L  +C +KG++I+AYSPL    A  L++P+++++ + 
Sbjct: 183 SPGNKLTPAANQIEIHPLLPEHDLIKFCREKGIMIEAYSPLGSINAPILKEPKIIEISKK 242

Query: 218 -DSYPEQTSAQILVNWSLQMGFVPLVKTVHEDRLKENIKSCDFELSSADLKKLTH----D 272
            D  P    AQ++++W +Q G+V LVK+ HE+R+  N K   F LS  D + + +     
Sbjct: 243 LDVPP----AQLIISWHVQRGYVVLVKSTHEERIIANRKV--FTLSKEDFEAIKNLAKEK 296

Query: 273 DQYYLSQPKWDP 284
               +  P W P
Sbjct: 297 GTLRVVDPDWSP 308

>NDAI0D01600 Chr4 (382637..383620) [984 bp, 327 aa] {ON} 
          Length = 327

 Score =  127 bits (318), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 89/315 (28%), Positives = 152/315 (48%), Gaps = 46/315 (14%)

Query: 11  LKNGVKMPCLGLGLYQTPKEETTNIVHNALKLGYRQVDSAQLYGNEREACLGITKFLEES 70
           L NG+KMP +GLG ++ P       +++A+K+GYR  D A  YGNE+E   GI + ++E 
Sbjct: 7   LNNGLKMPLVGLGCWKIPTSTCAQQIYDAIKVGYRLFDGATDYGNEKEVGQGIKRAIDEG 66

Query: 71  PKVSRSDIFFTTKIKTQDQGYESAKKSIEESLNRVKELDYIDLFLIHAPL---------- 120
             V R D+F  +K+       +  K +++ +L  +  LDY+DL+ IH P+          
Sbjct: 67  -LVKREDLFIVSKLWNNFHHPDHVKLNLQRNLKDLG-LDYVDLYYIHFPIAFKFVSPDER 124

Query: 121 ------TNKEKR------------LGTWKAFQEYYETGKIKAIGVSNYGIQHLEEMYQWD 162
                 T KE              + T++A ++  + G IK+IG+SNY    + +  +  
Sbjct: 125 YPPGMYTGKEDEAKGILTEENVPLIDTYRAMEKLVDEGLIKSIGISNYNGGLVADTLR-- 182

Query: 163 GLKIDPMVNQYELNPWLTRKELSNYCHQKGMVIQAYSPL-------------TRARRLQD 209
           G +I P+  Q E +P+LT+++L  YC    + + AYS                    L D
Sbjct: 183 GCRIKPVALQIEHHPYLTQEKLLEYCKIHDVQVVAYSSFGPQSFVDCGQEMAKNTPPLFD 242

Query: 210 PELVKLVEDSYPEQTSAQILVNWSLQMGFVPLVKTVHEDRLKENIK-SCDFELSSADLKK 268
              +K + D Y   T++Q+L+ W+ Q G   + K+  ++RL EN+       L+  DL++
Sbjct: 243 HPTIKKIADKYEAVTTSQVLLRWATQRGVAIIPKSSKKERLLENLTIDQKVTLAEEDLRE 302

Query: 269 LTHDDQYYLSQPKWD 283
           ++  +Q       WD
Sbjct: 303 ISALNQNLRFNDPWD 317

>TPHA0E01760 Chr5 complement(354862..355794) [933 bp, 310 aa] {ON}
           Anc_5.434 YOR120W
          Length = 310

 Score =  126 bits (316), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 99/309 (32%), Positives = 158/309 (51%), Gaps = 50/309 (16%)

Query: 11  LKNGVKMPCLGLGLYQTPKEETTNIVHNALKLGYRQVDSAQLYGNEREACLGITKFLEES 70
           L +G ++P +GLG +Q+ + +    V  ALK GYR +D+A +YGNE E    I     + 
Sbjct: 12  LNDGNQLPYVGLGTWQSKENDAYKAVVAALKAGYRHIDTAAIYGNEEEVGRAI-----KD 66

Query: 71  PKVSRSDIFFTTKI-KTQDQGYESAKKSIEESLNRVKELDYIDLFLIHAPLTNKEKR--- 126
             V RS+IF TTK+  TQ +  + A   + +SL R+  LDY+DL+L+H P+   + +   
Sbjct: 67  SGVRRSEIFVTTKLWGTQHRHPDDA---LNQSLERLG-LDYVDLYLMHWPVPINDAQCKK 122

Query: 127 ------------------------LGTWKAFQEYYETGKIKAIGVSNYGIQHLEEMYQWD 162
                                   + TW+  Q   ++ K+K+IGVSN+ I +++++    
Sbjct: 123 DNNYLQIPMNEDGTRDLDLASWDFIKTWELMQALPKS-KVKSIGVSNFSINNIKDLLASP 181

Query: 163 GLKIDPMVNQYELNPWLTRKELSNYCHQKGMVIQAYSPL--TRARRLQDPELVKLVEDSY 220
           G K  P+VNQ EL+P L + EL  +C  K +V++AYSPL  T A  L   EL  + E S 
Sbjct: 182 GNKEVPVVNQVELHPLLPQFELVEFCKSKNIVVEAYSPLGSTGAPIL---ELGTINEVSK 238

Query: 221 PEQT-SAQILVNWSLQMGFVPLVKTVHEDRLKENIKSCDFELSSADLKKLTHDD----QY 275
                 A ++ +W +Q   V L K+V E R+  N+++   EL + +  KL +      + 
Sbjct: 239 KLAIPPANVVFSWLIQRKIVVLPKSVTESRIISNLQT--MELPAEEFSKLNNISSEVGEK 296

Query: 276 YLSQPKWDP 284
              +P W P
Sbjct: 297 RSVKPNWTP 305

>TBLA0F01720 Chr6 complement(430289..431269) [981 bp, 326 aa] {ON} 
          Length = 326

 Score =  126 bits (317), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 93/315 (29%), Positives = 157/315 (49%), Gaps = 47/315 (14%)

Query: 10  ALKNGVKMPCLGLGLYQTPKEETTNIVHNALKLGYRQVDSAQLYGNEREACLGITKFLEE 69
           AL NG+KMP +GLG ++ P       V+ A+KLGYR  D A+ YGNE+E   GI + ++E
Sbjct: 6   ALNNGLKMPMVGLGCWKIPNTVCAEQVYQAIKLGYRLFDGAEDYGNEKEVGQGIRRAIDE 65

Query: 70  SPKVSRSDIFFTTKIKTQDQGYESAKKSIEESLNRVKELDYIDLFLIHAPL--------- 120
              V RSD+F  +K+       +  K +++++L+ +  LDY+DL+ IH PL         
Sbjct: 66  K-IVKRSDLFIVSKLWNTYHHPDHVKLAVKKTLSDLG-LDYLDLYYIHFPLAFKFVPIEE 123

Query: 121 -------TNKEKR------------LGTWKAFQEYYETGKIKAIGVSNYGIQHLEEMYQW 161
                  T KE              L T+ A +   E G IK+IGVSN     L+++   
Sbjct: 124 KYPPGFYTGKEDAAQGKISLQKVPYLDTYHAMEALVEEGLIKSIGVSNLQGGLLQDVLM- 182

Query: 162 DGLKIDPMVNQYELNPWLTRKELSNYCHQKGMVIQAYSPLTRARRLQ------------- 208
            G KI P+  Q E +P+LT+  L +YC ++ +++ AYS   +   L+             
Sbjct: 183 -GCKIKPVTLQIEHHPYLTQSRLVDYCKREQIIVVAYSSFGQQSYLELGSELKEDTPNLF 241

Query: 209 DPELVKLVEDSYPEQTSAQILVNWSLQMGFVPLVKTVHEDRLKENIK-SCDFELSSADLK 267
           D  ++K +   Y   T++++L+ W+ Q G   + K+  ++RL  N+       LS+ +L 
Sbjct: 242 DHPVIKRIASKY-NVTTSEVLLRWANQNGVAVIPKSSKKERLLMNLNIESTLTLSNEELV 300

Query: 268 KLTHDDQYYLSQPKW 282
           ++++ ++       W
Sbjct: 301 EISNINRNIRFNDTW 315

>KAFR0G01350 Chr7 (304389..305363) [975 bp, 324 aa] {ON} Anc_3.108
           YBR149W
          Length = 324

 Score =  126 bits (316), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 95/295 (32%), Positives = 157/295 (53%), Gaps = 47/295 (15%)

Query: 11  LKNGVKMPCLGLGLYQTPKE---ETTNIVHNALKLGYRQVDSAQLYGNEREACLGITKFL 67
           L NG  +P LG G Y  P+E   ET   V  A+K GYR +D+A +Y +E      I + +
Sbjct: 13  LNNGTTIPALGFGTY-APRERIPETKQAVKAAIKAGYRHIDTAWVYESEPYVGEAIKEMI 71

Query: 68  EESPKVSRSDIFFTTKIKTQDQGYESAKKSIEESLNRVKELDYIDLFLIHAPL------- 120
           EE  +VSRSD+F TTK+      +++ +KS+ ESL  +  LDY+DL L H PL       
Sbjct: 72  EEG-EVSRSDLFVTTKV--WPVYWDNVEKSLNESLEALG-LDYVDLLLQHWPLCFPRVED 127

Query: 121 ---------------------TNKEKRLGTWKAFQEYY---ETGKIKAIGVSNYGIQHLE 156
                                  K   L T++  ++ Y   +  +++AIGVSNY I++LE
Sbjct: 128 EKNGVNGLVAYPEDDEGKPLLNEKGDFLETYRQIEKIYLNPDDHRVRAIGVSNYAIEYLE 187

Query: 157 EMYQWDGLKIDPMVNQYELNPWLTRKELSNYCHQKGMVIQAYSPLTR--ARRLQDPELVK 214
            +++    K+ P+VNQ E++P L + EL+ +CH  G+++ AYSPL    A  L+ P LV 
Sbjct: 188 ALFK--ECKVKPVVNQVEIHPHLPQLELNKFCHNHGILLTAYSPLGSDGAPNLKIP-LVH 244

Query: 215 LVEDSYPEQTSAQILVNWSLQMGFVPLVKTVHEDRLKENIKSCDFELSSADLKKL 269
            + + Y + +   IL+++ ++ G   + ++++  R+   I+   F  +  +LK+L
Sbjct: 245 QLAEKY-DMSLNDILISYHIRKGNTVIPRSLNPVRIASTIEFAPF--TQEELKQL 296

>Skud_8.165 Chr8 (297201..298184) [984 bp, 327 aa] {ON} YHR104W
           (REAL)
          Length = 327

 Score =  125 bits (315), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 87/302 (28%), Positives = 160/302 (52%), Gaps = 46/302 (15%)

Query: 11  LKNGVKMPCLGLGLYQTPKEETTNIVHNALKLGYRQVDSAQLYGNEREACLGITKFLEES 70
           L NG+KMP +GLG ++  K    N ++ A+KLGYR  D A  YGNE+E   GI K + E 
Sbjct: 7   LNNGLKMPLVGLGCWKIDKNACANQIYEAIKLGYRLFDGACDYGNEKEVGEGIRKAIYEG 66

Query: 71  PKVSRSDIFFTTKIKTQDQGYESAKKSIEESLNRVKELDYIDLFLIHAPL---------- 120
             V+R D+F  +K+       +  K +++++L+ +  LDY+DL+ IH P+          
Sbjct: 67  -LVTRKDVFVVSKLWNNFHHPDHVKLALKKTLSDMG-LDYLDLYYIHFPIAFKYIPFEEK 124

Query: 121 --------TNKEKR----------LGTWKAFQEYYETGKIKAIGVSNYGIQHLEEMYQWD 162
                   T  E++          + T++A ++  + G IK+IG+SN+    ++++ +  
Sbjct: 125 YPPGFYTGTEDEEKGHITEAHVPIIDTYRALEKCVDEGLIKSIGISNFQGSLVQDLLR-- 182

Query: 163 GLKIDPMVNQYELNPWLTRKELSNYCHQKGMVIQAYSP------------LTRARR-LQD 209
           G +I P+  Q E +P+LT++ L  +C    + + AYS             L +A + L +
Sbjct: 183 GCRIKPVALQIEHHPYLTQEHLVEFCKLHDIQVVAYSSFGPQSFIEMDLQLAKATQTLFE 242

Query: 210 PELVKLVEDSYPEQTSAQILVNWSLQMGFVPLVKTVHEDRLKENIK-SCDFELSSADLKK 268
            +++K V +++   T++Q+L+ W+ Q G   + K+  ++RL  N++    F L+  +LKK
Sbjct: 243 NDVIKKVSENHTGSTTSQVLLRWATQRGIAVIPKSSKKERLLGNLEIEKKFSLTEQELKK 302

Query: 269 LT 270
           ++
Sbjct: 303 IS 304

>KAFR0C05320 Chr3 complement(1065934..1066917) [984 bp, 327 aa] {ON}
           
          Length = 327

 Score =  124 bits (310), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 87/290 (30%), Positives = 145/290 (50%), Gaps = 47/290 (16%)

Query: 11  LKNGVKMPCLGLGLYQTPKEETTNIVHNALKLGYRQVDSAQLYGNEREACLGITKFLEES 70
           L NG KMP +GLG ++   +     V+ A+KLGYR  D A  YGNE E   GI K ++E 
Sbjct: 7   LNNGQKMPLVGLGCWKISNDICAEQVYQAIKLGYRLFDGATDYGNEVEVGQGIKKAIDEG 66

Query: 71  PKVSRSDIFFTTKIKTQDQGYESAKKSIEESLNRVKELDYIDLFLIHAPLTNK-----EK 125
             V RSD+F  +K+       +  K +++ +L  +  LDYIDL+ IH P+  K     EK
Sbjct: 67  -LVKRSDLFVVSKLWNSYHHPDHVKLALKRNLQDLG-LDYIDLYYIHFPIAFKFVPFEEK 124

Query: 126 R-----------------------LGTWKAFQEYYETGKIKAIGVSNYGIQHLEEMYQWD 162
                                   L T++A +E  + G IK+IG+SN+    ++++   +
Sbjct: 125 YPPGFYTGVDDAREGILSEAKVPILDTYRALEECVDNGLIKSIGISNFNGVLVQDLL--N 182

Query: 163 GLKIDPMVNQYELNPWLTRKELSNYCHQKGMVIQAYSPL--------------TRARRLQ 208
           G +I P+  Q E +P+LT+++L  YC  KG+ + AYS                +    L+
Sbjct: 183 GCRIKPVALQIEHHPYLTQEKLVEYCKLKGIQVVAYSSFGPQSFIELDSQLAKSTPSLLE 242

Query: 209 DPELVKLVEDSYPEQTSAQILVNWSLQMGFVPLVKTVHEDRLKENIKSCD 258
            P ++K +  ++   T +++L+ W+ Q G   + K+  ++RL +N+   D
Sbjct: 243 HP-IIKKIAAAHRSSTPSEVLLRWATQRGIAVIPKSTKKERLLQNLNVED 291

>Ecym_5508 Chr5 (1035144..1036124) [981 bp, 326 aa] {ON} similar to
           Ashbya gossypii ACL107C
          Length = 326

 Score =  122 bits (307), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 87/299 (29%), Positives = 153/299 (51%), Gaps = 47/299 (15%)

Query: 8   THALKNGVKMPCLGLGLYQTPKEETTNIVHNALKLGYRQVDSAQLYGNEREACLGITKFL 67
           T+ L NG+KMP +GLG ++   +     V+ A+KLGYR  D A  YGNE+E  +GI + +
Sbjct: 6   TYTLNNGMKMPVVGLGCWKLSADVAATQVYEAIKLGYRLFDGALCYGNEKEIGVGIKQAI 65

Query: 68  EESPKVSRSDIFFTTKIKTQDQGYESAKKSIEESLNRVKELDYIDLFLIHAPL------- 120
            E   V R D+F  +K+       +  K +++ +LN +  LDY+DL+ IH PL       
Sbjct: 66  NEG-LVKREDLFIVSKLWCNFHHPDHVKLALQRTLNDLG-LDYVDLYYIHFPLPIKYVPL 123

Query: 121 ---------TNKEKR------------LGTWKAFQEYYETGKIKAIGVSNYGIQHLEEMY 159
                    T +E R            L T++A ++  + G +K++G+SN+    ++++ 
Sbjct: 124 EEKYPPEMYTGEEDRRNNIVSEQQVPILDTYRAMEKLVDEGLVKSLGLSNFQACLIQDLL 183

Query: 160 QWDGLKIDPMVNQYELNPWLTRKELSNYCHQKGMVIQAYS---PLT----------RARR 206
           +  G +I P+  Q EL+P+L+++ L  Y   K + + AYS   PL+              
Sbjct: 184 R--GARIKPVALQVELHPYLSQERLVTYAQSKDIQVVAYSTFGPLSFLELGNSAAKDVTP 241

Query: 207 LQDPELVKLVEDSYPEQTSAQILVNWSLQMGFVPLVKTVHEDRLKENIKSCDFELSSAD 265
           L + E+V  +   + + T +Q+++ W+ Q G   + K+  ++RL  N+ S D  L+ +D
Sbjct: 242 LLEHEIVLNIAKKH-DVTPSQVILRWATQRGIAVIPKSSKKERLLNNLNS-DKALTLSD 298

>ACL107C Chr3 complement(152564..153628) [1065 bp, 354 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YHR104W
           (GRE3)
          Length = 354

 Score =  122 bits (306), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 92/320 (28%), Positives = 155/320 (48%), Gaps = 51/320 (15%)

Query: 8   THALKNGVKMPCLGLGLYQTPKEETTNIVHNALKLGYRQVDSAQLYGNEREACLGITKFL 67
           T  L NG  MP +GLG ++ P E     V+ A+KLGYR +D A+ Y NERE   GI + +
Sbjct: 32  TIKLNNGADMPLVGLGCWKIPNEVAAEQVYEAIKLGYRLLDGAEDYANEREVGQGIRRAI 91

Query: 68  EESPKVSRSDIFFTTKIKTQDQGYESAKKSIEESLNRVKELDYIDLFLIHAPLTNK---- 123
           +E   V R ++F  +K+       E   K+++ +L+ +  LDY+DLF IH PL  K    
Sbjct: 92  DEG-LVRREELFVVSKLWNNYHRPEDVGKALQRTLSDLG-LDYLDLFYIHFPLAFKFVPL 149

Query: 124 EKR------------------------LGTWKAFQEYYETGKIKAIGVSNYGIQHLEEMY 159
           E+R                        + T++A ++  + G+I+AIG+SN+    ++++ 
Sbjct: 150 EERYPAGLYTGAADEQAGRLAQEPVPLIETYRALEQLVDEGRIRAIGLSNFQGCLVQDLL 209

Query: 160 QWDGLKIDPMVNQYELNPWLTRKELSNYCHQKGMVIQAYSPL--------------TRAR 205
           +  G +I P   Q E +P+LT++ L  Y   +G+ +  YS L                A 
Sbjct: 210 R--GCRIRPAALQIEHHPYLTQERLVQYAKSEGLAVVGYSSLGPQSFLELGNTAAQNAAP 267

Query: 206 RLQDPELVKLVEDSYPEQTSAQILVNWSLQMGFVPLVKTVHEDRLKENIKSCDFELSSAD 265
            LQ   + ++ E      T A++L+ W+ Q     + K+  ++RL  N++  D  L+ AD
Sbjct: 268 LLQHEVVCRIAERH--TATPAEVLLRWATQRDIAVIPKSSRKERLATNLR-VDEALTLAD 324

Query: 266 --LKKLTHDDQYYLSQPKWD 283
             L++L+  +        WD
Sbjct: 325 DELRELSSLNCGLRFNDPWD 344

>Kwal_55.21426 s55 complement(832981..833907) [927 bp, 308 aa] {ON}
           YOR120W (GCY1) - Similar to mammalian aldo/keto
           reductases [contig 130] FULL
          Length = 308

 Score =  120 bits (302), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 88/290 (30%), Positives = 152/290 (52%), Gaps = 40/290 (13%)

Query: 7   TTHALKNGVKMPCLGLGLYQTPKEETTNIVHNALKLGYRQVDSAQLYGNEREACLGITKF 66
            T  L  G K+P LGLG ++  KE     +  ALK GYR +DSA +  NE+     I K 
Sbjct: 10  ATATLNTGAKIPLLGLGTWRLTKEGGYKAILAALKAGYRHIDSAAVCMNEQV----IGKA 65

Query: 67  LEESPKVSRSDIFFTTKIKTQDQGYESAKKSIEESLNRVKELDYIDLFLIHAPLT----- 121
           + +S  V R ++F TTK+ +      SA  ++++SL R+  L+Y+DL+++H PL      
Sbjct: 66  IRDS-GVRRDELFVTTKLWSTQHRDPSA--ALDQSLKRLG-LEYVDLYMMHWPLAFRVDQ 121

Query: 122 -----------NKEKR---------LGTWKAFQEYYETGKIKAIGVSNYGIQHLEEMYQW 161
                      N E +         + TW+  Q+   T K +AIGV+N+ +  L  + + 
Sbjct: 122 IKAKNFMLIPRNSEGKPYVDTDWDYVKTWELMQKL-PTEKTRAIGVANFSVPQLTSLLKS 180

Query: 162 DGLKIDPMVNQYELNPWLTRKELSNYCHQKGMVIQAYSPL--TRARRLQDPELVKLVEDS 219
              KI P  +Q E +P+L   E+  +C +KG++++AYSPL       + +P + ++ +  
Sbjct: 181 PNNKIIPAASQLETHPFLPHDEMLAFCREKGILMEAYSPLGGDGGPLIDEPVIREISKKL 240

Query: 220 YPEQTSAQILVNWSLQMGFVPLVKTVHEDRLKENIKSCDFELSSADLKKL 269
           + E   AQ+L++W L+ G   L K+  + R++ N++   F+LS  D +++
Sbjct: 241 HVE--PAQLLISWGLKRGCAVLPKSKTQTRIESNLEV--FDLSDEDYERI 286

>TPHA0E01860 Chr5 complement(373074..374054) [981 bp, 326 aa] {ON}
           Anc_5.409 YHR104W
          Length = 326

 Score =  120 bits (301), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 84/285 (29%), Positives = 142/285 (49%), Gaps = 46/285 (16%)

Query: 11  LKNGVKMPCLGLGLYQTPKEETTNIVHNALKLGYRQVDSAQLYGNEREACLGITKFLEES 70
           L NG+KMP +GLG ++ P +     V+ A+KLGYR  D AQ YGNE+E   GI + + E 
Sbjct: 7   LNNGLKMPIVGLGCWKIPNDTCAAQVYEAIKLGYRAFDGAQDYGNEKEVGEGINQAISEG 66

Query: 71  PKVSRSDIFFTTKIKTQDQGYESAKKSIEESLNRVKELDYIDLFLIHAPL---------- 120
             V R ++F  +K+       +  K +++ +L+ +K LDY+DL+ IH P+          
Sbjct: 67  -IVKREELFVISKLWNSYHDPKHVKMALQRTLSDMK-LDYLDLYYIHFPIAFKFVPFEEK 124

Query: 121 ------TNKEKR------------LGTWKAFQEYYETGKIKAIGVSNYGIQHLEEMYQWD 162
                 T KE              + T++A ++    G IK+IG+SN+    ++++ +  
Sbjct: 125 YPAGFYTGKEDAEKGIISEEVVPLIDTYRAMEQLATDGLIKSIGISNFNGALIQDLLR-- 182

Query: 163 GLKIDPMVNQYELNPWLTRKELSNYCHQKGMVIQAYSPL-------------TRARRLQD 209
             KI P   Q E +P+LT+  L  YC    + + AYS                 A+ L +
Sbjct: 183 SCKIKPTCLQIEHHPYLTQPHLIEYCKLNDIQVVAYSSFGPQSFLELNVQKALDAKVLFE 242

Query: 210 PELVKLVEDSYPEQTSAQILVNWSLQMGFVPLVKTVHEDRLKENI 254
            E++K +  ++  + S Q+L+ W+ Q G   + K+  ++RL EN+
Sbjct: 243 HEVIKSIATNHSVEPS-QVLLRWATQRGIAIIPKSSKKERLLENL 286

>TBLA0A00630 Chr1 complement(126399..127385) [987 bp, 328 aa] {ON} 
          Length = 328

 Score =  119 bits (299), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 87/316 (27%), Positives = 155/316 (49%), Gaps = 47/316 (14%)

Query: 11  LKNGVKMPCLGLGLYQTPKEETTNIVHNALKLGYRQVDSAQLYGNEREACLGITKFLEES 70
           L NG+KMP +GLG ++ P +   + V+ A+KLGYR  D A  YGNE+E   GI K L E 
Sbjct: 7   LNNGLKMPLVGLGCWKIPNDVCASQVYEAIKLGYRLFDGAADYGNEKEVGQGINKALSEG 66

Query: 71  PKVSRSDIFFTTKIKTQDQGYESAKKSIEESLNRVKELDYIDLFLIHAPLTNK------- 123
             V RSD+F  +K+       +  K +++ +L+ +  LDY+DL+ IH PL  K       
Sbjct: 67  -IVKRSDLFIISKLWNTFHHPDHVKLALQRTLSDLG-LDYLDLYYIHFPLAFKYVPFEEK 124

Query: 124 ----------EKRLG-----------TWKAFQEYYETGKIKAIGVSNYGIQHLEEMYQWD 162
                     + ++G           T++A ++  + G  K+IGVSN     L+++    
Sbjct: 125 YPPCFYTGAEDAKIGKISLQNVPYLDTYRAMEKLVDEGLTKSIGVSNLQGSILQDVLM-- 182

Query: 163 GLKIDPMVNQYELNPWLTRKELSNYCHQKGMVIQAYSPL-------TRARRLQD------ 209
           G +I P   Q E +P+LT++ L  +C  + + + +YS           ++R +D      
Sbjct: 183 GCRIRPAALQIEHHPYLTQEHLVQFCKNENIAVVSYSSFGPQSFLELGSKRAEDTPALFD 242

Query: 210 -PELVKLVEDSYPEQTSAQILVNWSLQMGFVPLVKTVHEDRLKENIKSCD-FELSSADLK 267
            P + K+      + T++++L+ W+ Q     + K+  ++RL  N+   +   L+ A+L 
Sbjct: 243 HPVIKKIAAAHGKDVTTSEVLLRWATQRDIAIIPKSSRKERLLLNLNVNEKLTLTEAELL 302

Query: 268 KLTHDDQYYLSQPKWD 283
           +++  ++       WD
Sbjct: 303 EISALNKNIRFNDTWD 318

>KNAG0B03780 Chr2 (725307..726287) [981 bp, 326 aa] {ON} 
          Length = 326

 Score =  119 bits (297), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 87/318 (27%), Positives = 156/318 (49%), Gaps = 47/318 (14%)

Query: 8   THALKNGVKMPCLGLGLYQTPKEETTNIVHNALKLGYRQVDSAQLYGNEREACLGITKFL 67
           T  L NG+ MP +GLG ++   +     V+ A+KLGYR  D A  YGNE++   GI + +
Sbjct: 4   TVTLNNGLTMPLVGLGCWKISPDICAEQVYEAIKLGYRLFDGACDYGNEKQVGDGIRRAI 63

Query: 68  EESPKVSRSDIFFTTKIKTQDQGYESAKKSIEESLNRVKELDYIDLFLIHAPLTNK---- 123
           +E   V R D+F  +K+       +  K +++ +L+ +K L+Y+DL+ IH PL  K    
Sbjct: 64  DEG-IVKREDLFVVSKLWNTYHDPKHVKLALQRTLDDMK-LEYLDLYYIHFPLAFKFVPF 121

Query: 124 EKR------------------------LGTWKAFQEYYETGKIKAIGVSNYGIQHLEEMY 159
           E+R                        + T++A +E  + G  K+IG+SNY    +++  
Sbjct: 122 EERYPPGFYTGAEDAKKGILTEEKVALIDTYRAMEELVDEGLTKSIGISNYAGALVQDTL 181

Query: 160 QWDGLKIDPMVNQYELNPWLTRKELSNYCHQKGMVIQAYSPL-------------TRARR 206
           +  G +I P+  Q E +P+LT+++L  YC   G+ + AYS                    
Sbjct: 182 R--GCRIKPVCLQIEHHPYLTQEKLVEYCKLNGIQVVAYSSFGPQSFVDIDQKLAKHTPP 239

Query: 207 LQDPELVKLVEDSYPEQTSAQILVNWSLQMGFVPLVKTVHEDRLKENIK-SCDFELSSAD 265
           L D  ++K +   + + T++Q+++ W+ Q G   + K+ H+ RL  N++      L+  D
Sbjct: 240 LFDHPVIKKIAQEH-KVTTSQVILRWATQRGIAVIPKSAHKGRLLGNLQIDQAVTLTPKD 298

Query: 266 LKKLTHDDQYYLSQPKWD 283
           L++++  ++       WD
Sbjct: 299 LEEISSLNKNLRFNDTWD 316

>TDEL0D05160 Chr4 complement(935981..936958) [978 bp, 325 aa] {ON}
           Anc_3.108 YBR149W
          Length = 325

 Score =  117 bits (294), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 86/279 (30%), Positives = 147/279 (52%), Gaps = 42/279 (15%)

Query: 11  LKNGVKMPCLGLGLYQTPKE--ETTNIVHNALKLGYRQVDSAQLYGNEREACLGITKFLE 68
           L NGV+MP +GLG    P++  ET   V  A+K GYR +D+A  YG+E      I + +E
Sbjct: 13  LNNGVRMPAIGLGTANPPEKLAETKQAVKAAVKAGYRNIDTAWAYGSEPFVGEAIKELIE 72

Query: 69  ESPKVSRSDIFFTTKIKTQDQGYESAKKSIEESLNRVKELDYIDLFLIHAPLT------- 121
           E   + R D+F T+K+      ++ A++S++ESL  +  +DYIDL+L H PL        
Sbjct: 73  EG-AIKREDLFITSKV--WPVLWDDAERSLQESLKSLG-VDYIDLWLQHWPLCYNRREDP 128

Query: 122 --------NKEKR------------LGTWKAFQEYYETGK---IKAIGVSNYGIQHLEEM 158
                   N EK             L T+K  +  Y   K   ++AIGVSN+ +++L+ +
Sbjct: 129 HGINGLARNPEKADGSPDFNEKADWLDTYKQMERIYSNPKDNRVRAIGVSNFPVEYLKRV 188

Query: 159 YQWDGLKIDPMVNQYELNPWLTRKELSNYCHQKGMVIQAYSPLTR--ARRLQDPELVKLV 216
            +     + P++NQ E++P L + EL+ +CH   + + AYSPL    A  ++ P L+K +
Sbjct: 189 LK--ECPVKPVLNQVEMHPRLPQFELNEFCHDNDIKLTAYSPLGSHGAPMVKHP-LIKEM 245

Query: 217 EDSYPEQTSAQILVNWSLQMGFVPLVKTVHEDRLKENIK 255
              Y + +   IL ++ ++ G   + ++++  R+  NI+
Sbjct: 246 SQKY-KASENDILTSFHIRQGNTVVPRSINSVRIASNIE 283

>SAKL0C09922g Chr3 (897779..898747) [969 bp, 322 aa] {ON} similar to
           uniprot|P38115 Saccharomyces cerevisiae YBR149W ARA1
           Large subunit of NADP dependent arabinose dehydrogenase
           involved in carbohydrate metabolism small subunit is
           unidentified
          Length = 322

 Score =  117 bits (294), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 86/279 (30%), Positives = 147/279 (52%), Gaps = 44/279 (15%)

Query: 11  LKNGVKMPCLGLGLYQTPKE---ETTNIVHNALKLGYRQVDSAQLYGNEREACLGITKFL 67
           L NG ++P +GLG    PK+   +T   V  A+K G+RQ+D+A  YG E      + +  
Sbjct: 13  LNNGTRIPAVGLGT-ANPKDKWPQTKEAVKAAVKAGFRQIDTAWAYGTEEYIGEALQELF 71

Query: 68  EESPKVSRSDIFFTTKIKTQDQGYESAKKSIEESLNRVKELDYIDLFLIHAPLTNKEKR- 126
            E   V R D+F TTK+      ++ A+KS+ ESL R+ +LDY+DL L H P    +K+ 
Sbjct: 72  AEG-VVKREDLFITTKV--WPNYWDQAEKSLNESLKRL-QLDYVDLLLQHWPFCFVKKQD 127

Query: 127 --------------------------LGTWKAFQEYY---ETGKIKAIGVSNYGIQHLEE 157
                                     L T+K  +  Y      +++AIGVSNY I++LE 
Sbjct: 128 PEGSGQLVNHPQHEDGSPFYDTAGDWLETYKQIEAIYLAENDTRVRAIGVSNYPIEYLER 187

Query: 158 MYQWDGLKIDPMVNQYELNPWLTRKELSNYCHQKGMVIQAYSPL--TRARRLQDPELVKL 215
           +++    K  P +NQ EL+P L ++EL +YC++ G+++ +YSPL    A  L+ P LV+ 
Sbjct: 188 LFK--ECKTVPAINQVELHPRLPQRELCDYCNKHGILMTSYSPLGSNGAPNLRIP-LVQE 244

Query: 216 VEDSYPEQTSAQILVNWSLQMGFVPLVKTVHEDRLKENI 254
           +   Y       +LV++ ++ G + + ++++ +R+ + +
Sbjct: 245 LASKY-NANGNDVLVSYHIRQGTIVIPRSLNLERISKGL 282

>ZYRO0A06336g Chr1 complement(505818..506801) [984 bp, 327 aa] {ON}
           highly similar to uniprot|P38715 Saccharomyces
           cerevisiae YHR104W GRE3 Aldose reductase involved in
           methylglyoxal d-xylose and arabinose metabolism stress
           induced (osmotic ionic oxidative heat shock starvation
           and heavy metals) regulated by the HOG pathway
          Length = 327

 Score =  117 bits (293), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 81/290 (27%), Positives = 144/290 (49%), Gaps = 46/290 (15%)

Query: 6   GTTHALKNGVKMPCLGLGLYQTPKEETTNIVHNALKLGYRQVDSAQLYGNEREACLGITK 65
            +  AL NG KMP +GLG ++ P E  +  +++A+ +GYR  D AQ YGNE+E   G+ +
Sbjct: 2   ASVVALNNGNKMPLVGLGCWKIPNETCSQQIYDAISVGYRVFDGAQDYGNEKEVGEGVRR 61

Query: 66  FLEESPKVSRSDIFFTTKIKTQDQGYESAKKSIEESLNRVKELDYIDLFLIHAPLTNKEK 125
            +++   V R ++F  +K+       ++ K +++ +L+ +  LDY+DLF IH P+  K  
Sbjct: 62  AIKDG-LVKREELFVVSKLWNSFHHPKNVKLALKRTLSDMG-LDYLDLFYIHFPIALKPV 119

Query: 126 R----------------------------LGTWKAFQEYYETGKIKAIGVSNYGIQHLEE 157
                                        L T++A +E  E G IK+IGVSN+    + +
Sbjct: 120 SFEEKYPPGLYTGEADAKAGVLSEEPVPILDTYRALEECVEEGLIKSIGVSNFSGSIMLD 179

Query: 158 MYQWDGLKIDPMVNQYELNPWLTRKELSNYCHQKGMVIQAYSPL---------TRARRLQ 208
           + +  G +I P   Q EL+P+LT++    +   KG+ + AYS           +   +  
Sbjct: 180 LLR--GARIPPAALQIELHPYLTQERYVKWVQSKGIQVVAYSSFGPQSFVDIGSEVAKAT 237

Query: 209 DP----ELVKLVEDSYPEQTSAQILVNWSLQMGFVPLVKTVHEDRLKENI 254
            P    ++VK +   +   TS Q+L+ W+ Q     + K+  ++RL++N+
Sbjct: 238 PPLFEHDVVKKIAAKHNVSTS-QVLLRWATQQKVAVIPKSSKKERLRQNL 286

>KAFR0B01200 Chr2 (224411..225358) [948 bp, 315 aa] {ON} Anc_7.285
           YDL124W
          Length = 315

 Score =  116 bits (291), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 87/288 (30%), Positives = 149/288 (51%), Gaps = 34/288 (11%)

Query: 10  ALKNGVKMPCL-----GLGLYQTPK------EETTNIVHNALKL-GYRQVDSAQLYGNER 57
            L NG KMP +     G   Y+T +      +E  + +  AL L G   +D+A++Y    
Sbjct: 10  TLNNGNKMPSIAIIGTGTAWYKTEETPETFSQELVDQIKYALTLPGIVHIDAAEVYRTYP 69

Query: 58  EACLGITKFLEESPKVS-RSDIFFTTKIKTQDQGYESAKKSIEESLNRVKELDYIDLFLI 116
           E    + K L ES  V  R +IF T K  TQ +  E+    +   L ++  LDY+DL+L+
Sbjct: 70  E----VGKALRESHNVKPRDEIFITDKYSTQLKISENPMVGLTNGLKKLG-LDYVDLYLL 124

Query: 117 HAPLTNKEKRLGT----WKAFQEYYETGKIKAIGVSNYGIQHLEEMYQWDGLKIDPMVNQ 172
           H+P  +KEK   T    WK  ++ Y+ GK+K IGVSN+ +  L+ + +    ++ P VNQ
Sbjct: 125 HSPFISKEKNGFTMEEAWKYMEDLYKAGKVKNIGVSNFSMADLQRILK--SCEVKPQVNQ 182

Query: 173 YELNPWLTRKE--LSNYCHQKGMVIQAYSPLTRARRLQDP-------ELVKLVEDSYPEQ 223
            E N +L  +   + N+C +  + + AY+PL   +R           + VK + + Y ++
Sbjct: 183 IEFNAFLQNQTPGIVNFCRENDIQVVAYTPLGPLQRKSKNFEQENFHKFVKQLAEKY-DK 241

Query: 224 TSAQILVNWSLQMGFVPLVKTVHEDRLKENIKSCDFELSSADLKKLTH 271
           + AQIL+ W  + G +P+  +  E R+K+      F+L+ ++++K+T 
Sbjct: 242 SEAQILLRWVSKRGIIPVTTSSKEKRIKDAQYLFTFDLTDSEVEKITQ 289

>KLTH0G00638g Chr7 (43280..44221) [942 bp, 313 aa] {ON} similar to
           uniprot|Q07551 Saccharomyces cerevisiae YDL124W
           NADPH-dependent alpha-keto amide reductase reduces
           aromatic alpha-keto amides aliphatic alpha-keto esters
           and aromatic alpha-keto esters
          Length = 313

 Score =  114 bits (286), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 80/284 (28%), Positives = 141/284 (49%), Gaps = 34/284 (11%)

Query: 13  NGVKMPCLGLGL---YQTPK----------EETTNIVHNALKLGYRQVDSAQLYGNEREA 59
           +G K+P +G G    ++  K          +E  + V NA+K G+  +D+A+ Y    E 
Sbjct: 13  SGDKLPVIGFGSGTKWRIAKAEGEKKDQFIQELADQVSNAIKAGFNHIDAAEAYKTHPEV 72

Query: 60  CLGITKFLEESPKVSRSDIFFTTKIKTQDQGYESAK---KSIEESLNRVKELDYIDLFLI 116
             GI      +  V R  ++ T K       +   K   +S+E SL ++ ++ Y+DL+L+
Sbjct: 73  GAGIA-----NSGVPREKLWVTDKYTPWSWTWRKGKGPLESLELSLGKM-QMQYVDLYLV 126

Query: 117 HAPLTNKEKR----LGTWKAFQEYYETGKIKAIGVSNYGIQHLEEMYQWDGLKIDPMVNQ 172
           H P  N E         W+  +E Y+ G  K IGVSN+ ++ LE +      K  P+VNQ
Sbjct: 127 HVPFINPETAGIDLKEAWRQMEEIYDRGWAKNIGVSNFDVESLEYIRTIG--KYQPVVNQ 184

Query: 173 YELNPWLTRKE--LSNYCHQKGMVIQAYSPL---TRARRLQDPELVKLVEDSYPEQTSAQ 227
            E + ++ ++   + +YC + G+ I+ YSPL   T+ +     +++ L+   Y  ++  Q
Sbjct: 185 IEFSAYMQQQSPGIISYCKKHGIAIEGYSPLVPLTKGKPGPLDDILPLMAKKY-GKSELQ 243

Query: 228 ILVNWSLQMGFVPLVKTVHEDRLKENIKSCDFELSSADLKKLTH 271
           IL+ W +Q G + +  +  + R+ E++   DFELSS D   +T 
Sbjct: 244 ILLRWVVQNGVIAITTSAQQKRIDESLDIFDFELSSEDFTSITE 287

>NDAI0A07000 Chr1 complement(1596632..1597594) [963 bp, 320 aa] {ON}
           Anc_3.108
          Length = 320

 Score =  114 bits (285), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 92/304 (30%), Positives = 155/304 (50%), Gaps = 49/304 (16%)

Query: 11  LKNGVKMPCLGLGLYQTPKE---ETTNIVHNALKLGYRQVDSAQLYGNEREACLGITKFL 67
           L NG ++P +GLG   +PK+   ET   V  A++ GYR +D+A  Y  E      + K L
Sbjct: 13  LNNGTRIPAIGLGT-ASPKDRYPETKEAVKAAIRAGYRHIDTAYFYKTEPYIGQAL-KEL 70

Query: 68  EESPKVSRSDIFFTTKIKTQDQGYESAKKSIEESLNRVKELDYIDLFLIHAPLTNKEKR- 126
            ES ++ R ++F TTK+      + +   SI++SL  +  +DY+DL L H P+  ++   
Sbjct: 71  FESAEIKREELFITTKV--WPTFWNNPSDSIDQSLKDLG-IDYVDLVLQHWPVCFQKVEN 127

Query: 127 ------------------------LGTWKAFQEYY---ETGKIKAIGVSNYGIQHLEEMY 159
                                   L T+KA ++ Y   +  +++AIGVSNY I++LE ++
Sbjct: 128 SQGNIIGLPRDKDGNALFEKDADWLFTYKALEKIYLDPKDNRVRAIGVSNYPIEYLERLF 187

Query: 160 QWDGLKIDPMVNQYELNPWLTRKELSNYCHQKGMVIQAYSPLTRARRLQDPEL-VKLVED 218
           +    K+ P +NQ E++P L + EL+ +CH   +++ AYSPL        P L +K V+D
Sbjct: 188 K--ECKVTPAINQVEVHPHLPQLELNKFCHDHAILLTAYSPLGSDGA---PNLKIKSVQD 242

Query: 219 SYPEQT--SAQILVNWSLQMGFVPLVKTVHEDRLKENIKSCDFELSSADLKKLTHDDQYY 276
              +     A IL ++ +  G V L ++++  R+  N+     +L+  DL KL   DQ  
Sbjct: 243 LAKKYKVEPADILTSYHISKGNVVLPRSLNPKRIAANVSFA--KLTDDDLSKL---DQVG 297

Query: 277 LSQP 280
           + +P
Sbjct: 298 IDEP 301

>Suva_4.398 Chr4 (709192..710226) [1035 bp, 344 aa] {ON} YBR149W
           (REAL)
          Length = 344

 Score =  114 bits (285), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 94/311 (30%), Positives = 156/311 (50%), Gaps = 51/311 (16%)

Query: 5   PGTTH---ALKNGVKMPCLGLGLYQTPKE---ETTNIVHNALKLGYRQVDSAQLYGNERE 58
           P TT     L NGV++P LGLG    P E   ET   V  A+K GYR +D+A  Y  E  
Sbjct: 18  PKTTEIYFTLNNGVRVPALGLGT-ANPHEKLAETKQAVKAAIKAGYRHIDTAWAYETEPF 76

Query: 59  ACLGITKFLEESPKVSRSDIFFTTKIKTQDQGYESAKKSIEESLNRVKELDYIDLFLIHA 118
               I + LEE   + R D+F TTK+      ++  ++S+ ESL +   LDY+DLFL H 
Sbjct: 77  VGEAIKELLEEG-SIKREDLFITTKV--WPVLWDEVERSLSESL-KAMGLDYVDLFLQHW 132

Query: 119 PLTNKEKR---------------------------LGTWKAFQEYY---ETGKIKAIGVS 148
           PL  ++ +                           + T+K  ++ Y      +++AIGVS
Sbjct: 133 PLCFEKVKDPKGISGLVKTPVHKSGEAMLASNGDWMETYKQLEKIYLDPNDHRVRAIGVS 192

Query: 149 NYGIQHLEEMYQWDGLKIDPMVNQYELNPWLTRKELSNYCHQKGMVIQAYSPL--TRARR 206
           N+ I++LE + +    ++ P VNQ E +P L + EL  +C    +++ AYSPL    A  
Sbjct: 193 NFSIEYLERLVK--ECRVKPTVNQVETHPHLPQMELRKFCFMHDILLTAYSPLGSNGAPN 250

Query: 207 LQDPELVKLVEDSYPEQTSAQILVNWSLQMGFVPLVKTVHEDRLKENIK-SCDFELSSAD 265
           L+ P + KLVE      T   +L+++ ++ G + + ++++  R+  +I+ +C   L+  +
Sbjct: 251 LKIPLVKKLVEKY--NVTGNDVLISYHIRQGTIVIPRSLNPVRISSSIEFAC---LTKDE 305

Query: 266 LKKLTHDDQYY 276
           L++L    + Y
Sbjct: 306 LQELNDFGEKY 316

>Kwal_56.22611 s56 complement(202750..203715) [966 bp, 321 aa] {ON}
           YBR149W (ARA1) - D-arabinose dehydrogenase [contig 184]
           FULL
          Length = 321

 Score =  112 bits (281), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 91/305 (29%), Positives = 150/305 (49%), Gaps = 48/305 (15%)

Query: 11  LKNGVKMPCLGLG----LYQTPKEETTNIVHNALKLGYRQVDSAQLYGNEREACLGITKF 66
           L NGVKMP LGLG    + Q P  +T   V  A+K GYR +D+A  Y  E      + + 
Sbjct: 13  LNNGVKMPALGLGTANVIEQIP--QTKQAVKAAIKSGYRHIDTAWAYRCEDRIGEALKEL 70

Query: 67  LEESPKVSRSDIFFTTKIKTQDQGYESAKKSIEESLNRVKELDYIDLFLIHAPL------ 120
            EE   + R DIF TTK+   +  ++ A +SI  SL  +  +DY+DL L H PL      
Sbjct: 71  FEEG-VIKREDIFITTKVWPTN--WDRADESISRSLENLG-VDYVDLVLQHWPLCFNRLQ 126

Query: 121 ---------------------TNKEKRLGTWKAFQEYY--ETGKIKAIGVSNYGIQHLEE 157
                                  K   L T+K+ ++ Y  +  + ++IGVSNY +++LE 
Sbjct: 127 DPEGIDGICRNPTHEDGSPHYNEKGDYLQTFKSLEKMYLSKDPRFRSIGVSNYPVEYLER 186

Query: 158 MYQWDGLKIDPMVNQYELNPWLTRKELSNYCHQKGMVIQAYSPL-TRARRLQDPELVKLV 216
           + +    K+ P VNQ E++P L + EL ++C +  + ++A+SP       +   ELV+ V
Sbjct: 187 LLK--ECKVVPAVNQVEMHPHLPQMELRDFCTKHNIRLEAFSPFGATGSPMVKNELVQKV 244

Query: 217 EDSYPEQTSAQILVNWSLQMGFVPLVKTVHEDRLKENIKSCDFELSSADLKKLTHDDQYY 276
              Y   T   +L+ + L+ G V + ++V+   +  N++     LS  D+ +L   +++ 
Sbjct: 245 AQKY-SCTPNDVLIAYHLRQGVVTVPRSVNPKNIASNVQFV--PLSKEDIDEL---NKFG 298

Query: 277 LSQPK 281
           +  PK
Sbjct: 299 VENPK 303

>NCAS0A06660 Chr1 (1316398..1317378) [981 bp, 326 aa] {ON} 
          Length = 326

 Score =  112 bits (281), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 86/315 (27%), Positives = 149/315 (47%), Gaps = 47/315 (14%)

Query: 11  LKNGVKMPCLGLGLYQTPKEETTNIVHNALKLGYRQVDSAQLYGNEREACLGITKFLEES 70
           L NG+KMP +GLG ++ P +   + V+ A+K GYR  D A  Y NE E   G+ + +++ 
Sbjct: 7   LNNGMKMPQVGLGCWKIPNDICADQVYEAIKAGYRLFDGATDYANEVEVGKGLKRAMDDG 66

Query: 71  PKVSRSDIFFTTKIKTQDQGYESAKKSIEESLNRVKELDYIDLFLIHAPLTNK----EKR 126
             V R D+F  +K+       +  K +++ +L  +  LDY+DL+ IH P+  K    E+R
Sbjct: 67  -IVKRQDLFVVSKLWNNFHHPDHVKLNLKRNLKDLG-LDYLDLYYIHFPIAFKFVPMEER 124

Query: 127 ------------------------LGTWKAFQEYYETGKIKAIGVSNYGIQHLEEMYQWD 162
                                   L T++A +E    G IK+IG+SN+    + ++ +  
Sbjct: 125 YPPQMYTGKADEAKGILTEENVPLLDTYRALEECQREGLIKSIGISNFNGGLVADILR-- 182

Query: 163 GLKIDPMVNQYELNPWLTRKELSNYCHQKGMVIQAYSPL-------------TRARRLQD 209
           G  I P+  Q E +P+LT+++L  YC    + +  YS                    L D
Sbjct: 183 GCSIKPVALQIEHHPYLTQEKLLEYCKIHDVQVVGYSSFGPQSFADCGMDLAKNTPPLFD 242

Query: 210 PELVKLVEDSYPEQTSAQILVNWSLQMGFVPLVKTVHEDRLKENIKSCD-FELSSADLKK 268
             ++K + + +   ++A++L+ W+ Q G   + K+ H+ RL  N+   D   L+  DLK 
Sbjct: 243 HPVIKKIAEKH-NVSTAEVLLRWATQRGVAIIPKSSHKKRLLSNLNIDDNVTLTEEDLKS 301

Query: 269 LTHDDQYYLSQPKWD 283
           ++  +Q       WD
Sbjct: 302 ISGLNQNLRFNDPWD 316

>KNAG0C04110 Chr3 (806389..807324) [936 bp, 311 aa] {ON} Anc_7.285
           YDL124W
          Length = 311

 Score =  112 bits (279), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 83/286 (29%), Positives = 144/286 (50%), Gaps = 36/286 (12%)

Query: 11  LKNGVKMPC---LGLGLYQTPKEETTNIVHN--------ALKL-GYRQVDSAQLYGN--E 56
           L NG KMP    +G G +   K+E  + + +        AL L G   +D+A++YG   E
Sbjct: 10  LNNGHKMPAVAIIGTGTHWHHKKEKDHALSHELIEQLEFALSLPGVVHIDAAEMYGTYPE 69

Query: 57  REACLGITKFLEESPKVSRSDIFFTTKIKTQDQGYESAKKSIEESLNRVKELDYIDLFLI 116
             A L +T    E P   RS+IF T K        +     +E+SL +   LDY+DL+L+
Sbjct: 70  LSAALRMT----EKP---RSEIFITDKHALHAAMSKDPIAGLEDSL-KANNLDYVDLYLL 121

Query: 117 HAPLTNKEKR----LGTWKAFQEYYETGKIKAIGVSNYGIQHLEEMYQWDGLKIDPMVNQ 172
           H+P   KEK      G W+  ++ Y+ GK K IGVSN+ ++ L+ +      +I P VNQ
Sbjct: 122 HSPFVAKEKPGLTLEGAWRQMEQLYKDGKAKNIGVSNFSVEDLKRVLSV--AEIKPQVNQ 179

Query: 173 YELNPWLTRKE--LSNYCHQKGMVIQAYSPL----TRARRLQDPELVKLVE--DSYPEQT 224
            E +P+L  +   +  +C  + + ++A++PL     + +  ++ E  K +       ++T
Sbjct: 180 IEFHPFLQNQTPGILKFCQDENIELEAFTPLGPLQVKTQEDENDEFFKYISSLSGKYQKT 239

Query: 225 SAQILVNWSLQMGFVPLVKTVHEDRLKENIKSCDFELSSADLKKLT 270
            AQI++ W  + G +P+  +   DR+ +     +F+L   ++ K+T
Sbjct: 240 EAQIILRWVTKRGVIPVTTSRRHDRIADAQNLFEFDLEDEEVTKIT 285

>Smik_2.289 Chr2 (526189..527223) [1035 bp, 344 aa] {ON} YBR149W
           (REAL)
          Length = 344

 Score =  112 bits (280), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 90/289 (31%), Positives = 144/289 (49%), Gaps = 47/289 (16%)

Query: 5   PGTTH---ALKNGVKMPCLGLGLYQTPKE---ETTNIVHNALKLGYRQVDSAQLYGNERE 58
           P TT    +L NGV++P LGLG    P+E   ET   V  A+K GYR +D+A  Y  E  
Sbjct: 18  PKTTEIYFSLNNGVRIPALGLGT-ANPQEKLAETKQAVKAAIKAGYRHIDTAWAYRTEPF 76

Query: 59  ACLGITKFLEESPKVSRSDIFFTTKIKTQDQGYESAKKSIEESLNRVKELDYIDLFLIHA 118
               I + LEE   + R D+F TTK+      ++   +S+ ESL  +  LDY+DL L H 
Sbjct: 77  VGEAIKELLEEG-TIQREDLFITTKV--WPVLWDEVDRSLNESLKALG-LDYVDLLLQHW 132

Query: 119 PLTNKEKR---------------------------LGTWKAFQEYY---ETGKIKAIGVS 148
           PL  ++ +                           L T+K  ++ Y      +++AIGVS
Sbjct: 133 PLCFEKVKDPKGISGLVKTPVDDSGKTVYASNGDWLETYKQLEKIYLDSNDHRVRAIGVS 192

Query: 149 NYGIQHLEEMYQWDGLKIDPMVNQYELNPWLTRKELSNYCHQKGMVIQAYSPLTR--ARR 206
           N+ I++LE + +    K+ P VNQ E +P L + EL  +C    +++ AYSPL    A  
Sbjct: 193 NFSIEYLERLIK--ECKVKPTVNQVESHPHLPQVELRKFCFMHDILLTAYSPLGSQGAPN 250

Query: 207 LQDPELVKLVEDSYPEQTSAQILVNWSLQMGFVPLVKTVHEDRLKENIK 255
           L+ P + KL E      T   +L+++ ++ G + + ++++  R+  NI+
Sbjct: 251 LKIPLVKKLCEKY--NVTGNDLLISYHIRQGTIVIPRSLNPVRISSNIE 297

>KLTH0C10010g Chr3 (829145..830110) [966 bp, 321 aa] {ON} similar to
           uniprot|P38115 Saccharomyces cerevisiae YBR149W ARA1
           Large subunit of NADP dependent arabinose dehydrogenase
           involved in carbohydrate metabolism small subunit is
           unidentified
          Length = 321

 Score =  112 bits (279), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 87/292 (29%), Positives = 141/292 (48%), Gaps = 41/292 (14%)

Query: 11  LKNGVKMPCLGLGLYQTPKE--ETTNIVHNALKLGYRQVDSAQLYGNEREACLGITKFLE 68
           L NGV+MP +GLG     ++  +T   V  A+K GYR +D+A  Y  E      + +  E
Sbjct: 13  LNNGVRMPAIGLGTANVVEQIPQTKQAVKAAIKSGYRHIDTAWAYQCEDRVGEALKELFE 72

Query: 69  ESPKVSRSDIFFTTKIKTQDQGYESAKKSIEESLNRVKELDYIDLFLIHAPL-------- 120
           E   V R DIF TTK+   +  ++   +SI  SL  +  LD++DL L H PL        
Sbjct: 73  EG-VVKREDIFVTTKVWPTN--WDRVDESISRSLENLG-LDHVDLVLQHWPLCFNRLEDP 128

Query: 121 -------------------TNKEKRLGTWKAFQEYY--ETGKIKAIGVSNYGIQHLEEMY 159
                                K   L T+K  ++ Y  +  + +AIGVSNY +++LE + 
Sbjct: 129 DGIDGVRRNPYHEDGSPHYNEKGDYLETFKTLEKLYLAKDPRFRAIGVSNYPVEYLERLL 188

Query: 160 QWDGLKIDPMVNQYELNPWLTRKELSNYCHQKGMVIQAYSPLTRARR-LQDPELVKLVED 218
           +    ++ P +NQ E +P L + EL ++C +  + ++AYSPL      L D ELVK +  
Sbjct: 189 K--ECQVVPAINQVECHPHLPQMELRDFCTKHNIRLEAYSPLGATNAPLIDNELVKKIAG 246

Query: 219 SYPEQTSAQILVNWSLQMGFVPLVKTVHEDRLKENIKSCDFELSSADLKKLT 270
            Y   T   +L+ + ++ G V + ++V+   +  N++     LS  D+  L 
Sbjct: 247 KYACSTQ-NVLIAYHMRQGVVSVPRSVNPKHIASNVQF--VALSKEDIDTLN 295

>KLLA0F05775g Chr6 (560270..561199) [930 bp, 309 aa] {ON} highly
           similar to uniprot|Q07551 Saccharomyces cerevisiae
           YDL124W NADPH-dependent alpha-keto amide reductase
           reduces aromatic alpha-keto amides aliphatic alpha-keto
           esters and aromatic alpha-keto esters
          Length = 309

 Score =  111 bits (278), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 83/286 (29%), Positives = 150/286 (52%), Gaps = 35/286 (12%)

Query: 11  LKNGVKMPCL-----GLGLYQTPKEETT------NIVHNALKL--GYRQVDSAQLYGNER 57
           L NG K+P +     G   Y++ + + T      +IV   L    G   +D+A++Y    
Sbjct: 9   LSNGNKIPAVAIVGTGTAWYKSEETDATFSQPLVDIVKKTLDTVPGVVHIDAAEIYRTYP 68

Query: 58  EACLGITKFLEESPKVSRSDIFFTTKIKTQDQGYESAKKSIEESLNRVKELDYIDLFLIH 117
           E    +     +  K  R +IF T K  T  Q  E+ K ++E SL ++  +DY+DL+L+H
Sbjct: 69  ELGAAL-----KDTKKPRDEIFITDKYSTLKQLSENPKVALETSLKKLG-VDYVDLYLLH 122

Query: 118 APLTNKEKRL---GTWKAFQEYYETGKIKAIGVSNYGIQHLEEMYQWDGLKIDPMVNQYE 174
           +P+  KE +L     WK  +E Y++GK K IGVSN+ ++ LE++     +K  P VNQ E
Sbjct: 123 SPII-KESKLDVEANWKYLEELYKSGKAKNIGVSNFAVKDLEKLLAVAEVK--PQVNQIE 179

Query: 175 LNPWLTRKE--LSNYCHQKGMVIQAYSPL-TRARRLQDP------ELVKLVEDSYPEQTS 225
            +P+L  +   +  +  + G++++AYSPL    RR +D       + +  +   Y  ++ 
Sbjct: 180 FSPFLQNQTPGIVEFSQKNGILLEAYSPLGPLQRRPEDADKLPFYQYIAELSKKY-NKSE 238

Query: 226 AQILVNWSLQMGFVPLVKTVHEDRLKENIKSCDFELSSADLKKLTH 271
           AQIL++W  + G +P+  +   +R+++      F L++ +++K+T 
Sbjct: 239 AQILLSWVYERGILPVTTSSKIERIQQAQDIFSFSLANEEVQKITQ 284

>Kpol_1020.13 s1020 (27790..28731) [942 bp, 313 aa] {ON}
           (27790..28731) [942 nt, 314 aa]
          Length = 313

 Score =  111 bits (277), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 85/285 (29%), Positives = 139/285 (48%), Gaps = 33/285 (11%)

Query: 11  LKNGVKMPCLGL-----------GLYQTPKEETTNIVHNALKL-GYRQVDSAQLYGNERE 58
           L NG ++P + +           G   T  +E    +  AL L G   +D+A+ YG   E
Sbjct: 10  LNNGNQIPSISIIGTGTRWFKRPGSEHTFSDELVEQIKYALSLPGIIHIDAAECYGTYPE 69

Query: 59  ACLGITKFLEESPKVSRSDIFFTTKIKTQDQGYESAKKSIEESLNRVKELDYIDLFLIHA 118
               + K L+ES K  RS+IF T K  TQ +      + +   L  +  LDY+DL+LIH+
Sbjct: 70  ----LAKALKESSK-PRSEIFITDKYSTQTKFTNDPIEGLNTGLKTLG-LDYVDLYLIHS 123

Query: 119 PLTNKEKRLG-----TWKAFQEYYETGKIKAIGVSNYGIQHLEEMYQWDGLKIDPMVNQY 173
           P  + E +        WK  +  Y+ GK K+IGVSN+ ++++EE+ +  G+K  P VNQ 
Sbjct: 124 PFFDPEFKGSLTLEKVWKDMETLYKEGKAKSIGVSNFSVKNIEEILKIAGIK--PQVNQI 181

Query: 174 ELNPWLTRKE--LSNYCHQKGMVIQAYSPL----TRARRLQDPELVKLVED--SYPEQTS 225
           E N +L  +   + NYC +  + ++AYSPL     R     +      +++  S   +T 
Sbjct: 182 EFNAFLQNQTPGIVNYCQKNNIQLEAYSPLGPLQKRPENSNELPFYNYIDELASKYGKTD 241

Query: 226 AQILVNWSLQMGFVPLVKTVHEDRLKENIKSCDFELSSADLKKLT 270
           +QIL+NW    G +P+  +    R+ +      F L+  ++  LT
Sbjct: 242 SQILLNWVYNRGILPITTSSKTQRIIDAQNIFSFNLTKDEVDTLT 286

>Smik_4.113 Chr4 (216885..217823) [939 bp, 312 aa] {ON} YDL124W
           (REAL)
          Length = 312

 Score =  110 bits (276), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 86/287 (29%), Positives = 145/287 (50%), Gaps = 34/287 (11%)

Query: 10  ALKNGVKMPCL---GLGLYQTPKEETTNIVHN--------ALKL-GYRQVDSAQLYGNER 57
            L NG K+P +   G G     +EET     N        ALKL G   +D+A++Y    
Sbjct: 9   TLNNGNKIPAIAIIGTGTRWYKEEETDATFSNSLVEQIVYALKLPGIIHIDAAEIYRTYP 68

Query: 58  EACLGITKFLEESPKVSRSDIFFTTKIKTQDQGYESAKKSIEESLNRVKELDYIDLFLIH 117
           E    ++  L E P   R++IF T K  TQ +  ES    ++ +L ++   DY+DL+L+H
Sbjct: 69  EVGKALS--LTEKP---RNEIFLTDKYSTQIKVSESPAVGLDIALKKMGT-DYVDLYLLH 122

Query: 118 APLTNKEKRLGT----WKAFQEYYETGKIKAIGVSNYGIQHLEEMYQWDGLKIDPMVNQY 173
           +P  +KE    T    WK  ++ Y +GK K IGVSN+ ++ LE + +    +I P VNQ 
Sbjct: 123 SPFVSKETNGFTLEEAWKDMEQLYRSGKAKNIGVSNFAMKDLERILK--VAEIRPQVNQI 180

Query: 174 ELNPWLTRKE--LSNYCHQKGMVIQAYSPL-------TRARRLQDPELVKLVEDSYPEQT 224
           E +P+L  +   +  +C +  ++++AYSPL       T+   L   E VK + + Y  ++
Sbjct: 181 EFSPFLQNQTPGIYKFCQENDILLEAYSPLGPLQKRTTKDESLPFFEYVKELSEKYI-KS 239

Query: 225 SAQILVNWSLQMGFVPLVKTVHEDRLKENIKSCDFELSSADLKKLTH 271
            AQI + W  + G +P+  +    R+ +      F+L+  ++ ++T 
Sbjct: 240 EAQITLRWVTRRGVLPVTTSSKPQRISDAQNLFSFDLTDEEVNQITE 286

>Skud_2.276 Chr2 (507436..508470) [1035 bp, 344 aa] {ON} YBR149W
           (REAL)
          Length = 344

 Score =  111 bits (277), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 90/292 (30%), Positives = 147/292 (50%), Gaps = 48/292 (16%)

Query: 5   PGTTH---ALKNGVKMPCLGLGLYQTPKE---ETTNIVHNALKLGYRQVDSAQLYGNERE 58
           P TT    +L NGV++P LGLG    P E   ET   V  A+K GYR +D+A  Y  E  
Sbjct: 18  PKTTEIYFSLNNGVRIPALGLGT-ANPHEKLAETKQAVKAAIKAGYRHIDTAWAYETEPF 76

Query: 59  ACLGITKFLEESPKVSRSDIFFTTKIKTQDQGYESAKKSIEESLNRVKELDYIDLFLIHA 118
               I + LE+   + R D+F TTK+      ++   +S+ ESL  +  LDY+DLFL H 
Sbjct: 77  VGEAIKELLEDG-SIKREDLFITTKV--WPVLWDEVDRSLNESLKALG-LDYVDLFLQHW 132

Query: 119 PLTNKEKR---------------------------LGTWKAFQEYY---ETGKIKAIGVS 148
           PL  ++ +                           L T+K  ++ Y      +I+AIGVS
Sbjct: 133 PLCFEKVKDPKGLSGLVKTPVDDSGKTMYASNGDWLETYKQLEKIYLDPNDHRIRAIGVS 192

Query: 149 NYGIQHLEEMYQWDGLKIDPMVNQYELNPWLTRKELSNYCHQKGMVIQAYSPL--TRARR 206
           N+ I++LE + +    ++ P VNQ E +P L +  +  +C    +++ AYSPL    A  
Sbjct: 193 NFSIEYLERLIK--ECRVKPTVNQVETHPHLPQMAMRKFCFMHDILLTAYSPLGSNGAPN 250

Query: 207 LQDPELVKLVEDSYPEQTSAQILVNWSLQMGFVPLVKTVHEDRLKENIK-SC 257
           L+ P LVK + + Y   T   +L+++ ++ G + + ++++  R+  +I+ SC
Sbjct: 251 LKIP-LVKKLTEKY-NLTGNDVLISYHIRQGTIVIPRSLNPVRISSSIEFSC 300

>Smik_2.288 Chr2 (524564..525598) [1035 bp, 344 aa] {ON} YBR149W
           (REAL)
          Length = 344

 Score =  110 bits (276), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 89/289 (30%), Positives = 143/289 (49%), Gaps = 47/289 (16%)

Query: 5   PGTTH---ALKNGVKMPCLGLGLYQTPKE---ETTNIVHNALKLGYRQVDSAQLYGNERE 58
           P TT    +L NGV++P LGLG    P+E   ET   V  A+K GYR +D+A  Y  E  
Sbjct: 18  PKTTEIYFSLNNGVRIPALGLGT-ANPQEKLAETKQAVKAAIKAGYRHIDTAWAYETEPF 76

Query: 59  ACLGITKFLEESPKVSRSDIFFTTKIKTQDQGYESAKKSIEESLNRVKELDYIDLFLIHA 118
               I + LEE   + R D+F TTK+      ++   +S+ ESL  +  LDY+DL L H 
Sbjct: 77  VGEAIKELLEEG-TIQREDLFITTKV--WPVLWDEVDRSLNESLKALG-LDYVDLLLQHW 132

Query: 119 PLTNKEKR---------------------------LGTWKAFQEYY---ETGKIKAIGVS 148
           P+   + +                           L T+K  ++ Y      +++AIGVS
Sbjct: 133 PICFGKVKDPEGISGYMKLPVDDSGKTVYASNGDWLETYKQLEKIYLDSNDHRVRAIGVS 192

Query: 149 NYGIQHLEEMYQWDGLKIDPMVNQYELNPWLTRKELSNYCHQKGMVIQAYSPLTR--ARR 206
           N+ I++LE + +    K+ P VNQ E +P L + EL  +C    +++ AYSPL    A  
Sbjct: 193 NFSIEYLERLIK--ECKVKPTVNQVESHPHLPQVELRKFCFMHDILLTAYSPLGSQGAPN 250

Query: 207 LQDPELVKLVEDSYPEQTSAQILVNWSLQMGFVPLVKTVHEDRLKENIK 255
           L+ P + KL E      T   +L+++ ++ G + + ++++  R+  NI+
Sbjct: 251 LKIPLVKKLCEKY--NVTGNDLLISYHIRQGTIVIPRSLNPVRISSNIE 297

>NCAS0I02420 Chr9 complement(454156..455118) [963 bp, 320 aa] {ON}
           Anc_3.108
          Length = 320

 Score =  109 bits (272), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 81/277 (29%), Positives = 143/277 (51%), Gaps = 42/277 (15%)

Query: 11  LKNGVKMPCLGLGLYQTPK---EETTNIVHNALKLGYRQVDSAQLYGNEREACLGITKFL 67
           L NG ++P +GLG   +PK    ET   V  A++ GYRQ+D+A  Y  E      + +  
Sbjct: 13  LNNGGRIPAIGLGT-ASPKGRYPETKKAVKAAIRAGYRQIDTAWYYKTEPYIGEALKELF 71

Query: 68  EESPKVSRSDIFFTTKIKTQDQGYESAKKSIEESLNRVKELDYIDLFLIHAPLTNKEKR- 126
            +  ++ R D+F TTK+      ++    SI ESL  +  +DY+D+ L H PL  K+   
Sbjct: 72  RDG-EIKREDLFITTKV--WPCYWDDPSTSINESLKSLG-IDYVDMVLQHWPLCYKKTYD 127

Query: 127 ------------------------LGTWKAFQEYY---ETGKIKAIGVSNYGIQHLEEMY 159
                                   + T++  ++ Y   +  +++AIGVSNY I++LE + 
Sbjct: 128 ENGTIIGKPLDKDGKVIFAEGADWITTYQLMEKIYLDPKDTRVRAIGVSNYPIEYLERVI 187

Query: 160 QWDGLKIDPMVNQYELNPWLTRKELSNYCHQKGMVIQAYSPLTR--ARRLQDPELVKLVE 217
           +    K+ P++NQ EL+P L + EL+++CH+ G+++ AYSPL    A   + P + +  +
Sbjct: 188 K--ECKVTPVINQVELHPHLPQLELNDFCHKNGILLTAYSPLGSGGAPNTKIPLVQEYAK 245

Query: 218 DSYPEQTSAQILVNWSLQMGFVPLVKTVHEDRLKENI 254
               E   A IL ++ ++ G V + ++++ +R+  NI
Sbjct: 246 KH--EVAPADILTSYHVRKGNVVIPRSLNPERVASNI 280

>ZYRO0B06138g Chr2 complement(491830..492816) [987 bp, 328 aa] {ON}
           similar to uniprot|P38115 Saccharomyces cerevisiae
           YBR149W ARA1 Large subunit of NADP dependent arabinose
           dehydrogenase involved in carbohydrate metabolism small
           subunit is unidentified
          Length = 328

 Score =  108 bits (271), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 88/308 (28%), Positives = 152/308 (49%), Gaps = 47/308 (15%)

Query: 8   THALKNGVKMPCLGLGLYQTPKE--ETTNIVHNALKLGYRQVDSAQLYGNEREACLGITK 65
           +  L NGV+MP LGLG      E   T   V  A+K GYR +D+A  YG+E      I +
Sbjct: 13  SFTLNNGVRMPALGLGTANPHPEIGRTKQAVKAAVKAGYRHIDTAWAYGSEPFVGEAIKE 72

Query: 66  FLEESPKVSRSDIFFTTKIKTQDQGYESAKKSIEESLNRVKELDYIDLFLIHAPLT---- 121
            +EE   + R DIF T+K+      ++  ++S+ ESL  +  +DYIDL+L H PL     
Sbjct: 73  LMEEG-VIRREDIFITSKV--WPVLWDDVERSLNESLESLG-VDYIDLWLQHWPLCYVKQ 128

Query: 122 ------NKEKRLGTWKAFQEYYET--------------------GKIKAIGVSNYGIQHL 155
                 N   R       + YYE                      ++++IGVSN+ +Q+L
Sbjct: 129 EDTHGINGLARNPETPNGEPYYEVDGDWLETYVQMEKIYLDPSDNRVRSIGVSNFPVQYL 188

Query: 156 EE-MYQWDGLKIDPMVNQYELNPWLTRKELSNYCHQKGMVIQAYSPLTRARRLQ-DPELV 213
           E  +++     + P VNQ E++P L + EL+ +C    ++++AYSPL          +LV
Sbjct: 189 ERTLFE---CAVKPAVNQVEMHPRLPQFELNKFCRAHNILLEAYSPLGSHNAPNVHLQLV 245

Query: 214 KLVEDSYPEQTSAQILVNWSLQMGFVPLVKTVHEDRLKENIKSCDFELSSADLKKLTHDD 273
           + + + Y   + + IL ++ ++ G   + ++V+  R+  N+     E ++   ++L + D
Sbjct: 246 QDLAEKY-SMSPSGILNSYHIRQGNAVVSRSVNTMRIASNV-----EFAALTEEELDNLD 299

Query: 274 QYYLSQPK 281
           Q  +++PK
Sbjct: 300 QLGITKPK 307

>NCAS0A13740 Chr1 complement(2699208..2700137) [930 bp, 309 aa] {ON}
           Anc_7.285
          Length = 309

 Score =  107 bits (266), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 85/282 (30%), Positives = 137/282 (48%), Gaps = 29/282 (10%)

Query: 11  LKNGVKMPCL---GLGLYQTPKEET--------TNIVHNALKL-GYRQVDSAQLYGNERE 58
           L NG K+P +   G G      EET         + +  AL L G   +D+A++Y    E
Sbjct: 10  LNNGNKIPAIAVIGTGTRWFKTEETDATFSQQLVDELKVALTLPGIVHIDAAEIYRTYPE 69

Query: 59  ACLGITKFLEESPKVSRSDIFFTTKIKTQDQGYESAKKSIEESLNRVKELDYIDLFLIHA 118
                   L ES +  R +IF T K  TQ +  +     +  SL  +  LDY+DL+L+H+
Sbjct: 70  VAAA----LRESNR-PRDEIFITDKYSTQLKLSDDPIAGLNISLKTLG-LDYVDLYLLHS 123

Query: 119 PLTNKEKRLG-TWKAFQEYYETGKIKAIGVSNYGIQHLEEMYQWDGLKIDPMVNQYELNP 177
           P       L   WK  ++ Y++GK K IGVSN+ ++ LE++ +   +K  P +NQ E N 
Sbjct: 124 PFIKNGSTLEECWKQMEKLYKSGKAKNIGVSNFRVEDLEKILKIATIK--PQINQIEFNA 181

Query: 178 WLTRKE--LSNYCHQKGMVIQAYSPLTRARRLQDPELVKLVEDSYPE------QTSAQIL 229
            L  +   +  +C +  + ++AY+PL   +R+QD    K   D   E      +T AQIL
Sbjct: 182 ALQNQSPGIVKFCKENNIQLEAYTPLGPFQRIQDTPEAKPFYDYIAELSKKYNKTEAQIL 241

Query: 230 VNWSLQMGFVPLVKTVHEDRLKENIKSCDFELSSADLKKLTH 271
           + W  + G +P+  +    RL +      F+L S+++ K+T 
Sbjct: 242 LRWVTKRGILPVTTSSKPQRLHDAQNLFSFDLESSEVDKITE 283

>Skud_4.131 Chr4 (235946..236884) [939 bp, 312 aa] {ON} YDL124W
           (REAL)
          Length = 312

 Score =  107 bits (266), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 84/286 (29%), Positives = 144/286 (50%), Gaps = 34/286 (11%)

Query: 10  ALKNGVKMPCL---GLGLYQTPKEETTNIVHN--------ALKL-GYRQVDSAQLYGNER 57
            L NG K+P +   G G       ET     N        AL+L G   +D+A++Y    
Sbjct: 9   VLNNGNKIPAIAIIGTGTRWFKNVETDATFSNSLVEQIMYALELPGIVHIDAAEIYRTYP 68

Query: 58  EACLGITKFLEESPKVSRSDIFFTTKIKTQDQGYESAKKSIEESLNRVKELDYIDLFLIH 117
           E    ++  L + P   R +IF T K  TQ +  +S    +E SL ++   DY+DL+L+H
Sbjct: 69  EVGKALS--LTKKP---RDEIFLTDKYSTQIKVSDSPAAGLEVSLKKMGT-DYVDLYLLH 122

Query: 118 APLTNKEKRLGT----WKAFQEYYETGKIKAIGVSNYGIQHLEEMYQWDGLKIDPMVNQY 173
           +P  +KE    T    WK  ++ Y+ GK K IGVSN+ ++ LE++ +   +K  P VNQ 
Sbjct: 123 SPFVSKEANGFTLEEAWKDMEQLYKAGKAKNIGVSNFAVKDLEKILKIAEVK--PQVNQI 180

Query: 174 ELNPWLTRKE--LSNYCHQKGMVIQAYSPLT--RARRLQDP-----ELVKLVEDSYPEQT 224
           E +P+L  +   +  +C    ++++AYSPL   + +  QD      E VK + + Y  ++
Sbjct: 181 EFSPFLQNQTPGIYKFCQDNNILLEAYSPLAPLQKKTAQDDSKPFFEYVKELSEKY-FKS 239

Query: 225 SAQILVNWSLQMGFVPLVKTVHEDRLKENIKSCDFELSSADLKKLT 270
            AQI++ W  + G +P+  +    R+ +      F+L+  ++ ++T
Sbjct: 240 EAQIILRWVSKRGVLPVTTSSKPQRISDAQNLFSFDLTDEEVDEIT 285

>YBR149W Chr2 (539987..541021) [1035 bp, 344 aa] {ON}  ARA1NADP+
           dependent arabinose dehydrogenase, involved in
           carbohydrate metabolism; purified as homodimer;
           naturally occurs with a N-terminus degradation product
          Length = 344

 Score =  107 bits (267), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 87/289 (30%), Positives = 145/289 (50%), Gaps = 47/289 (16%)

Query: 5   PGTTH---ALKNGVKMPCLGLGLYQTPKE---ETTNIVHNALKLGYRQVDSAQLYGNERE 58
           P TT    +L NGV++P LGLG    P E   ET   V  A+K GYR +D+A  Y  E  
Sbjct: 18  PKTTEIYFSLNNGVRIPALGLGT-ANPHEKLAETKQAVKAAIKAGYRHIDTAWAYETEPF 76

Query: 59  ACLGITKFLEESPKVSRSDIFFTTKIKTQDQGYESAKKSIEESLNRVKELDYIDLFLIHA 118
               I + LE+   + R D+F TTK+      ++   +S+ ESL  +  L+Y+DL L H 
Sbjct: 77  VGEAIKELLEDG-SIKREDLFITTKV--WPVLWDEVDRSLNESLKALG-LEYVDLLLQHW 132

Query: 119 PLTNKEKR---------------------------LGTWKAFQEYY---ETGKIKAIGVS 148
           PL  ++ +                           L T+K  ++ Y      +++AIGVS
Sbjct: 133 PLCFEKIKDPKGISGLVKTPVDDSGKTMYAADGDYLETYKQLEKIYLDPNDHRVRAIGVS 192

Query: 149 NYGIQHLEEMYQWDGLKIDPMVNQYELNPWLTRKELSNYCHQKGMVIQAYSPLTR--ARR 206
           N+ I++LE + +    ++ P VNQ E +P L + EL  +C    +++ AYSPL    A  
Sbjct: 193 NFSIEYLERLIK--ECRVKPTVNQVETHPHLPQMELRKFCFMHDILLTAYSPLGSHGAPN 250

Query: 207 LQDPELVKLVEDSYPEQTSAQILVNWSLQMGFVPLVKTVHEDRLKENIK 255
           L+ P LVK + + Y   T   +L+++ ++ G + + ++++  R+  +I+
Sbjct: 251 LKIP-LVKKLAEKY-NVTGNDLLISYHIRQGTIVIPRSLNPVRISSSIE 297

>YDL124W Chr4 (240259..241197) [939 bp, 312 aa] {ON} NADPH-dependent
           alpha-keto amide reductase; reduces aromatic alpha-keto
           amides, aliphatic alpha-keto esters, and aromatic
           alpha-keto esters; member of the aldo-keto reductase
           (AKR) family
          Length = 312

 Score =  106 bits (265), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 83/285 (29%), Positives = 145/285 (50%), Gaps = 34/285 (11%)

Query: 11  LKNGVKMPCL---GLGLYQTPKEETTNIVHN--------ALKL-GYRQVDSAQLYGNERE 58
           L NG K+P +   G G      EET     N        ALKL G   +D+A++Y    E
Sbjct: 10  LNNGNKIPAIAIIGTGTRWYKNEETDATFSNSLVEQIVYALKLPGIIHIDAAEIYRTYPE 69

Query: 59  ACLGITKFLEESPKVSRSDIFFTTKIKTQDQGYESAKKSIEESLNRVKELDYIDLFLIHA 118
               ++  L E P   R+ IF T K   Q +  +S    ++ +L ++   DY+DL+L+H+
Sbjct: 70  VGKALS--LTEKP---RNAIFLTDKYSPQIKMSDSPADGLDLALKKMGT-DYVDLYLLHS 123

Query: 119 PLTNKE----KRLGTWKAFQEYYETGKIKAIGVSNYGIQHLEEMYQWDGLKIDPMVNQYE 174
           P  +KE         WK  ++ Y++GK K IGVSN+ ++ L+ + +   +K  P VNQ E
Sbjct: 124 PFVSKEVNGLSLEEAWKDMEQLYKSGKAKNIGVSNFAVEDLQRILKVAEVK--PQVNQIE 181

Query: 175 LNPWLTRKE--LSNYCHQKGMVIQAYSPL--TRARRLQDP-----ELVKLVEDSYPEQTS 225
            +P+L  +   +  +C +  ++++AYSPL   + +  QD      E VK + + Y  ++ 
Sbjct: 182 FSPFLQNQTPGIYKFCQEHDILVEAYSPLGPLQKKTAQDDSQPFFEYVKELSEKYI-KSE 240

Query: 226 AQILVNWSLQMGFVPLVKTVHEDRLKENIKSCDFELSSADLKKLT 270
           AQI++ W  + G +P+  +    R+ +      F+L++ ++ K+T
Sbjct: 241 AQIILRWVTKRGVLPVTTSSKPQRISDAQNLFSFDLTAEEVDKIT 285

>KNAG0K02070 Chr11 complement(419556..420527) [972 bp, 323 aa] {ON}
           Anc_3.108 YBR149W
          Length = 323

 Score =  106 bits (265), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 87/276 (31%), Positives = 141/276 (51%), Gaps = 45/276 (16%)

Query: 11  LKNGVKMPCLGLGLYQTPKE---ETTNIVHNALKLGYRQVDSAQLYGNEREACLGITKFL 67
           L NGV MP LGLG   +P+E   ET   V  A+K GYR +D+A  YG E      + + L
Sbjct: 13  LNNGVNMPALGLGT-ASPREHMAETKQAVKAAIKAGYRHIDTAWFYGTEGYIGDALKELL 71

Query: 68  EESPKVSRSDIFFTTKIKTQDQGYESAKKSIEESLNRVKELDYIDLFLIHAPLTNKE--- 124
           E    V RSD+F T+K+      ++    S+ ESL  +  LDY+DL+L H PL  ++   
Sbjct: 72  ENG-DVKRSDLFITSKV--WPVYWDDVDLSLNESLKSLG-LDYVDLYLQHWPLCFQKIED 127

Query: 125 -------------------------KRLGTWKAFQEYY---ETGKIKAIGVSNYGIQHLE 156
                                      L T+K  ++ Y   +  +++AIGVSNY +++L+
Sbjct: 128 SKDGVNGLKGKPIDKDGNALIVEGADYLSTYKQMEKIYLDPKDNRVRAIGVSNYPVEYLD 187

Query: 157 EMYQWDGLKIDPMVNQYELNPWLTRKELSNYCHQKGMVIQAYSPL--TRARRLQDPELVK 214
            + +   +K  P VNQ E++P L + EL  +C    + + AYSPL  + A  L+ P LVK
Sbjct: 188 RLLKVCTVK--PAVNQVEMHPHLPQFELREFCELHDIKLTAYSPLGSSGAPLLKLP-LVK 244

Query: 215 LVEDSYPEQTSAQILVNWSLQMGFVPLVKTVHEDRL 250
            + + Y + T   +L+++ ++ G   + ++++  RL
Sbjct: 245 ELSEKY-QVTLNDVLISYHIRKGSFVIPRSLNPVRL 279

>KLLA0F02728g Chr6 (249240..250232) [993 bp, 330 aa] {ON} similar to
           uniprot|P38115 Saccharomyces cerevisiae YBR149W ARA1
           Large subunit of NADP dependent arabinose dehydrogenase
           involved in carbohydrate metabolism small subunit is
           unidentified
          Length = 330

 Score =  105 bits (261), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 87/294 (29%), Positives = 139/294 (47%), Gaps = 44/294 (14%)

Query: 11  LKNGVKMPCLGLGLYQTPKE--ETTNIVHNALKLGYRQVDSAQLYGNEREACLGITKFLE 68
             NG K+P  GLG     +   ET   V  A+K GYR +D+A  YG E      + +  E
Sbjct: 13  FNNGNKVPAFGLGTAAQHERVAETKQAVKAAIKAGYRHIDTAWAYGVEEYVGEALQELFE 72

Query: 69  ESPKVSRSDIFFTTKIKTQDQGYESAKKSIEESLNRVKELDYIDLFLIHAPLTN------ 122
           E   V R D+  T+K+      +    KS+ ESL R+K +DY+DLFL H PL        
Sbjct: 73  ER-VVKREDLHITSKV--WHTMWNDVDKSLNESLARLK-VDYVDLFLQHWPLCTQKVPDP 128

Query: 123 ---------------------KEKRLGTWKAFQEYY---ETGKIKAIGVSNYGIQHLEEM 158
                                K   + T+K  ++ Y      +++AIGVSN+ I++L+ +
Sbjct: 129 HGVDKIAKEPVDDQGNPLYDEKGDWIETYKQIEKIYLDKNDKRVRAIGVSNFPIEYLKRV 188

Query: 159 YQWDGLKIDPMVNQYELNPWLTRKELSNYCHQKGMVIQAYSPL--TRARRLQDPELVKLV 216
            +    +  P  NQ EL+P L ++EL  +C +  +++ AYSPL    A  L+ P L  L 
Sbjct: 189 LK--ECRTVPACNQVELHPHLPQRELCEFCSEHKILVTAYSPLGGNGAPLLELPILKGLC 246

Query: 217 EDSYPEQTSAQILVNWSLQMGFVPLVKTVHEDRLKENIKSCDFELSSADLKKLT 270
           E      +   IL ++ L+ G + + ++++  R+  N++     LS  D+ KL 
Sbjct: 247 EKY--NASPNDILTSYHLRQGTIVIPRSLNSTRIASNLEF--VPLSEEDVNKLN 296

>SAKL0F00704g Chr6 (60941..61888) [948 bp, 315 aa] {ON} similar to
           uniprot|Q07551 Saccharomyces cerevisiae YDL124W
           NADPH-dependent alpha-keto amide reductase reduces
           aromatic alpha-keto amides aliphatic alpha-keto esters
           and aromatic alpha-keto esters
          Length = 315

 Score =  103 bits (256), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 70/247 (28%), Positives = 125/247 (50%), Gaps = 19/247 (7%)

Query: 36  VHNALKLGYRQVDSAQLYGNEREACLGITKFLEESPKVSRSDIFFTTKIKTQDQGYESAK 95
           V NA++ G+  +D+A+ Y   +E   GI+     + +V R  ++ T K       +    
Sbjct: 50  VTNAIQCGFNHIDTAEAYKTYKEVGTGIS-----NAQVPRETLWITDKYTPWSWEWRKGS 104

Query: 96  KSIEESLNRVKE--LDYIDLFLIHAP-LTNKEKRLG---TWKAFQEYYETGKIKAIGVSN 149
             +E     +KE  LDY+DL++IH P +T K   +     W   +E Y     + IGVSN
Sbjct: 105 GPLESLTLSLKEMNLDYVDLYMIHVPNITTKTAGIDLKEAWLQMEEIYTRKMARNIGVSN 164

Query: 150 YGIQHLEEMYQWDGLKIDPMVNQYELNPWLTRKE--LSNYCHQKGMVIQAYSPL---TRA 204
           + ++ LE +  +   K  P+VNQ E + ++ ++   +  YC +  +V++ YSPL   T+ 
Sbjct: 165 FDVESLEYIKSF--AKYQPVVNQIEFSAYMQQQSPGILKYCRENNIVVEGYSPLVPLTKG 222

Query: 205 RRLQDPELVKLVEDSYPEQTSAQILVNWSLQMGFVPLVKTVHEDRLKENIKSCDFELSSA 264
           +     E++  +   Y  ++  Q+L+ W  Q G V +  T  ++RL E++   DFELS  
Sbjct: 223 KPGPLDEILPGIAAKYG-KSQLQVLLRWVTQNGIVVITTTGKKERLNESLNIFDFELSKE 281

Query: 265 DLKKLTH 271
           D  ++T+
Sbjct: 282 DFDQITN 288

>TDEL0D02790 Chr4 complement(533517..534506) [990 bp, 329 aa] {ON} 
          Length = 329

 Score =  100 bits (248), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 83/283 (29%), Positives = 140/283 (49%), Gaps = 30/283 (10%)

Query: 10  ALKNGVKMPCL---GLGLYQTPKEET-TNI-------VHNALKL-GYRQVDSAQLYGNER 57
            L NG K+P +   G G      EET +N        +  AL L G   +D+A+ Y   +
Sbjct: 28  TLNNGNKIPAVAVVGTGTTWFKNEETESNFSKELVEQIKYALTLPGIVHLDAAECYNTYQ 87

Query: 58  EACLGITKFLEESPKVSRSDIFFTTKIKTQDQGYESAKKSIEESLNRVKELDYIDLFLIH 117
           E    + + L ESPK  R +IF T K     + +    +  E  + ++  +DY+DL+LIH
Sbjct: 88  E----LGQALRESPK-PRDEIFITDKFSPTPKNHGGVLERFESGIKKMG-VDYVDLYLIH 141

Query: 118 APLTNKEKRLGT----WKAFQEYYETGKIKAIGVSNYGIQHLEEMYQWDGLKIDPMVNQY 173
           +PL  KEK   T    WK  ++ YE GK K IGVSN+ ++ L+ + +    K+ P VNQ 
Sbjct: 142 SPLIEKEKNGVTLEEVWKDLEKLYEAGKAKNIGVSNFRVEDLQRILKV--AKVKPQVNQI 199

Query: 174 ELNPWLTRKE--LSNYCHQKGMVIQAYSPLTRARRLQDP--ELVKLVEDSYPE--QTSAQ 227
           E + +L  +   +  +     + ++AY+PL   +R Q    +    VE+   +  +T AQ
Sbjct: 200 EFHVFLQNQTPGIVKFSQDNNIQLEAYTPLGPLQRKQSDAGDFYNYVEELAKKYGKTEAQ 259

Query: 228 ILVNWSLQMGFVPLVKTVHEDRLKENIKSCDFELSSADLKKLT 270
           +L+ W  +   +P+  +    R++       F+L+  ++KK+T
Sbjct: 260 VLLRWVTRRHVLPITTSSKPQRIQAAQDLFSFDLTDEEVKKIT 302

>Kwal_47.19278 s47 complement(1169418..1170362) [945 bp, 314 aa]
           {ON} YDL124W - Hypothetical ORF [contig 344] FULL
          Length = 314

 Score = 99.8 bits (247), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 69/252 (27%), Positives = 124/252 (49%), Gaps = 21/252 (8%)

Query: 31  ETTNIVHNALKLGYRQVDSAQLYGNEREACLGITKFLEESPKVSRSDIFFTTKIKTQDQG 90
           E  + V +A+  G+  +D+A+ Y    E   G+     ++  V R  ++ T K       
Sbjct: 44  ELADQVTSAINAGFNHIDAAEAYKTHPEVGRGV-----KNSGVPRDKLWITDKYTPWSWD 98

Query: 91  YESAKKSIEE---SLNRVKELDYIDLFLIHAPLTNKEKR----LGTWKAFQEYYETGKIK 143
           +      +E    SL ++ ++ Y+DL+L+H P    +         W+  +E Y+ G  K
Sbjct: 99  WRKGTGPLESLSLSLEKM-QMSYVDLYLLHVPFITVQTAGIDLKEAWRQMEEIYDRGLAK 157

Query: 144 AIGVSNYGIQHLEEMYQWDGLKIDPMVNQYELNPWLTRKE--LSNYCHQKGMVIQAYSPL 201
            IGVSN+ ++ LE + +    K  P+VNQ E N +L ++   +  YC    +V++ YSPL
Sbjct: 158 NIGVSNFDVESLEYITKIG--KYLPVVNQIEFNAYLQQQSPGIIAYCKDHDIVVEGYSPL 215

Query: 202 ---TRARRLQDPELVKLVEDSYPEQTSAQILVNWSLQMGFVPLVKTVHEDRLKENIKSCD 258
              T+ R     +L+  + + Y  ++  QIL+ W  Q G V +  +  + R+KE++   D
Sbjct: 216 VPLTKGRPGPLDKLLPALAEKY-HKSELQILLRWVTQNGVVVITTSAQQARVKESVNIFD 274

Query: 259 FELSSADLKKLT 270
           FEL++ D   +T
Sbjct: 275 FELTAEDFDSIT 286

>ZYRO0C09196g Chr3 complement(698826..699764) [939 bp, 312 aa] {ON}
           highly similar to uniprot|Q07551 Saccharomyces
           cerevisiae YDL124W NADPH-dependent alpha-keto amide
           reductase reduces aromatic alpha-keto amides aliphatic
           alpha-keto esters and aromatic alpha-keto esters
          Length = 312

 Score = 99.4 bits (246), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 83/303 (27%), Positives = 144/303 (47%), Gaps = 39/303 (12%)

Query: 11  LKNGVKMPC---LGLGLYQTPKEET-TNIVHNALKL--------GYRQVDSAQLYGNERE 58
           L NG K+P    +G G     KEET  N  H  +K         G   VD A++Y    E
Sbjct: 10  LNNGNKIPAVAVIGTGTRWYKKEETDANFSHALVKQIEYALTLPGVVHVDHAEVYRTYPE 69

Query: 59  ACLGITKFLEESPKVSRSDIFFTTKIKTQDQGYESAKKSIEESLNRVKELDYIDLFLIHA 118
               +     ++ K  R++IF T K   Q++     ++ ++  L R   L+Y+DL+L+H+
Sbjct: 70  FSEAL-----KNTKKPRNEIFVTDKYSVQEKITNDPREGLDTGLKRTG-LEYVDLYLLHS 123

Query: 119 PLTNKEKRLGT----WKAFQEYYETGKIKAIGVSNYGIQHLEEMYQWDGLKIDPMVNQYE 174
           P  +KEK   T    W   +E Y  GK K IGVSN+ ++ LE++ +    K+ P VNQ E
Sbjct: 124 PFASKEKNGFTIEEAWAQLEELYHEGKAKNIGVSNFRVEDLEKILKV--AKVKPQVNQIE 181

Query: 175 LNPWLTRKE--LSNYCHQKGMVIQAYSPLTRARRLQDPELVKLVEDSYPE------QTSA 226
            + +L  +   +  +     + ++AY+PL    +  + E  K   D   +      +T A
Sbjct: 182 FSAFLQNQTPGVVKFSQDHDIQLEAYAPLGPLSKRDESEQAKPFYDYIKKLTEKYSKTEA 241

Query: 227 QILVNWSLQMGFVPLVKTVHEDRLKENIKSCDFELSSADLKKLTHDDQYYLSQPK----W 282
           QIL+ W  + G +P+  +    R+++      F+L+  ++ ++T   +  L+ P     W
Sbjct: 242 QILLRWVSKRGILPVTTSGQPKRIEDAQNLFGFDLTKDEVDEIT---KLGLAHPALRLYW 298

Query: 283 DPI 285
           +P+
Sbjct: 299 NPL 301

>NDAI0A02300 Chr1 (516594..517535) [942 bp, 313 aa] {ON} Anc_7.285
          Length = 313

 Score = 99.4 bits (246), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 81/287 (28%), Positives = 147/287 (51%), Gaps = 35/287 (12%)

Query: 10  ALKNGVKMPCLGL---------GLYQTPK--EETTNIVHNALKL-GYRQVDSAQLYGNER 57
            L NG K+P + +         G  ++ K  +E  + +  AL L G   +D+A++Y    
Sbjct: 9   TLNNGNKIPAISIIGTGTKWHHGKLESGKFSDELVDQLQYALTLPGIIHIDAAEMYNTYP 68

Query: 58  EACLGITKFLEESPKVSRSDIFFTTKIKTQDQGY-ESAKKSIEESLNRVKELDYIDLFLI 116
           E    + K L+ + KV R +IF T K  +      E+    + +SL  + ELDY+DL+L+
Sbjct: 69  E----VNKALKSTSKV-RDEIFITDKYYSGSPKLTENPIAGLTKSLKEL-ELDYVDLYLL 122

Query: 117 HAPLTNKEKRLGT----WKAFQEYYETGKIKAIGVSNYGIQHLEEMYQWDGLKIDPMVNQ 172
           H+P   KE    T    WK  ++ Y+ GK K IGVSN+ +  L+ + +    +I P +NQ
Sbjct: 123 HSPFITKESCGYTMEEAWKQMEKLYKDGKAKNIGVSNFSVDDLKRILKI--CEIKPQINQ 180

Query: 173 YELNPWLTRKE--LSNYCHQKGMVIQAYSPLTRARRL---QDP----ELVKLVEDSYPEQ 223
            E N +L  +   +  +C    ++++AYSPL   R+    +DP    + ++ +   Y  +
Sbjct: 181 IEFNAFLQNQTPGIVKFCQDHDILVEAYSPLGPLRKKPTDRDPGPFYQYIEELAKKYG-K 239

Query: 224 TSAQILVNWSLQMGFVPLVKTVHEDRLKENIKSCDFELSSADLKKLT 270
           +  Q+L+ W  +   +P+  +  E+R+K+      F+L+S +++K+T
Sbjct: 240 SEGQVLLRWVTKRKILPITTSGKEERIKDAQDLFSFDLTSEEVEKIT 286

>ZYRO0E09614g Chr5 complement(765913..766839) [927 bp, 308 aa] {ON}
           similar to uniprot|Q07551 Saccharomyces cerevisiae
           YDL124W NADPH-dependent alpha-keto amide reductase
           reduces aromatic alpha-keto amides aliphatic alpha-keto
           esters and aromatic alpha-keto esters
          Length = 308

 Score = 98.6 bits (244), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 69/248 (27%), Positives = 123/248 (49%), Gaps = 33/248 (13%)

Query: 38  NALKLGYRQVDSAQLYGNEREACLGITKFLEESPKVSRSDIFFTTKIKTQDQG------- 90
            A+ LG+  +D+A+ Y    E    + +      ++ R  +F T K    +QG       
Sbjct: 52  TAVDLGFNHIDTAEFYLTHEEVGEALRR-----SQLPRDKLFITDKY---NQGAWTGLDC 103

Query: 91  ---YESAKKSIEESLNRVKELDYIDLFLIHAPLTNKEKR----LGTWKAFQEYYETGKIK 143
               ++AKK +E        + Y DL+++H P   KE         W+  +E YE G  K
Sbjct: 104 SGPIQAAKKGLE-----ALGIKYFDLYMLHRPDITKENAGIDLQEAWRQVEELYEAGIAK 158

Query: 144 AIGVSNYGIQHLEEMYQWDGLKIDPMVNQYELNPWLTRKE--LSNYCHQKGMVIQAYSPL 201
           AIGVSN+ ++ L++M  +   +  PMV+Q E +P+L  +   +  +C  K +V++AYSPL
Sbjct: 159 AIGVSNFPLETLKQMESY--CRYLPMVHQVEFHPYLQNQSPGVVEWCQNKHIVVEAYSPL 216

Query: 202 TRARRLQDPELVKLVEDSYPE--QTSAQILVNWSLQMGFVPLVKTVHEDRLKENIKSCDF 259
               R +   L  ++ +   +  ++  QI++ W +  G V L  +  E+R+ E + + DF
Sbjct: 217 APLFRARPGPLDDILPNLMKKYGKSETQIVLRWVIDRGIVALTTSSKEERIHEILGTLDF 276

Query: 260 ELSSADLK 267
           EL  +D++
Sbjct: 277 ELEKSDVE 284

>Kpol_381.8 s381 complement(20844..21359,21366..21695,21698..21781)
           [930 bp, 309 aa] {ON}
           complement(20844..21359,21366..21695,21698..21781) [930
           nt, 310 aa]
          Length = 309

 Score = 98.6 bits (244), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 77/243 (31%), Positives = 128/243 (52%), Gaps = 19/243 (7%)

Query: 39  ALKL-GYRQVDSAQLYGNEREACLGITKFLEESPKVSRSDIFFTTKIKTQDQGYESAKKS 97
           AL L G   VD+A+ Y    E    + K L+ES K  R++IF T K  T  +   +  ++
Sbjct: 48  ALSLPGIVHVDAAEYYRTYPE----LNKALKESSK-PRNEIFITDKFSTLLKITANPIEA 102

Query: 98  IEESLNRVKELDYIDLFLIHAPLTNKE-KRLGTWKAFQEY-YETGKIKAIGVSNYGIQHL 155
           +  +L+ +  LDY+DL+++H P  + E K L    A+ E  Y+ GK K IGVSN+ I+HL
Sbjct: 103 LNTALDSLG-LDYVDLYVLHFPEFDPEYKDLSIETAWMELLYKEGKAKNIGVSNFSIEHL 161

Query: 156 EEMYQWDGLKIDPMVNQYELNPWLTRKE--LSNYCHQKGMVIQAYSPLTRARR----LQD 209
           E + +   +K  P VNQ E N +L  +   +  YC Q G  ++AYSPL   +R      +
Sbjct: 162 ERVMKIADVK--PQVNQIEFNAFLQNQTPGIVKYCQQNGFQLEAYSPLAPLQRKPKNFNE 219

Query: 210 PELVKLVEDSYPE--QTSAQILVNWSLQMGFVPLVKTVHEDRLKENIKSCDFELSSADLK 267
               K +++   +  +T ++IL+ W  + G VP+  +   +R+        F+L+  ++ 
Sbjct: 220 LPFYKYIDEVSAKYGKTDSEILLRWVTKRGIVPITTSSRHERIVNAQNLFSFDLTDEEVD 279

Query: 268 KLT 270
           K+T
Sbjct: 280 KIT 282

>CAGL0J09394g Chr10 (925839..926774) [936 bp, 311 aa] {ON} similar
           to uniprot|Q07551 Saccharomyces cerevisiae YDL124w
          Length = 311

 Score = 94.0 bits (232), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 74/249 (29%), Positives = 127/249 (51%), Gaps = 29/249 (11%)

Query: 39  ALKL-GYRQVDSAQLYGNEREACLGITKFLEESPKVSRSDIFFTTKIKTQDQGYESAKKS 97
           AL L G   +D+A+ Y   RE    + + L E+ K  R +IF T K  T  +  E+    
Sbjct: 48  ALSLPGVVHLDAAEFYMTYRE----VGRALAETSK-PRDEIFITDKYWTLSKVTENPIVG 102

Query: 98  IEESLNRVKELDYIDLFLIHAPLTNKEKRLGT----WKAFQEYYETGKIKAIGVSNYGIQ 153
           +E  L R+  L+Y+DL+L+H+P  +KE    +    W   +E Y +GK K IGVSN+  +
Sbjct: 103 LETGLKRLG-LEYVDLYLLHSPFISKETNGFSLEEAWGMMEELYHSGKAKNIGVSNFAKE 161

Query: 154 HLEEMYQWDGLKIDPMVNQYELNPWLTRKE--LSNYCHQKGMVIQAYSPLTRARRLQDPE 211
            LE + +    K+ P VNQ E N +L  +   + N+C Q  + + AYSPL   ++   P 
Sbjct: 162 DLERVLKV--CKVKPQVNQIEFNAFLQNQTPGIYNFCKQNDIQLAAYSPLGPLQK--KPA 217

Query: 212 ----------LVKLVEDSYPEQTSAQILVNWSLQMGFVPLVKTVHEDRLKENIKSCDFEL 261
                     + KL +  +  +T  Q+L+ W  + G V +  +  ++R+K+  +  +F+L
Sbjct: 218 DGNSQPFYSYINKLAQ--HYNKTPGQVLLRWVTKRGVVAVTTSEKKERIKQAQEIFEFDL 275

Query: 262 SSADLKKLT 270
              ++ ++T
Sbjct: 276 KDDEVTEIT 284

>Kwal_33.13274 s33 (151643..151969) [327 bp, 108 aa] {ON} YJR096W -
           Hypothetical ORF [contig 119] FULL
          Length = 108

 Score = 87.8 bits (216), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 41/94 (43%), Positives = 67/94 (71%), Gaps = 1/94 (1%)

Query: 7   TTHALKNGVKMPCLGLGLYQTPKEETTNIVHNALKLGYRQVDSAQLYGNEREACLGITKF 66
           T + L NG ++P +G G+Y+ PKE+T + V++ALK GYR +D+A LY N++EA  G+ K+
Sbjct: 11  TRYKLNNGQQIPVIGFGVYEIPKEDTADRVYSALKDGYRHIDTAVLYRNQKEAAQGVRKY 70

Query: 67  LEESPKVSRSDIFFTTKIKTQDQGYESAKKSIEE 100
           L+E+ + +R +I+FTTK+     G E  KK+++E
Sbjct: 71  LDETGE-ARENIWFTTKLWDSQFGREETKKALQE 103

>TBLA0F01980 Chr6 (493378..494286) [909 bp, 302 aa] {ON} Anc_7.285
           YDL124W
          Length = 302

 Score = 92.0 bits (227), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 73/282 (25%), Positives = 141/282 (50%), Gaps = 30/282 (10%)

Query: 10  ALKNGVKMPCL-----GLGLYQ-TPKEETTNI----VHNALKL-GYRQVDSAQLYGNERE 58
            L NG K+P +     G   Y+  P+++ ++     + NAL+L G   +D A++Y    E
Sbjct: 9   TLNNGNKIPGISIIGTGTRWYKYNPEDKYSDALVKQIENALELPGMLHIDCAEMYQTHAE 68

Query: 59  ACLGITKFLEESPKVSRSDIFFTTKIKTQDQGYESAKKSIEESLNRVKELDYIDLFLIHA 118
               +      + K  R +IF T K     +   + K+ ++ +L ++  L+Y+DL+L+H 
Sbjct: 69  VGEAL-----RNSKKPRDEIFITDKYAIPRKFSSNPKEGLKLALEKMG-LEYVDLYLLHF 122

Query: 119 PLTNKEKRLGT----WKAFQEYYETGKIKAIGVSNYGIQHLEEMYQWDGLKIDPMVNQYE 174
           P+ + +    T    WK  ++ Y  G  K IGVSN+ ++ LE++ +     I P +NQ E
Sbjct: 123 PIIDPKLYDFTLEEAWKMMEDLYNEGLAKNIGVSNFRVEDLEQLSK--SWVIKPQINQIE 180

Query: 175 LNPWLTRKE--LSNYCHQKGMVIQAYSPLTRARRLQDPEL----VKLVEDSYPEQTSAQI 228
            N +L  +   + +YC +  + ++A+ PL   R + + +L    VK +   Y  +T  QI
Sbjct: 181 FNAYLQNQTPGIYDYCIKNNIQLEAFCPLVPLREVNEKDLLPLYVKQLAQKY-SKTENQI 239

Query: 229 LVNWSLQMGFVPLVKTVHEDRLKENIKSCDFELSSADLKKLT 270
           ++ W  Q   +P+  +   +R+++      FEL+  +++ +T
Sbjct: 240 MLRWVSQRKVIPVTTSSRPERVRDAYDIFSFELTQDEVEFIT 281

>SAKL0F09746g Chr6 complement(746292..747230) [939 bp, 312 aa] {ON}
           highly similar to uniprot|Q07551 Saccharomyces
           cerevisiae YDL124W NADPH-dependent alpha-keto amide
           reductase reduces aromatic alpha-keto amides aliphatic
           alpha-keto esters and aromatic alpha-keto esters
          Length = 312

 Score = 90.5 bits (223), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 84/291 (28%), Positives = 143/291 (49%), Gaps = 46/291 (15%)

Query: 11  LKNGVKMPCL-----GLGLYQTPK------EETTNIVHNALKL-GYRQVDSAQLYGNERE 58
           L NG K+P +     G   ++T +      +E  + V  AL L G   +D+A++Y    E
Sbjct: 10  LNNGNKIPAVAVIGTGTKWFKTEENASKFSDELVDQVKYALTLPGVVHIDAAEIYRTYPE 69

Query: 59  ACLGITKFLEESPKVSRSDIFFTTKIKTQDQGYESAKKSIEESLNRVKELDYIDLFLIHA 118
               + K L E+ K  R++I+ T K  T  +  ++     E  L  +  +DYIDL+L+H+
Sbjct: 70  ----LGKALRETKK-PRNEIWITDKYSTSLKLSDNPIVGFENGLKELG-VDYIDLYLLHS 123

Query: 119 PLTNKEKRLG-----TWKAFQEYYETGKIKAIGVSNYGIQHLEEMYQWDGLKIDPMVNQY 173
           P    E R G      WK  +E Y++GK K IGVSN+  + LE + +    +I P VNQ 
Sbjct: 124 PFIT-EGRNGFTLEQAWKYLEELYKSGKAKNIGVSNFAKEDLERILKI--AEIKPQVNQI 180

Query: 174 ELNPWLTRKE--LSNYCHQKGMVIQAYSPLTRARRLQDPELVKLVEDSYP---------- 221
           E + +L  +   + N+  +  ++++AYSPL   +R   PE      DS P          
Sbjct: 181 EYSAFLQNQTPGIYNFAKENDILLEAYSPLGPLQR--RPEEA----DSLPFYKYINELAE 234

Query: 222 --EQTSAQILVNWSLQMGFVPLVKTVHEDRLKENIKSCDFELSSADLKKLT 270
              ++ AQ+L+ W  + G +P+  +    R+ +      F+L+S +++K+T
Sbjct: 235 KYGKSEAQVLLRWVSKRGVLPVTTSSKPHRVHDAQHIFTFDLTSTEVEKIT 285

>Ecym_3264 Chr3 complement(503010..503945) [936 bp, 311 aa] {ON}
           similar to Saccharomyces cerevisiae YDL124W
          Length = 311

 Score = 89.0 bits (219), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 69/241 (28%), Positives = 117/241 (48%), Gaps = 23/241 (9%)

Query: 43  GYRQVDSAQLYGNEREACLGITKFLEESPKVSRSDIFFTTKIKTQDQGYESAKKSIEESL 102
           G+  + +A+ Y N      G+     ++ +  R +I+ T K  +Q +   S  +++E SL
Sbjct: 54  GFLHIMTAEFYPNN-----GLLSAALKASQKPRHEIWITDKYCSQCKLSSSPIEALERSL 108

Query: 103 NRVKELDYIDLFLIHAPLT----NKEKRLGTWKAFQEYYETGKIKAIGVSNYGIQHLEEM 158
           +R+   DY+DL+LIH P      N       WK  +  Y+TGK+K IGVSN+ I+ LE +
Sbjct: 109 DRLG-FDYVDLYLIHNPCLDSSPNGISLEKAWKQMELLYKTGKVKNIGVSNFRIEDLERL 167

Query: 159 YQWDGLKIDPMVNQYELNPWLTRK--ELSNYCHQKGMVIQAYSPL----TRARRLQDPEL 212
                 +I P VN+ E + +L  +   +  Y     +++  YSPL    T+     D   
Sbjct: 168 ---KDAEIKPQVNEIEFHAFLQNQTPNIYEYAKTHDLLLCGYSPLFPLETKTEDFMDFPF 224

Query: 213 VKLV---EDSYPEQTSAQILVNWSLQMGFVPLVKTVHEDRLKENIKSCDFELSSADLKKL 269
            + +    + Y  +T AQIL++W   +G +P++        KE      FEL+S +L  +
Sbjct: 225 YRYIIGLAEKY-NKTEAQILLHWMNCLGVLPVITNTKVKWYKEASDIISFELTSEELDMI 283

Query: 270 T 270
           T
Sbjct: 284 T 284

>TBLA0E05040 Chr5 (1303453..1304481) [1029 bp, 342 aa] {ON} 
          Length = 342

 Score = 55.5 bits (132), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 76/309 (24%), Positives = 128/309 (41%), Gaps = 70/309 (22%)

Query: 29  KEETTNIVHNALKLGYRQVDSAQLYGN-EREACLGITKFLE--ESPK---VSRSDIFF-- 80
           KEE   I+ +A   G R  D+A +Y N   E  LG  +FL     P+   V  + +FF  
Sbjct: 39  KEEIFGILKHAYDRGLRTYDTADVYSNGMSETILG--EFLRTYNIPRETVVIMTKVFFPV 96

Query: 81  -------TTKIKTQ-------DQGYESAKKSIEESLNRVKELD-YIDLFLIHAPLTNKEK 125
                  + + KT+       +Q + S K  +    N VK L  YID++ IH    ++  
Sbjct: 97  DDKMDISSNRTKTEEENLQLINQQHLSRKHILNAVKNSVKRLGTYIDVYQIHR-CDHETP 155

Query: 126 RLGTWKAFQEYYETGKIKAIGVSNY------GIQHLEEMYQWDGLKIDPMVNQYELNPWL 179
              T +A  +  E G ++ +G S+        +Q + E + W   K   M + Y L    
Sbjct: 156 FEETMRALNDVVEQGDVRYLGASSMLAVEFAEMQFIAEKHGWH--KFVNMQSCYNLVYRE 213

Query: 180 TRKELSNYCHQKGMVIQAYSPLTR---------------------ARRLQ-----DPELV 213
             +E+  +C + G+ +  +SP+ +                     AR+L      + E++
Sbjct: 214 DEREMIPFCKRHGIALTPWSPIQKGLLARPLGSHTHRESTDGVLIARKLNQFTESEKEII 273

Query: 214 KLVEDSYPEQT--SAQILVNWSLQMGFVPLVKTVHEDRLKENIKSCDFELSSADLKKLTH 271
             VE    ++      I + W +Q G +P++     +R+ E IK+           KLT 
Sbjct: 274 NRVEKLAIKKNLKMVDISLGWVIQKGTLPILGMSSIERVDEAIKTLT--------TKLTE 325

Query: 272 DDQYYLSQP 280
           DD YYL +P
Sbjct: 326 DDMYYLEEP 334

>NDAI0J00730 Chr10 complement(155561..156592) [1032 bp, 343 aa] {ON}
           
          Length = 343

 Score = 54.7 bits (130), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 75/296 (25%), Positives = 123/296 (41%), Gaps = 58/296 (19%)

Query: 29  KEETTNIVHNALKLGYRQVDSAQLYGN----------------EREACLGITKF---LEE 69
           KE+  NI+ +    G R  D+A +Y N                +RE  +  TK    ++E
Sbjct: 39  KEKIFNILKHCYDNGLRTYDTADVYSNGVSERLIGEFLKKYNIKRETVVIFTKIFYAVDE 98

Query: 70  SPKVSRSDI-FFTTKIKTQDQGYESAKKSIEESLNRVKELD-YIDLFLIHAPLTNKEKRL 127
           +  + RS++      +   +QG  S K  I    N V+ L  YID+  IH  L +   + 
Sbjct: 99  TLDLPRSNVPNERNDLDLANQGGLSRKHIITGVKNSVERLGTYIDVLQIHR-LDHDTPKE 157

Query: 128 GTWKAFQEYYETGKIKAIGVSNY------GIQHLEEMYQWDGLKIDPMVNQYELNPWLTR 181
              +A  +    G ++ IG S+        +Q   E   W   K     + Y L      
Sbjct: 158 EIMRALNDVIVEGSVRYIGASSMWATEFAELQFTAEKNGW--FKFVSSQSYYNLLNREDE 215

Query: 182 KELSNYCHQKGMVIQAYSP-----LTR------ARRLQDP---------------ELVKL 215
           +EL  +C + G+ +  +SP     LTR       R+L DP               E+VK 
Sbjct: 216 RELIPFCKRHGVGLIPWSPNARGILTRPLEQQSTRKLSDPTITNMGLDNLADDQKEIVKR 275

Query: 216 VEDSYPEQ--TSAQILVNWSLQMGFVPLVKTVHEDRLKENIKSCDFELSSADLKKL 269
           VE    ++  + A + ++W+L  G  P+V     +R+ E IK+ D +L+  D+K L
Sbjct: 276 VEHLATKKNISMAMLSISWALHKGANPIVGLNSIERVDEAIKAIDVKLTEDDIKYL 331

>KLTH0E01474g Chr5 complement(143734..144675) [942 bp, 313 aa] {ON}
           conserved hypothetical protein
          Length = 313

 Score = 52.0 bits (123), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 56/194 (28%), Positives = 89/194 (45%), Gaps = 22/194 (11%)

Query: 29  KEETTNIVHNALKLGYRQVDSAQLYGNEREACLGITKFLEESPKVSRSDIFFTTKIKTQD 88
           +EE +  V    K    ++D+A++Y    EA   I KF  E PK         TK +   
Sbjct: 19  QEEASKFVDVLEKYKVEELDTARIYPGSEEA---IGKF--ELPK----SFIIDTKARGFG 69

Query: 89  QGY---ESAKKSIEESLNRVKELDYIDLFLIHAP--LTNKEKRLGTWKAFQEYYETGKIK 143
           +G    ES  +SIEES   +  ++ +++F +H P   T  E+   T  A    Y+ GK K
Sbjct: 70  EGTLTKESINESIEESFGLLG-VESVEIFYLHCPDPATPLEE---TLDAIDALYKEGKFK 125

Query: 144 AIGVSNYGIQHLEEMYQWDGLK--IDPMVNQYELNPWLTRKELSNY--CHQKGMVIQAYS 199
             GVSN+  + + ++Y ++  K  + P V Q   N    + E S +    + G+   AYS
Sbjct: 126 KFGVSNFSPEDVRKIYSYNKEKGYVLPTVYQGNYNAVGRKIETSLFPVLRELGLSFYAYS 185

Query: 200 PLTRARRLQDPELV 213
           P+      + PE V
Sbjct: 186 PIAGGFLAKTPEEV 199

>TDEL0A08000 Chr1 (1399350..1400309) [960 bp, 319 aa] {ON} 
          Length = 319

 Score = 51.6 bits (122), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 57/199 (28%), Positives = 98/199 (49%), Gaps = 23/199 (11%)

Query: 15  VKMPCLGLGLY---QTPKEETTNIVHNALKLGYRQVDSAQLY-GNERE-ACLGITKFLEE 69
            ++P +  G Y     PK+E + +     + G  + D+A++Y G+E+    LGI   L  
Sbjct: 2   AELPKIVYGAYPITALPKDEFSKLYSLLRENGVTEWDTARIYPGSEKSIGDLGIADDLVI 61

Query: 70  SPKVSRSDIFFTTKIKTQDQGYESAKKSIEESLNRVKELDYIDLFLIHAP--LTNKEKRL 127
             K +RS   F     T+D  +ES K+S +E      ++D ++++ +HAP  +T  E+  
Sbjct: 62  DTK-ARS---FEEGALTRDGIFESIKQSFDEL-----KVDSVEIYYLHAPDPITPIEE-- 110

Query: 128 GTWKAFQEYYETGKIKAIGVSNYGIQHLEEMYQWDGLK--IDPMVNQYELNPW--LTRKE 183
            T  A  E Y+ GK K  G+SNY    ++++Y++   K  + P V Q   N +     K+
Sbjct: 111 -TIDAINELYKQGKFKKFGLSNYTPDDVKKIYEYAKSKNYVLPTVFQGNYNAFSRSIEKD 169

Query: 184 LSNYCHQKGMVIQAYSPLT 202
           L     + G+   AYSP+ 
Sbjct: 170 LFPVLRKYGISFYAYSPIA 188

>TBLA0G00960 Chr7 complement(244386..245351) [966 bp, 321 aa] {ON} 
          Length = 321

 Score = 51.6 bits (122), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 70/299 (23%), Positives = 123/299 (41%), Gaps = 62/299 (20%)

Query: 29  KEETTNIVHNALKLGYRQVDSAQLYGNEREACLGITKFLEESPKVSRSDIFFTTK----- 83
           K+++  I+  A  LG R  D+A LY N +   + + +FL+E   +SR  +   TK     
Sbjct: 16  KQKSYKILKRAYDLGLRTYDTADLYSNGQSEIIILGEFLKEY-NISRETVVIMTKLFAPV 74

Query: 84  ------------------IKTQDQGYESAKKSIEESLNRVKELD-YIDLFLIHA--PLTN 122
                             I   +Q   S K  IE   N ++ L  YID++ +H   P T 
Sbjct: 75  DDTLPDYQPTGGLHGNQTIHFANQRGLSKKHIIEACKNSLRRLGTYIDVYQVHRADPDTP 134

Query: 123 KEKRLGTWKAFQEYYETGKIKAIGVSNY-GIQHLEEMYQWDGLKIDPMVNQYELNPWLTR 181
            E+   T +A  +  + G  + IG S+  G +  E  +  +       VN  +    L R
Sbjct: 135 MEE---TMRALNDVVQQGLTRYIGASSMLGTKFAEYQFIAEKNGWSKFVNMQDCYNLLYR 191

Query: 182 ---KELSNYCHQKGMVIQAYSPLTR---------------------ARRLQ-----DPEL 212
              +E+  Y  + G+    +SPL R                      +RL      + E+
Sbjct: 192 EEEREMIPYIKKHGIAQTPWSPLQRGLLSRPVEGSSYREDNDRVLKGQRLNQYEDFEIEI 251

Query: 213 VKLVEDSYPEQTS--AQILVNWSLQMGFVPLVKTVHEDRLKENIKSCDFELSSADLKKL 269
           +K VE+   ++ +  A I   W L  G  P++     +R+++ +++ + EL+  +LK L
Sbjct: 252 IKRVEEISKKRNNPMAVISTAWVLSKGTFPILGLNSVERMEDAVRALNIELTEEELKYL 310

>Suva_12.272 Chr12 complement(441543..442262,442266..442340) [795
           bp, 265 aa] {ON} YDL124W (REAL)
          Length = 265

 Score = 49.3 bits (116), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 50/187 (26%), Positives = 90/187 (48%), Gaps = 16/187 (8%)

Query: 31  ETTNIVHNALKLGYRQVDSAQLYGNEREACLGITKFLEESPKVSRSDIFFTTKIKTQDQG 90
           + +N +   LK G + +D+A++Y +  +A   +   L +   +      F+    T+D  
Sbjct: 16  QNSNEIVTVLKAGVKDIDTARIYPDNEKAIGELQ--LPDRFTIHTKASGFSGGCLTRD-- 71

Query: 91  YESAKKSIEESLNRVKELDYIDLFLIHAPLTNKEKRLG-TWKAFQEYYETGKIKAIGVSN 149
             +  KSIEESL+ +  +  ++ FL+H+P  + E  L  T  A    YE GK +  G+SN
Sbjct: 72  --NINKSIEESLSLLG-VPSVETFLLHSP--DPEIPLEETLDAINSLYEQGKFEKFGLSN 126

Query: 150 YGIQHLEEMYQWDGLK--IDPMVNQYELNPWLTR---KELSNYCHQKGMVIQAYSPLTRA 204
           +  + ++ +Y +   K  + P V Q   N  L+R    +L     +  + + AYSP+ R 
Sbjct: 127 FSTEDVKRIYDYAKSKDYVLPTVYQGNYNA-LSRAIVNDLFPLLKELHISLYAYSPIARG 185

Query: 205 RRLQDPE 211
              + PE
Sbjct: 186 FLAETPE 192

>SAKL0E00286g Chr5 complement(13788..14804) [1017 bp, 338 aa] {ON}
           similar to uniprot|Q02895 Saccharomyces cerevisiae
           YPL088W Putative aryl alcohol dehydrogenase
           transcription is activated by paralogous transcription
           factors Yrm1p and Yrr1p along with genes involved in
           multidrug resistance
          Length = 338

 Score = 49.7 bits (117), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 73/304 (24%), Positives = 123/304 (40%), Gaps = 63/304 (20%)

Query: 29  KEETTNIVHNALKLGYRQVDSAQLYGN----------------EREACLGITKF---LEE 69
           KEE   I+ +    G R  D+A +Y N                 RE  + ++K    ++E
Sbjct: 39  KEEIFKILKHCYDNGLRTFDTADVYSNGLSERLLGEFLKRYKINRETVVILSKVRFPVDE 98

Query: 70  SPKVSRSDIFFT---TKIKTQDQGYESAKKSIEESLNRVKELD-YIDLFLIHAPLTNKEK 125
           S ++  S I+ T   T +   +QG  S K  ++     V+ L  YID+  IH    ++  
Sbjct: 99  SLELPLSTIYGTDEVTALTLANQGGLSRKHIMDGVAKSVERLGTYIDVLQIHR-FDHETP 157

Query: 126 RLGTWKAFQEYYETGKIKAIGVSNY------GIQHLEEMYQWDGLKIDPMVNQYELNPWL 179
              T KA  +  E G  + IG S+        +Q + E + W   K     + Y L    
Sbjct: 158 MEETMKALNDVVEKGYTRYIGASSMLATEFAELQFVAEKHSW--FKFISSQSCYNLLYRE 215

Query: 180 TRKELSNYCHQKGMVIQAYSP-----------LTRARRLQDP----------ELVKLVED 218
             +EL  +  +  + +  +SP           LT AR   D           E+++ VE+
Sbjct: 216 DERELIPFAKRHRIGLIPWSPNSRGLLTRPLGLTTARYEADSRLHNIAPDEQEIIRRVEE 275

Query: 219 SYPEQTSAQILVN--WSLQMGFVPLVKTVHEDRLKENIKSCDFELSSADLKKLTHDDQYY 276
              ++ +   +V+  W L  G  P+V     +R+ E +K+ DFE        LT ++  Y
Sbjct: 276 VAKKRDTTMAIVSTAWVLSKGCYPIVGLSSTERVDEALKAIDFE--------LTEEESKY 327

Query: 277 LSQP 280
           L +P
Sbjct: 328 LEEP 331

>NDAI0C01480 Chr3 (312131..313162) [1032 bp, 343 aa] {ON} 
          Length = 343

 Score = 49.3 bits (116), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 73/298 (24%), Positives = 117/298 (39%), Gaps = 62/298 (20%)

Query: 29  KEETTNIVHNALKLGYRQVDSAQLYGNEREACLGITKFLEESPKVSRSDIFFTTKI---- 84
           KE+  +I+ +    G R  D+A +Y N     + I +FL++   + R  +   TKI    
Sbjct: 39  KEKIFSILKHCYDNGLRTFDTADVYSNGLSERI-IGEFLKKY-NIRRETVVILTKIFYPV 96

Query: 85  -KTQD-----------------QGYESAKKSIEESLNRVKELD-YIDLFLIHAPLTNKEK 125
            +T D                 Q   S K  I    N V+ L  YID+  IH  L +   
Sbjct: 97  DETLDLHHGNSTNERNALDLVNQNGLSRKHIITGVKNSVERLGTYIDVLQIHR-LDHDTP 155

Query: 126 RLGTWKAFQEYYETGKIKAIGVSNY------GIQHLEEMYQWDGLKIDPMVNQYELNPWL 179
           +    +A  +    G ++ IG S+        +Q   E   W   K     + Y L    
Sbjct: 156 KEEIMRALNDVIVEGSVRYIGASSMWATEFAELQFTAEKNGW--FKFVSSQSYYNLLNRE 213

Query: 180 TRKELSNYCHQKGMVIQAYSP-----LTR------ARRLQDPELVKLVEDSYPEQ----- 223
             +EL  +C + G+ +  +SP     LTR       R+L DP  +++  D   E      
Sbjct: 214 DERELIPFCKKHGVGLIPWSPNARGVLTRPLEQQTTRKLTDPTFIRMGLDKLSEDQKEIV 273

Query: 224 ------------TSAQILVNWSLQMGFVPLVKTVHEDRLKENIKSCDFELSSADLKKL 269
                       + A + + W+L  G  P+V     +R+ E IK+ D EL+  D+K L
Sbjct: 274 RRVEHLAAKKNISMAMLSIAWTLHKGANPIVGLNSIERVDEAIKAIDVELTEDDIKYL 331

>CAGL0E05192g Chr5 complement(506831..507868) [1038 bp, 345 aa] {ON}
           highly similar to uniprot|Q02895 Saccharomyces
           cerevisiae YPL088w
          Length = 345

 Score = 45.4 bits (106), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 77/297 (25%), Positives = 113/297 (38%), Gaps = 60/297 (20%)

Query: 29  KEETTNIVHNALKLGYRQVDSAQLYGNEREACLGITKFLEE-----SPKVSRSDIFFTT- 82
           KE+   I+ +A   G R  D+A +Y N     L + +F E+        V  + +FF   
Sbjct: 42  KEKIFGILKHAYDRGLRTYDTADVYSNGYSERL-LKEFFEKYQIKRETVVIMTKVFFGVD 100

Query: 83  ---------KIKTQ------DQGYESAKKSIEESLNRVKELD-YIDLFLIHAPLTNKEKR 126
                    KI  Q      +Q   S K  +E   N  + L  YID+  IH  L  +   
Sbjct: 101 EDLNLQPGVKIDEQEDLVLTNQRGLSRKHILEGVKNSTERLGTYIDVLQIHR-LDKETPM 159

Query: 127 LGTWKAFQEYYETGKIKAIGVSNY------GIQHLEEMYQWDGLKIDPMVNQYELNPWLT 180
               KA  +  E G  + IG S+        +Q + E + W   +   + + Y L     
Sbjct: 160 KEIMKALNDVVEAGYARYIGSSSMLATEFAELQFIAEKHNW--FQFVSLQSLYNLLIRED 217

Query: 181 RKELSNYCHQKGMVIQAYSPLTRA-----------RRLQDP-----ELVKLVED------ 218
            +E+  +  +  + +  +SP  R            R   DP     EL KL ED      
Sbjct: 218 EREIIPFAKRHNIALIPWSPNARGLLTRPLNKTTDRIKSDPTFKYLELDKLTEDQKEIIN 277

Query: 219 -----SYPEQTSAQILVN-WSLQMGFVPLVKTVHEDRLKENIKSCDFELSSADLKKL 269
                +    TS  I+ N W L  G  P+V     DR+ E I S DFEL   D+K L
Sbjct: 278 RVEEVAKKHNTSMAIISNSWVLSKGCNPIVGLNSIDRVDEAIASIDFELPEEDIKYL 334

>TBLA0G01120 Chr7 complement(285827..286858) [1032 bp, 343 aa] {ON} 
          Length = 343

 Score = 45.4 bits (106), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 70/297 (23%), Positives = 115/297 (38%), Gaps = 59/297 (19%)

Query: 29  KEETTNIVHNALKLGYRQVDSAQLYGNEREACLGITKFLEESPKVSRSDIFFTTKI---- 84
           K E   I+  A   G R  D+A  Y N +   L + +FL+E  ++ R  +   TK+    
Sbjct: 39  KNEVFKILKTAYDSGLRTFDTADGYSNGQSEIL-LGEFLKEY-EIPRETVIIMTKVWAPV 96

Query: 85  KTQDQGYE-------------------SAKKSIEESLNRVKELD-YIDLFLIHAPLTNKE 124
            +  +G++                   S K  IE   N V+ L  YID++ IH    +  
Sbjct: 97  DSSLEGFQRTGPMNEDQKVHFANQQGLSRKHIIEACKNSVRRLGTYIDVYQIHRADQDTP 156

Query: 125 KRLGTWKAFQEYYETGKIKAIGVSNY-GIQHLEEMYQWDGLKIDPMVNQYELNPWLTR-- 181
               T +A  +  + G  + IG S+  G +  E  +  +       VN  +    L R  
Sbjct: 157 ME-ETMRALNDVVQQGLTRYIGASSMLGTEFAEYQFIAEKNGWSKFVNMQDCYNLLYREE 215

Query: 182 -KELSNYCHQKGMVIQAYSPLTRA---------------------RRLQ-----DPELVK 214
            +E+  Y  + G+    +SPL R                      RRL      + E++ 
Sbjct: 216 EREMIPYIKKHGIAQTPWSPLQRGLLSRPVEVSSYREDNDRVLKGRRLNQYEDFEIEIIN 275

Query: 215 LVEDSYPEQ--TSAQILVNWSLQMGFVPLVKTVHEDRLKENIKSCDFELSSADLKKL 269
            VE    ++  T A++   W L  G  P++      R+KE IK+ D  L+  + K L
Sbjct: 276 RVEQVAVKKGITMAEVATAWLLSKGTFPILGLNSVQRVKEAIKALDVTLTEEECKYL 332

>Suva_9.17 Chr9 (18179..19105) [927 bp, 308 aa] {ON} YNL331C (REAL)
          Length = 308

 Score = 45.1 bits (105), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 48/179 (26%), Positives = 82/179 (45%), Gaps = 16/179 (8%)

Query: 41  KLGYRQVDSAQLYGNEREACLGITKFLEESPKVSRSDIFFTTKIKTQDQGYESAKKSIEE 100
           K G + +D+A++Y  + E  +G  + L     +      F+    T+D    +  KSIEE
Sbjct: 31  KAGVKDIDTARIY-PDSEKIIGELQ-LPNRFTIHTKASGFSGGCLTKD----NINKSIEE 84

Query: 101 SLNRVKELDYIDLFLIHAP--LTNKEKRLGTWKAFQEYYETGKIKAIGVSNYGIQHLEEM 158
           SL+ +  +  ++ F +H+P   T  E+ LG   A    YE GK K  G+SN+  + ++ +
Sbjct: 85  SLSLLG-VPSVETFFLHSPDPETPIEETLG---AINSLYEQGKFKKFGLSNFATEDVKRI 140

Query: 159 YQWDGLK--IDPMVNQYELNPW--LTRKELSNYCHQKGMVIQAYSPLTRARRLQDPELV 213
           Y++   K  + P V Q   N +      +L     +      AYSP+      + PE V
Sbjct: 141 YEYAKSKNFVLPTVYQGSYNAFSRAIENDLFPLLRELHFSFYAYSPIAGGFLAKTPEQV 199

>Smik_3.208 Chr3 (305264..306298) [1035 bp, 344 aa] {ON} YPL088W
           (REAL)
          Length = 344

 Score = 45.1 bits (105), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 68/301 (22%), Positives = 113/301 (37%), Gaps = 68/301 (22%)

Query: 29  KEETTNIVHNALKLGYRQVDSAQLYGN----------------EREACLGITKF------ 66
           KE+   I+ +    G R  D+A +Y N                +RE  + +TK       
Sbjct: 41  KEKIFEILKHCYDSGMRTFDTADVYSNGLSERILGEFLKHYKIKRETVVILTKVYYPVDE 100

Query: 67  ---LEESPKVSRSDIFFTTKIKTQDQGYESAKKSIEESLNRVKELD-YIDLFLIHAPLTN 122
              L  S K+S SD+         +Q   S K  +E + N V+ L  YID+  IH  L +
Sbjct: 101 SLKLTHSAKISESDMLGLV-----NQTGLSRKHILEAAKNSVERLGTYIDVLQIHR-LDH 154

Query: 123 KEKRLGTWKAFQEYYETGKIKAIGVSNY------GIQHLEEMYQWDGLKIDPMVNQYELN 176
                   KA  +    G  + IG S+        +Q + E + W   K     + Y L 
Sbjct: 155 DTPMEEIMKALNDVVGLGYTRYIGASSMLATEFAELQFIAEKHDWT--KFICSQSCYSLL 212

Query: 177 PWLTRKELSNYCHQKGMVIQAYSPLTRA-----------RRLQDPELVKLVEDSYPEQ-- 223
                +EL  +  + G+ +  +SP  R            R++ DP L +L  D       
Sbjct: 213 YREDERELIPFAKKHGIGLIPWSPNARGVLTRPLNQETDRKISDPTLKRLKFDCLESHEK 272

Query: 224 ---------------TSAQILVNWSLQMGFVPLVKTVHEDRLKENIKSCDFELSSADLKK 268
                          + A + + W L  G  P+V     +R+ E I++ D +L+  +++ 
Sbjct: 273 RIVNRVEEVAKKKGISMAMVSIAWVLSKGACPIVGLNSIERVDEAIRAVDVQLTEEEIQY 332

Query: 269 L 269
           L
Sbjct: 333 L 333

>NCAS0J01740 Chr10 complement(321825..322862) [1038 bp, 345 aa] {ON}
           
          Length = 345

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 66/321 (20%), Positives = 126/321 (39%), Gaps = 60/321 (18%)

Query: 6   GTTHALKNGVKMPCLGLG------LYQTPKEETTNIVHNALKLGYRQVDSAQLYGN---- 55
           G+T    + + + C+  G        +  KE+   ++ +   +G R  D+A +Y N    
Sbjct: 11  GSTGMKVSPIIVGCMSYGSKSWQPWVEDNKEKVFALLKHCYDVGLRTFDTADVYNNGQSE 70

Query: 56  ------------EREACLGITKFL---EESPKVSR--SDIFFTTKIKTQDQGYESAKKSI 98
                        RE  + +TK     ++S +V    + I  +TK+   +Q   S K  I
Sbjct: 71  VLLGEFLKKYNIRRETVVILTKIYFDSDDSMEVGSNFASINESTKLDLVNQRGLSRKHII 130

Query: 99  EESLNRVKELD-YIDLFLIHAPLTNKEKRLGTWKAFQEYYETGKIKAIGVSNY------G 151
           +   N V+ L  YID+  IH  L +        K+  +   +G ++ IG S+        
Sbjct: 131 QGVKNSVRRLGTYIDVLQIHR-LDDNVPMKSIMKSLNDVVLSGDVRYIGASSMLATEFAD 189

Query: 152 IQHLEEMYQWDGLKIDPMVNQYELNPWLTRKELSNYCHQKGMVIQAYSP----------- 200
           +Q + + + W   +     +QY L      +E+  Y  +  + +  +SP           
Sbjct: 190 LQAIADKHDW--FQFVNWQSQYNLLYREDEREVIPYAKRHNIAVTPWSPNARGLLAKPAN 247

Query: 201 LTRARRLQDPELVKLVEDSY------------PEQTSAQILVNWSLQMGFVPLVKTVHED 248
           +T  R+  DP L  + +D               + + A +   W L   F+P+V     +
Sbjct: 248 VTSERKNFDPRLASISDDDKEIIGRVEKIAKDKDISMAMVSTAWVLSKRFLPIVGMSKME 307

Query: 249 RLKENIKSCDFELSSADLKKL 269
           R+ E +K+    L+  ++K L
Sbjct: 308 RIDEAVKAIKVTLTQEEIKYL 328

>CAGL0E05214g Chr5 complement(508275..509315) [1041 bp, 346 aa] {ON}
           highly similar to uniprot|Q02895 Saccharomyces
           cerevisiae YPL088w
          Length = 346

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 73/306 (23%), Positives = 115/306 (37%), Gaps = 81/306 (26%)

Query: 29  KEETTNIVHNALKLGYRQVDSAQLYGNEREACLGITKFLEESPKVSRSDIFFTTKIKTQD 88
           KE+   I+ +A   G R  D+A +Y N     L + +F E+  ++ R  +   TK+    
Sbjct: 42  KEKIFGILKHAYDRGLRTYDTADVYSNGYSERL-LKEFFEKY-QIKRETVVIMTKVFF-- 97

Query: 89  QGYESAKKSIEESLNRVKEL----DYIDLFL----------IHAPLTNKEKRLGTW---- 130
                    ++E LN    L    D+ DL L          I   + N  +RLGT+    
Sbjct: 98  --------GVDEDLNLHHGLKAYNDHDDLILTNQRGLSRKHILEGVKNSTERLGTYIDVL 149

Query: 131 ---------------KAFQEYYETGKIKAIGVSNY------GIQHLEEMYQWDGLKIDPM 169
                          KA  +  E G  + IG S+        +Q + E + W   +   +
Sbjct: 150 QIHRLDKETPMKEIMKALNDVVEAGYARYIGSSSMLATEFAELQFIAEKHNW--FQFVSL 207

Query: 170 VNQYELNPWLTRKELSNYCHQKGMVIQAYSPLTRA-----------RRLQDP-------- 210
            + Y L      +E+  +  +  + +  +SP  R            R   DP        
Sbjct: 208 QSFYNLLNREDEREIIPFAKRHNIALIPWSPNARGLLTRPLNKTTDRIKSDPTFKYLDLD 267

Query: 211 -------ELVKLVED-SYPEQTSAQILVN-WSLQMGFVPLVKTVHEDRLKENIKSCDFEL 261
                  E++  VE+ +    TS  I+ N W L  G  P+V     DR+ E I S DFEL
Sbjct: 268 NLTEDQKEIINRVEEVAKKHNTSMAIISNSWVLSKGCNPIVGLNSIDRVDEAIASIDFEL 327

Query: 262 SSADLK 267
           S  D+K
Sbjct: 328 SDEDIK 333

>KLTH0A08052g Chr1 complement(685177..686193) [1017 bp, 338 aa] {ON}
           highly similar to uniprot|Q02895 Saccharomyces
           cerevisiae YPL088W Putative aryl alcohol dehydrogenase
           transcription is activated by paralogous transcription
           factors Yrm1p and Yrr1p along with genes involved in
           multidrug resistance
          Length = 338

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 73/312 (23%), Positives = 119/312 (38%), Gaps = 64/312 (20%)

Query: 29  KEETTNIVHNALKLGYRQVDSAQLYGN----------------EREACLGITKF---LEE 69
           KEE   I+      G R  D+A +Y N                 RE  + ++K    ++E
Sbjct: 39  KEEIFKILKYCYDNGLRTFDTADIYSNGLSERLIGEFLRNYNINRETVVILSKVNFPVDE 98

Query: 70  SPKVSRSDIFFT---TKIKTQDQGYESAKKSIEESLNRVKELD-YIDLFLIHAPLTNKEK 125
           S  +S   IF     T +   +Q   S K  I+     V+ L  YID+  IH    ++  
Sbjct: 99  SLDLSVKSIFNVDEVTALTLTNQRGLSRKHIIDGVAKSVERLGTYIDVLQIHR-FDSETT 157

Query: 126 RLGTWKAFQEYYETGKIKAIGVSNY------GIQHLEEMYQWDGLKIDPMVNQYELNPWL 179
              T +A  +  E+G  + IG S+        +Q   E   W   K     +QY L    
Sbjct: 158 MEETMRALNDVVESGHARYIGASSMLATEFSDLQFTVERNGW--FKFISSQSQYNLLYRE 215

Query: 180 TRKELSNYCHQKGMVIQAYSPLTRA-----------RRLQDP----------ELVKLVED 218
             +EL  Y  + G+ +  +SP  R            R   DP          E++  VE+
Sbjct: 216 DERELIPYAKRHGIGLIPWSPNARGLLTRPVGVATERSSSDPRFQKLTNAGMEIINRVEE 275

Query: 219 SYPEQTSAQILVN--WSLQMGFVPLVKTVHEDRLKENIKSCDFELSSADLKKLTHDDQYY 276
               +  + ++ +  W L  G  P+V      R+ E +++  F        KLT ++  Y
Sbjct: 276 VANRRNVSMVVASNAWVLHKGCHPIVGMSSTARVDEAVQALTF--------KLTDEEVKY 327

Query: 277 LSQPKWDPIKYE 288
           + +P + P  YE
Sbjct: 328 IEEP-YRPKSYE 338

>SAKL0C14058g Chr3 (1248968..1249915) [948 bp, 315 aa] {ON}
           conserved hypothetical protein
          Length = 315

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 50/193 (25%), Positives = 90/193 (46%), Gaps = 19/193 (9%)

Query: 28  PKEETTNIVHNALKLGYRQVDSAQLYGNEREACLGITKFLEESPKVSRSDIFFTTKIKTQ 87
           PK++ + ++H   K   + +D+A++Y +  ++   +   L     +    + F     ++
Sbjct: 19  PKDQLSEVLHVLEKYNVKDLDTARVYPDGEKSIGKLN--LPAKYTIHTKAVTFQDGALSK 76

Query: 88  DQGYESAKKSIEESLNRVKELDYIDLFLIHAP--LTNKEKRLGTWKAFQEYYETGKIKAI 145
           D    S  +SI ESL+ +K  D ++ F +H P   T  E+   T KA  E Y+ GK    
Sbjct: 77  D----SIVESIGESLSLLKT-DKVETFYLHCPDPTTPIEE---TLKAINELYKEGKFVHF 128

Query: 146 GVSNYGIQHLEEMYQWDGLK--IDPMVNQYELNPWLTR--KELSNYCHQKGMVIQAYSPL 201
           G+SNY    + ++Y++   K  + P V Q   N    +  K+L     +  +   AYSP+
Sbjct: 129 GLSNYPANDVRKIYEYADSKGYVLPTVYQGNYNAVSRKIEKDLFPVLRELKIAFYAYSPI 188

Query: 202 TR---ARRLQDPE 211
                AR +Q+ E
Sbjct: 189 AGGFLARTVQEIE 201

>Kwal_47.16887 s47 complement(158953..159894) [942 bp, 313 aa] {ON}
           YDL124W - Hypothetical ORF [contig 219] FULL
          Length = 313

 Score = 43.1 bits (100), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 52/216 (24%), Positives = 95/216 (43%), Gaps = 30/216 (13%)

Query: 11  LKNGVKMPCLGLGLYQTPKEETTNIVHNALKLGYRQVDSAQLYGNEREACLGITKFLEES 70
           +    K+ C    L    K++    +    + G  ++D+A++Y    EA LG  +  E  
Sbjct: 1   MPGNAKLVCGAFPLATLSKDDAHKYLDVLKEHGVDELDTARIYEGSEEA-LGELRAPE-- 57

Query: 71  PKVSRSDIFFTTKIKTQDQGY-------ESAKKSIEESLNRVKELDYIDLFLIHAP--LT 121
                     T  I T+ +G+       +S  +SI+ES  R+ +++ +++F +H+P   T
Sbjct: 58  ----------TFVIDTKARGFAEGSLTRDSINQSIDESF-RLLKVESVNIFYLHSPDPAT 106

Query: 122 NKEKRLGTWKAFQEYYETGKIKAIGVSNYGIQHLEEMYQWDGLK--IDPMVNQYELNPWL 179
             E+ L T  +    Y  GK K  G+SNY  + + ++Y +   K  + P V Q   N + 
Sbjct: 107 LLEETLDTINSL---YVKGKFKKFGLSNYKPEDVRKVYSYCKEKGYVLPTVYQGNYNAFA 163

Query: 180 TRKE--LSNYCHQKGMVIQAYSPLTRARRLQDPELV 213
            + E  L     +  +   AYSP+      + PE +
Sbjct: 164 RKAESTLFPVLRELEIAFYAYSPIAGGFLAKTPEQI 199

>KNAG0L01270 Chr12 (230125..231156) [1032 bp, 343 aa] {ON} 
          Length = 343

 Score = 43.1 bits (100), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 53/224 (23%), Positives = 94/224 (41%), Gaps = 50/224 (22%)

Query: 97  SIEESLNRVKELDYIDLFLIHA---PLTNKEKRLGTWKAFQEYYETGKIKAIGVSN---- 149
           S+++S+ R+    YID+  IH      T KE      KA  +  E+ K++ IG S     
Sbjct: 133 SVDKSIERLG--TYIDVLQIHRLDHECTGKE----IMKALNDVVESNKVRYIGASTMLAT 186

Query: 150 --YGIQHLEEMYQWDGLKIDPMVNQYELNPWLTRKELSNYCHQKGMVIQAYSP------- 200
               +Q + + Y W   +      +Y L      +EL +Y  +  + +  +SP       
Sbjct: 187 EFVELQMIADKYDW--FQFVSSQTEYSLLFREDERELLSYTKRNNLAVLPWSPNARGLLC 244

Query: 201 ----------LTRARRL-----QDPELVKLVEDSYPEQTSAQILVN--WSLQMGFVPLVK 243
                      T +R L      D  +VK VE+   ++  +  +++  W +  G+ P++ 
Sbjct: 245 RPLGTKTERSTTESRMLLNMSESDKLIVKRVEELAKKKNVSMAMISEAWVMSKGYQPIIG 304

Query: 244 TVHEDRLKENIKSCDFELSSADLKKLTHDDQYYLSQPKWDPIKY 287
               +R+KE I++   E        LT D+  YL +P + P KY
Sbjct: 305 FSSVERVKEAIEATKIE--------LTDDEIKYLEEP-YQPKKY 339

>NCAS0C01990 Chr3 (365857..366888) [1032 bp, 343 aa] {ON} Anc_8.565
          Length = 343

 Score = 42.7 bits (99), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 67/297 (22%), Positives = 117/297 (39%), Gaps = 59/297 (19%)

Query: 29  KEETTNIVHNALKLGYRQVDSAQLYGN---EREACLGITKF-LEESPKVSRSDIFF---- 80
           K+E   I+ +    G R  D+A +Y N   ER     + K+ ++    V  + IFF    
Sbjct: 39  KDEIFKILKHCYDRGLRTFDTADVYSNGISERLVGEFLKKYNIKRETVVIMTKIFFPVDE 98

Query: 81  -------------TTKIKTQDQGYESAKKSIEESLNRVKELD-YIDLFLIHAPLTNKEKR 126
                          +++   Q   S K  I+   N V+ L  YID+  IH  L  +   
Sbjct: 99  SLDLHHGSNVNQEAMELQLTLQRGLSRKHIIDGVANSVERLGTYIDVLQIHR-LDEETSM 157

Query: 127 LGTWKAFQEYYETGKIKAIGVSNY------GIQHLEEMYQWDGLKIDPMVNQYELNPWLT 180
               ++  +   +G+++ IG S+        +Q + E   W   K     + Y L     
Sbjct: 158 EEIMRSLNDVVMSGQVRYIGASSMLATEFAELQFIAEKNGW--FKFISAQSYYNLINRED 215

Query: 181 RKELSNYCHQKGMVIQAYSPLTRA-----------RRLQDP---------------ELVK 214
            +EL  +C + G+ +  +SP  R            R L DP               E+V+
Sbjct: 216 ERELIPFCKKHGVGLIPWSPNARGVLTRPVEKNTERMLTDPTFNRMRLNELGDDEKEIVR 275

Query: 215 LVEDSYPEQ--TSAQILVNWSLQMGFVPLVKTVHEDRLKENIKSCDFELSSADLKKL 269
            ++     +  T A I + W+L  G  P+V     +R+ E +K+ +F L+  ++K L
Sbjct: 276 RIQMVAERRSVTMAIISMAWTLHKGCNPIVGLNSVERVDEAVKAIEFTLTEDEIKLL 332

>ABR094W Chr2 (555932..557011) [1080 bp, 359 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR041C
          Length = 359

 Score = 42.4 bits (98), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 39/143 (27%), Positives = 65/143 (45%), Gaps = 18/143 (12%)

Query: 25  YQTPKEETTNIVHNALKLGYRQVDSAQLYGNEREA-CLGITKFLEESPKVSRSDIFFTTK 83
           Y+ P   T  +V  AL+ G   +D++  YG   E     +    +E P   R   F  TK
Sbjct: 52  YEVP---TLGLVRRALEAGICAIDTSPYYGKSEEIYGEALAAVRDEHP---RETYFICTK 105

Query: 84  IKTQ---DQGYESA--KKSIEESLNRVKELDYIDLFLIHAPLTNKEKRLGTWKAFQEYY- 137
           +  +   D  Y +A  + S+  S  R+   +Y+DL  +H       +  G W+A QE   
Sbjct: 106 VGREGPSDFDYSAAHVRASVHRSCARLHT-EYLDLVYLHD--IEFVEAAGIWEALQELRR 162

Query: 138 --ETGKIKAIGVSNYGIQHLEEM 158
             + G I+  G+S Y ++ L+E+
Sbjct: 163 LKDEGVIRFFGISGYPVELLQEV 185

>NCAS0F04070 Chr6 complement(811712..812746) [1035 bp, 344 aa] {ON} 
          Length = 344

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 67/300 (22%), Positives = 121/300 (40%), Gaps = 59/300 (19%)

Query: 26  QTPKEETTNIVHNALKLGYRQVDSAQLYGN----------------EREACLGITKF--- 66
           Q  KE+   I+ +    G R  D+A +Y N                +RE  + +TK    
Sbjct: 37  QDDKEKVFEILKHCYDRGLRTFDTADVYSNGISERLLGEFLKKFNIKRETVVILTKTFFP 96

Query: 67  LEESPKVSRSDIFFTTK--IKTQDQGYESAKKSIEESLNRVKEL-DYIDLFLIHA--PLT 121
           ++ES  ++  ++ F+    +   +Q   S K  ++   N V+ L  YID+  IH   P T
Sbjct: 97  VDESLSLALGEMSFSESDTLDLTNQRGLSRKHILQSVKNSVERLGTYIDVLQIHRFDPTT 156

Query: 122 NKEKRLGTWKAFQEYYETGKIKAIGVSNYGIQHLEEMY----QWDGLKIDPMVNQYELNP 177
             ++   T KA  +  E+G ++ IG S+       EM     + D  +   + + Y L  
Sbjct: 157 PIKE---TMKALNDVVESGDVRYIGASSMLPTQFVEMQSVADKHDWFQFVNVQSCYNLLY 213

Query: 178 WLTRKELSNYCHQKGMVIQAYSP-----LTRA------RRLQDP---------------E 211
               ++L  YC +  + +  +SP     LTR       R   D                E
Sbjct: 214 REDERDLMQYCEKHNIALTPWSPNHQGLLTRPIGVESERSTTDKIINGWNMKDLKPSEIE 273

Query: 212 LVKLVEDSYPEQTSAQILVN--WSLQMGFVPLVKTVHEDRLKENIKSCDFELSSADLKKL 269
           ++  VE+   ++  +  +++  W L  G  P+V      R+ E I + D + +  + K+L
Sbjct: 274 IINRVEELSKKKNVSMAVISTAWVLSKGCAPIVGMSSISRVDEVITALDVKFTEEETKQL 333

>SAKL0E00264g Chr5 complement(12234..13181) [948 bp, 315 aa] {ON}
           conserved hypothetical protein
          Length = 315

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 51/199 (25%), Positives = 92/199 (46%), Gaps = 22/199 (11%)

Query: 13  NGVKMPCLGLGLYQTPKEETTNIVHNALKLGYRQVDSAQLY-GNEREACLGITKFLEESP 71
           N VK+      +   PK++  +++    K   + +D+A++Y G+E+   +G         
Sbjct: 4   NHVKIIYGAFPITHLPKDQLEDVLQLLEKYNVKDLDTARIYPGSEK--SIG-------EL 54

Query: 72  KVSRSDIFFTTKIKTQDQGY--ESAKKSIEESLNRVKELDYIDLFLIHAP--LTNKEKRL 127
            +S S    T  +  Q++    ES  +SI ESL+ +K  + ++ F +H P   T  E+  
Sbjct: 55  NLSASYTIHTKAVAFQERSLSKESIVESIGESLSLLK-TEKVETFYLHCPDPATPIEE-- 111

Query: 128 GTWKAFQEYYETGKIKAIGVSNYGIQHLEEMYQWDGLK--IDPMVNQYELNPWLTR--KE 183
            T +A  E Y+ GK    G+SNY    + ++Y++   K  + P V Q   N    +  K+
Sbjct: 112 -TLEAINELYKDGKFVHFGLSNYPASDVRKIYEYAASKGYVLPTVYQGNYNAVSRKIEKD 170

Query: 184 LSNYCHQKGMVIQAYSPLT 202
           L     +  +   AYSP+ 
Sbjct: 171 LFPVLRELKITFYAYSPIA 189

>NCAS0C02450 Chr3 complement(455582..456613) [1032 bp, 343 aa] {ON} 
          Length = 343

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 68/298 (22%), Positives = 118/298 (39%), Gaps = 61/298 (20%)

Query: 29  KEETTNIVHNALKLGYRQVDSAQLYGN-EREACLG--ITKF-LEESPKVSRSDIFFTT-- 82
           KEE   I+ +    G R  D+A +Y N   E  LG  + +F ++    V  S IFF    
Sbjct: 39  KEEIFKILKHCYDNGLRTFDTADVYSNGTSERILGEFLKRFNIKRETVVIMSKIFFPVDE 98

Query: 83  -----KIKTQDQGYESAKKSIEESLNR----------VKELD-YIDLFLIHAPLTNKEKR 126
                +    DQ Y   + S ++ LNR          V+ L  YID+  IH    +KE  
Sbjct: 99  SLDLHQGSKVDQEYIDLQLSFQQGLNRKHIMAGVANSVERLGTYIDILQIHR--LDKEAS 156

Query: 127 L-GTWKAFQEYYETGKIKAIGVSNY------GIQHLEEMYQWDGLKIDPMVNQYELNPWL 179
           +    ++  +   +G+++ IG S+        +Q + +   W   +   + + Y +    
Sbjct: 157 MEEIMRSLNDVVVSGQVRYIGASSMLATEFAELQFIAKQNGW--FQFINVQSYYNVLNRE 214

Query: 180 TRKELSNYCHQKGMVIQAYSP-----LTR------ARRLQDPELVKLVEDSYPEQ----- 223
              EL  +C + G+ +  +SP     LTR       R L DP  +K+  D   E      
Sbjct: 215 DENELIPFCKKHGVGLTVWSPNARGVLTRPADKTGTRMLSDPTFIKMGLDKLDESDKEII 274

Query: 224 ------------TSAQILVNWSLQMGFVPLVKTVHEDRLKENIKSCDFELSSADLKKL 269
                       + A + + W L  G   +      +R+ E I++ D + +  +L+ L
Sbjct: 275 GVVEAIAKKKGISMAMVSMAWILNKGANAIAGLNSIERVDEAIRAIDVKFTVEELELL 332

>TPHA0H00110 Chr8 (10204..11241) [1038 bp, 345 aa] {ON} 
          Length = 345

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 55/224 (24%), Positives = 93/224 (41%), Gaps = 46/224 (20%)

Query: 92  ESAKKSIEESLNRVKELDYIDLFLIHAPLTNKEKRLG-TWKAFQEYYETGKIKAIGVSNY 150
           ESAK+S+E      +   Y+D+  IH    ++E     T +A  +    G  K IG S  
Sbjct: 131 ESAKQSVE------RLGTYMDVLQIHR--CDRETPFEETMRALNDVVNAGYTKYIGASLM 182

Query: 151 GIQHLEEMYQWDGLKID--PMVNQYELNPWLTR---KELSNYCHQKGMVIQAYSPLTRA- 204
                 EM Q+   K D    VN   L+  + R   +EL  +  + G+ +  YSPL +  
Sbjct: 183 RATEFAEM-QFIAEKHDWHKFVNVQSLHNLIYREDERELIPFTKKHGIALTPYSPLQKGY 241

Query: 205 -------------------------RRLQDPELVKLVEDSYPEQ--TSAQILVNWSLQMG 237
                                     R  D E++  VE    ++  + A++ + W +Q G
Sbjct: 242 LAKPYGTKTVRNTTDKHMLRIKIDNMRDSDKEIISRVEKVSKDKKVSMAEVSLAWLIQQG 301

Query: 238 FVPLVKTVHEDRLKENIKSCDFELSSADLKKLTHDDQYYLSQPK 281
             P+V     +R+ E I++ D +L+  + K L   ++ Y  QP+
Sbjct: 302 CNPIVGVSSTERVDEAIRALDVKLTEEETKFL---EEPYQPQPQ 342

>KLLA0F19360g Chr6 (1792778..1793812) [1035 bp, 344 aa] {ON} highly
           similar to uniprot|Q02895 Saccharomyces cerevisiae
           YPL088W Putative aryl alcohol dehydrogenase
           transcription is activated by paralogous transcription
           factors Yrm1p and Yrr1p along with genes involved in
           multidrug resistance
          Length = 344

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 72/296 (24%), Positives = 115/296 (38%), Gaps = 65/296 (21%)

Query: 43  GYRQVDSAQLYGN----------------EREACLGITKF---LEESPKVSRSDIFFTTK 83
           G R  D+A  Y N                 RE  + +TK    ++E  ++S S+ F    
Sbjct: 53  GLRTFDTADFYSNGLSEKLVGEFLKKYNIRRETVVILTKVYFPVDEDLELSHSNGFTEND 112

Query: 84  IK--TQDQGYESAKKSIEESLNRVKELDY-IDLFLIHAPLTNKEKRLGTWKAFQEYYETG 140
           +   T  QG  S K  +       K LD  ID+  IH  L  +       ++     E+G
Sbjct: 113 LLDLTNQQGL-SRKHILAGVTASCKRLDTCIDVLQIHR-LDRETPMEEIMRSLNHVVESG 170

Query: 141 KIKAIGVSNY------GIQHLEEMYQWDGLKIDPMVNQYELNPWLTRKELSNYCHQKGMV 194
           +++ IG S         +Q + E Y W   K     + Y L      +EL  Y  + G+ 
Sbjct: 171 QVRYIGASTMLATEFVELQSIAERYGWH--KFISSQSCYNLLYREDERELIPYLKRHGVG 228

Query: 195 IQAYSPLTRA-----------------------RRL-----QDPELVKLVEDSYPEQTSA 226
           +  +SP  R                        R+L     Q+ E+V  VED   +   +
Sbjct: 229 MIPWSPNARGILCRPVSQQSNSKRYETDGRIKGRQLDQLQPQETEIVNRVEDLAKKHGVS 288

Query: 227 QILVN--WSLQMGFVPLVKTVHEDRLKENIKSCDFELSSADLKKLTHDDQYYLSQP 280
             +V+  W L  G  P+V     DR+KE I + + +LS  +++ L   +Q YL +P
Sbjct: 289 MAVVSSAWVLAKGGYPIVGLSSIDRVKEIISATELKLSEEEIQYL---EQPYLPKP 341

>Kpol_400.9 s400 complement(19154..20179) [1026 bp, 341 aa] {ON}
           complement(19154..20179) [1026 nt, 342 aa]
          Length = 341

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 79/339 (23%), Positives = 129/339 (38%), Gaps = 79/339 (23%)

Query: 6   GTTHALKNGVKMPCLGLG------LYQTPKEETTNIVHNALKLGYRQVDSAQLYGN-ERE 58
           G T    + + + C+  G        +  +E+   I+  A   G R  D+A +Y N E E
Sbjct: 10  GNTGLKVSPIIIGCMSFGSKKWSEWVEDDREKIFKILKYAYDKGLRTYDTANVYSNGESE 69

Query: 59  ACLGITKFLEESPKVSRSDIFFTTKI--KTQDQG-YE------------------SAKKS 97
             LG  +FL+   K+ R  +   TK+   T D   Y+                  S K  
Sbjct: 70  IILG--EFLKNY-KIPRETVIIMTKLYFPTNDNADYDIFSMTPEAILNNVNITGLSRKNI 126

Query: 98  IEESLNRVKELD-YIDLFLIHA--PLTNKEKRLGTWKAFQEYYETGKIKAIGVSNYGIQH 154
           I  + + V+ L  Y D+  IH   P T  E+   T +A  +    G  + IG S+     
Sbjct: 127 INSARDSVRRLGTYADIIQIHRADPDTPFEE---TMRALNDIVVDGLTRYIGASSMLATE 183

Query: 155 LEEMYQWDGLKID--PMVNQYELNPWLTR---KELSNYCHQKGMVIQAYSPLTR------ 203
             EM Q+   K D    +N       L R   +EL  +  +  + +  +SPL R      
Sbjct: 184 FVEM-QFIAEKNDWFKFINSQSCYNLLYREDERELIPFAKRHNIALTPWSPLQRGVLCRP 242

Query: 204 ----ARRLQ----------------DPELVKLVEDSYPEQTS--AQILVNWSLQMGFVPL 241
               + R +                D E++  VE+   ++ +  A + + W +Q G  P+
Sbjct: 243 VGETSTRFEKDQFMSIGNIKDINSSDEEIITRVEEIAKKRNTKMATVALYWVIQKGCFPI 302

Query: 242 VKTVHEDRLKENIKSCDFELSSADLKKLTHDDQYYLSQP 280
           V     DR+ E I + +          LT D+  YL +P
Sbjct: 303 VGMSKIDRIDEAIAALEI--------NLTKDEMTYLEEP 333

>KAFR0F03890 Chr6 complement(761303..762262) [960 bp, 319 aa] {ON} 
          Length = 319

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 68/306 (22%), Positives = 117/306 (38%), Gaps = 78/306 (25%)

Query: 29  KEETTNIVHNALKLGYRQVDSAQLYGNEREACLGITKFLEESPKVSRSDIFFTTKI---- 84
           KE+  N +      G R  D+A  Y N     L + +FL++  K+ R  +   TKI    
Sbjct: 16  KEKVFNTLKYCYDKGLRTFDTADYYSNGYSEIL-LGEFLKKY-KIKRETVVILTKIFFPV 73

Query: 85  -KTQDQ--GYES--------------AKKSIEESLNRVKEL--DYIDLFLIH-----APL 120
            +T D   G E               ++K I + + R  E    YID+  IH      P+
Sbjct: 74  DETLDLHLGEEPIGVDQLDVVNQRGLSRKHIVDGVKRSVERLGTYIDVLQIHRFDQDTPI 133

Query: 121 TNKEKRLGTWKAFQEYYETGKIKAIGVSNY------GIQHLEEMYQWDGLKIDPMVNQYE 174
             +       KA  +  E G ++ IG S+        +Q + E Y+W        VN   
Sbjct: 134 KER------MKALNDVVEKGHVRYIGASSMLATEFAEMQFVAEKYEWFQF-----VNSQS 182

Query: 175 LNPWLTR---KELSNYCHQKGMVIQAYSP--------------------------LTRAR 205
           L   + R   +EL  +C +  + +  +SP                          LT+  
Sbjct: 183 LYNLIYREDERELIPFCKRHNIALTPWSPNHQGLLTRPIGSTTERSENDPFVKCTLTKKL 242

Query: 206 RLQDPELVKLVEDSYPEQTSAQILVN--WSLQMGFVPLVKTVHEDRLKENIKSCDFELSS 263
              D E++  VE+   ++  +  +++  W +  G VP+V      R+ + IK+   + + 
Sbjct: 243 EKSDIEIINRVEELAKKKKCSMAVISTAWVISKGCVPIVGMSKTSRVDDAIKALKVKFTD 302

Query: 264 ADLKKL 269
            +LK L
Sbjct: 303 EELKYL 308

>CAGL0E05236g Chr5 complement(509715..510749) [1035 bp, 344 aa] {ON}
           highly similar to uniprot|Q02895 Saccharomyces
           cerevisiae YPL088w
          Length = 344

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 74/297 (24%), Positives = 114/297 (38%), Gaps = 60/297 (20%)

Query: 29  KEETTNIVHNALKLGYRQVDSAQLYGN----------------EREACLGITKF---LEE 69
           KE+   I+  A   G R  D+A +Y N                +RE  + ++K    ++E
Sbjct: 41  KEKIFGILKRAYDRGLRTYDTADMYSNGYSERLLKEFFEKYQIKRETVVIMSKVFYAVDE 100

Query: 70  SPKVSRS-DIFFTTKIKTQDQGYESAKKSIEESLNRVKELD-YIDLFLIHAPLTNKEKRL 127
              +    DI     +   +Q   S +  +E   N  + L  YID+  IH    +KE  +
Sbjct: 101 DLDLHHGLDINEVEDLHLTNQRGLSRRHILEAVKNSTERLGTYIDVLQIHR--LDKETPM 158

Query: 128 G-TWKAFQEYYETGKIKAIGVSNY------GIQHLEEMYQWDGLKIDPMVNQYELNPWLT 180
               KA  +  E G  + IG S+        +Q + E + W   +   + + Y L     
Sbjct: 159 KEIMKALNDVVEAGYARYIGSSSMLATEFAELQFIAEKHNW--FQFVSLQSFYNLLNRED 216

Query: 181 RKELSNYCHQKGMVIQAYSP-----LTR------ARRLQDPE-----LVKLVED------ 218
            +E+  +  +  + +  +SP     LTR       R   DP      L KL ED      
Sbjct: 217 EREIIPFAKRHNIALTPWSPNARGLLTRPVSKISVRIKSDPTFKIVGLDKLTEDQKEIIN 276

Query: 219 -----SYPEQTSAQILVN-WSLQMGFVPLVKTVHEDRLKENIKSCDFELSSADLKKL 269
                +    TS  I+ N W L  G  P+V      R+ E I S DFEL   D+K L
Sbjct: 277 RVEEVAKKHNTSMAIISNSWVLSKGCNPIVGLNSIARVDEAIASIDFELPEEDIKYL 333

>NDAI0H02960 Chr8 (721089..722123) [1035 bp, 344 aa] {ON} 
          Length = 344

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 71/312 (22%), Positives = 117/312 (37%), Gaps = 75/312 (24%)

Query: 29  KEETTNIVHNALKLGYRQVDSAQLYGNER-EACLGITKFLEESPKVSRSDIFFTTK---- 83
           KE+   I+ +   +G+R  D+A +Y N + E  LG  +FL +   + R  +   TK    
Sbjct: 40  KEKVFQILKHCYDIGFRTFDTADVYSNGKSERLLG--EFLRKF-NIRRETVVILTKTNFP 96

Query: 84  -------------------IKTQDQGYESAKKSIEESLNRVKELD-YIDLFLIHAPLTNK 123
                              +   +Q   S K  ++   N V+ L  YID+  IH    N 
Sbjct: 97  VDETLVLPIGDANRSENDTLDLVNQQGLSRKHILQSVKNSVERLGTYIDVLQIHRFDPNT 156

Query: 124 EKRLGTWKAFQEYYETGKIKAIGVSNYGIQHLEEMY----QWDGLKIDPMVNQYELNPWL 179
             +  T KA  +  E G ++ IG S+       EM     ++D  +   + +QY L    
Sbjct: 157 PIK-ETMKALNDVVEKGDVRYIGASSMLPTQFVEMQGVADKYDWFQFVNVQSQYNLLYRE 215

Query: 180 TRKELSNYCHQKGMVIQAYSP-----LTRARRLQDPELVKLVEDSY----------PEQT 224
             ++L  YC +  + +  +SP     LTR   +   E V+  +D +          P Q 
Sbjct: 216 DERDLMKYCKKHNIALTPWSPNYQGLLTRPVGV---ESVRSTKDKFINAWDLKKFDPAQK 272

Query: 225 S----------------AQILVNWSLQMGFVPLVKTVHEDRLKENIKSCDFELSSADLKK 268
           +                A I   W L  G  P+V      R+ E  ++ D         K
Sbjct: 273 AIIDRVEELSKKKGVPMAAISTAWVLAKGCYPIVGMSSIKRVDEAKEALDV--------K 324

Query: 269 LTHDDQYYLSQP 280
            T ++  YL +P
Sbjct: 325 FTEEELAYLEEP 336

>ZYRO0D02816g Chr4 (221712..222743) [1032 bp, 343 aa] {ON} similar
           to uniprot|Q02895 Saccharomyces cerevisiae YPL088W
           Putative aryl alcohol dehydrogenase transcription is
           activated by paralogous transcription factors Yrm1p and
           Yrr1p along with genes involved in multidrug resistance
          Length = 343

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 64/296 (21%), Positives = 114/296 (38%), Gaps = 58/296 (19%)

Query: 29  KEETTNIVHNALKLGYRQVDSAQLYGN----------------EREACLGITKF---LEE 69
           K+   +I+ +    G R  D+A +Y N                 RE  + +TK    ++E
Sbjct: 40  KQRIFSILKHCYDRGLRTFDTADVYSNGMSERLVGEFLRHYNINRETVVILTKVYFPVDE 99

Query: 70  SPKVSRSDIFFT-TKIKTQDQGYESAKKSIEESLNRVKELD-YIDLFLIHAPLTNKEKRL 127
           S +++ S+I  T   +   +Q   S K  I      V+ L  YID+  +H  L +     
Sbjct: 100 SIQLTHSNIASTDNGLTLANQRGLSRKHIIAGVKGSVERLGTYIDVLQLHR-LDHDTPME 158

Query: 128 GTWKAFQEYYETGKIKAIGVSNY------GIQHLEEMYQWDGLKIDPMVNQYELNPWLTR 181
              +A  +    G  + IG S+        +Q + E + W  +K     + Y L      
Sbjct: 159 EIMRALNDVVTQGDARYIGASSMLATEFAELQFIAEKHDW--VKFVSSQSCYNLLYREDE 216

Query: 182 KELSNYCHQKGMVIQAYSPLTRAR--------------------------RLQDPELVKL 215
           +EL  + H+  + +  +SPL R                               + E+VK 
Sbjct: 217 RELYPFAHRHNIALIPWSPLARGALSRPLGANTQRGSTDKGFQRFGFAELEAHEQEIVKR 276

Query: 216 VEDSYPEQ--TSAQILVNWSLQMGFVPLVKTVHEDRLKENIKSCDFELSSADLKKL 269
           VE    ++  + A +   W L  G  P+     E+R+ E +K+ D +L+  ++K L
Sbjct: 277 VEKVAKDKGISMATLGTAWVLSKGCYPIGGFSSEERVDEALKALDVKLTDEEIKYL 332

>NCAS0D03150 Chr4 complement(592701..593717) [1017 bp, 338 aa] {ON} 
          Length = 338

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 70/295 (23%), Positives = 114/295 (38%), Gaps = 65/295 (22%)

Query: 29  KEETTNIVHNALKLGYRQVDSAQLYGN---EREACLGITKF-LEESPKVSRSDIFFTT-- 82
           KEE   ++      G R  D+A  Y N   ER  C  + ++ +     V  S IFF    
Sbjct: 39  KEEVFALMKFCYDQGIRTFDTADQYSNGLSERLICEFLKRYSIRRETVVIMSKIFFAVDE 98

Query: 83  ------KIKTQDQGYES--------AKKSIEESLNRVKEL--DYIDLFLIH-----APLT 121
                  I   D G +         ++K I + + R  E    YID+  IH      P+ 
Sbjct: 99  AIDVPQNINLADAGVQLDVINQRGLSRKHIMDGVARSVERLGTYIDVLQIHRFDAETPME 158

Query: 122 NKEKRLGTWKAFQEYYETGKIKAIGVSNY-GIQHLEEMY--QWDGLKIDPMVN---QY-- 173
                  T +A  +  E G+++ +G S   G Q  E  +  Q +G      +N   QY  
Sbjct: 159 E------TMRALNDVVELGQVRYLGASRMLGTQFAEYQFVAQLNGWH--QFINWQSQYNL 210

Query: 174 -------ELNPWLTRKELS---NYCHQKGMVIQAYSPLTRARRLQDP----------ELV 213
                  E+ P+  R  ++    Y +  G++ +    ++   +  DP          E++
Sbjct: 211 LYREDEREVIPFAKRHNIALTPFYPNAGGLLARPLGQVSARTKSDDPKVKKLTARDKEII 270

Query: 214 KLVEDSYPEQ--TSAQILVNWSLQMGFVPLVKTVHEDRLKENIKSCDFELSSADL 266
             VE    E+  + AQI + W L  G  P+V      R +E+I +   +LS  DL
Sbjct: 271 NRVEQLSVEKGVSMAQISLAWLLHKGCYPIVGVNSIQRAQESIDALSLQLSEQDL 325

>Suva_4.122 Chr4 (228898..228945,228942..229163,229167..229517) [621
           bp, 206 aa] {ON} YDL124W (REAL)
          Length = 206

 Score = 38.1 bits (87), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 32/148 (21%), Positives = 65/148 (43%), Gaps = 11/148 (7%)

Query: 72  KVSRSDIFFTTKIKTQDQGYESAKKSIEESLNRVKELDYIDLFLIHAPLTNKEKRLGTWK 131
           K  +++IF T K  TQ +   +     + +L ++  ++Y+D+  +H+P   K+  +   K
Sbjct: 30  KKPKTEIFLTDKSSTQTEVSATLAMRPDMALKKI-SVEYVDMHFLHSPFVFKQANVLNLK 88

Query: 132 AF---QEYYETGKIKAIGVSNYGIQHLEEMYQWDGLKIDPMVNQYELNPWLTRKE--LSN 186
                     + K    G S+  ++ L  + + +    +P VNQ +L   L  +   +S 
Sbjct: 89  DAMHTDHLRRSNKANNRGASSVNVEELRRVLKTEDE--EPQVNQIKLRSSLRNQTPGISK 146

Query: 187 YCHQKGMVIQAYS---PLTRARRLQDPE 211
            C +  +++  YS   PL R     D +
Sbjct: 147 LCQENDILMAVYSTLDPLQRKNARNDSQ 174

>NDAI0G01600 Chr7 (349960..350994) [1035 bp, 344 aa] {ON} 
          Length = 344

 Score = 38.1 bits (87), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 70/313 (22%), Positives = 120/313 (38%), Gaps = 77/313 (24%)

Query: 29  KEETTNIVHNALKLGYRQVDSAQLYGNER-EACLGITKFLEESPKVSRSDIFFTTK---- 83
           KE+   I  +   +G+R  D+A +Y N + E  LG  +FL +  ++ R  +   TK    
Sbjct: 40  KEKIFQIFKHCYDIGFRTFDTADVYSNGKSERLLG--EFLRKF-EIRRETVVILTKTYFR 96

Query: 84  -------------------IKTQDQGYESAKKSIEESLNRVKELD-YIDLFLIHA--PLT 121
                              +   +Q   S K  ++   N V  L  YID+  IH   P T
Sbjct: 97  VDETLDLPLGEFPHSENDVLDLVNQQGLSRKHILDSVKNSVGRLGTYIDVLQIHRFDPTT 156

Query: 122 NKEKRLGTWKAFQEYYETGKIKAIGVSN------YGIQHLEEMYQWDGLKIDPMVNQYEL 175
             ++   T KA  +  E G ++ IG S+        +Q + + Y W   +   + +QY L
Sbjct: 157 PIKE---TMKALNDVVENGDVRYIGASSMLPTEFVEMQAIADKYDW--FQFVNVQSQYNL 211

Query: 176 NPWLTRKELSNYCHQKGMVIQAYSP-----LTRARRLQ------------------DP-- 210
                 ++L  YC +  + +  +SP     LTR   ++                  DP  
Sbjct: 212 LYREDERDLMKYCKKHNIALTPWSPNYQGLLTRPVGVESTRSKTDKVIDAWHLKNLDPAQ 271

Query: 211 -ELVKLVEDSYPEQ--TSAQILVNWSLQMGFVPLVKTVHEDRLKENIKSCDFELSSADLK 267
            E++  VE+   ++    A I   W +  G  P++      R+ E   + D         
Sbjct: 272 KEIINRVEELSKKKGVAMAAISTAWVMAKGCQPILGMSSIKRVDEAKDALDV-------- 323

Query: 268 KLTHDDQYYLSQP 280
           K T ++  YL +P
Sbjct: 324 KFTEEELAYLEEP 336

>Kpol_449.4 s449 (14334..15359) [1026 bp, 341 aa] {ON}
           (14334..15359) [1026 nt, 342 aa]
          Length = 341

 Score = 37.4 bits (85), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 73/316 (23%), Positives = 119/316 (37%), Gaps = 73/316 (23%)

Query: 19  CLGLG------LYQTPKEETTNIVHNALKLGYRQVDSAQLYGN-EREACLGITKFLEESP 71
           C+  G        Q  KEE   I+ +A   G R  D+A +Y N + E  LG  +FL +  
Sbjct: 23  CMSFGSKTWDEWVQDDKEEAFKILKHAYDRGIRSYDTANVYSNGQSEIILG--EFLRKY- 79

Query: 72  KVSRSDIFFTTKIK-----TQDQGYES---------------AKKSI-EESLNRVKELD- 109
            + R  +   TK++       D  +++               ++KSI   S   VK L  
Sbjct: 80  NIPRETVVIMTKLRFPADENMDIDFKNMTPEMKLNVVNMQGLSRKSIFSSSRASVKRLGT 139

Query: 110 YIDLFLIHA--PLTNKEKRLGTWKAFQEYYETGKIKAIGVS------NYGIQHLEEMYQW 161
           YID+  IH   P T  E+ +G   A  +    G  + +G S         +Q + E + W
Sbjct: 140 YIDILQIHRGDPDTPFEETMG---ALNDVVIEGLTRYVGASLMLATEFAEMQFVAEKHGW 196

Query: 162 DGLKIDPMVNQYELNPWLTRKELSNYCHQKGMVIQAYSPLTRAR--RLQDPELVKLVEDS 219
              K     + Y L      +EL  +  +  + +  +SPL R    R    E  +   DS
Sbjct: 197 --FKFVNSQSCYHLMYREDERELIPFAKRHNIALTPFSPLNRGLLCRPLGTETTRSNSDS 254

Query: 220 YPEQTS--------------------------AQILVNWSLQMGFVPLVKTVHEDRLKEN 253
             +  +                          + I + W LQ G  P+V     +R++E 
Sbjct: 255 VIKTKNLKNYTDWEASIINRVEKLSIKKNIPMSAISLAWVLQKGCFPIVGFSSIERVEEA 314

Query: 254 IKSCDFELSSADLKKL 269
           I + D  L+  ++K L
Sbjct: 315 IDALDVNLTEEEMKYL 330

>KNAG0L01560 Chr12 (276747..277769) [1023 bp, 340 aa] {ON} 
          Length = 340

 Score = 37.0 bits (84), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 68/304 (22%), Positives = 119/304 (39%), Gaps = 79/304 (25%)

Query: 43  GYRQVDSAQLYGNE-REACLGITKFLEESPKVSRSDIFFTTKIK-TQDQGYESAK----- 95
           G R  D+A +Y N   E  LG  KFL++   ++R  +   TK+    D+  E  K     
Sbjct: 53  GVRTFDTANVYSNGVSERLLG--KFLKKY-NINRETVVILTKVYFPVDESLEPFKIGGEN 109

Query: 96  --------------------KSIEESLNRVKELDYIDLFLIHA---PLTNKEKRLGTWKA 132
                                S+++S+ R+    YID+  IH      T KE      KA
Sbjct: 110 DPLTDVTLSNQRGLSRKNILASVDKSVERLG--TYIDVLQIHRLDHECTGKE----IMKA 163

Query: 133 FQEYYETGKIKAIGVSN------YGIQHLEEMYQWDGLKIDPMVNQYELNPWLTRKELSN 186
             +  E+ K++ +G S         +Q + E Y W   +      +Y L      +EL +
Sbjct: 164 LNDVVESNKVRYVGASTMLATEFVELQMIAEKYDW--FQFVSSQTEYSLLFREDERELLS 221

Query: 187 YCHQKGMVIQAYSP-----LTRARRLQ----------------DPELVKLVEDSYPEQTS 225
           Y  +  + +  +SP     L R                     D   +K VE+   +++ 
Sbjct: 222 YTKRNNIAVLPWSPNAGGYLCRPLDAATERSNSNTYKTEITEGDKITIKRVEEIAKKKSV 281

Query: 226 AQILVN--WSLQMGFVPLVKTVHEDRLKENIKSCDFELSSADLKKLTHDDQYYLSQPKWD 283
           +  +++  W +  G+ P++     +R+KE I++   E        LT ++  YL +P + 
Sbjct: 282 SMAMISEAWVMSKGYNPIIGFSSVERVKEAIEATKIE--------LTEEEINYLEEP-YQ 332

Query: 284 PIKY 287
           P KY
Sbjct: 333 PKKY 336

>KAFR0J00220 Chr10 complement(37107..38138) [1032 bp, 343 aa] {ON} 
          Length = 343

 Score = 37.0 bits (84), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 68/303 (22%), Positives = 113/303 (37%), Gaps = 71/303 (23%)

Query: 29  KEETTNIVHNALKLGYRQVDSAQLYGNEREACLGITKFLEESPKVSRSDIFFTTKI---- 84
           KE+   I+ +    G R  D+A +Y N    C  + K   E  K+ R  +   TK+    
Sbjct: 39  KEKVFKILKHCYDQGLRTFDTADVYSN--GLCERLLKEFLEEYKIRRETVVIMTKLFFPV 96

Query: 85  --------------------KTQDQG------YESAKKSIEESLNRVKELDYIDLFLIHA 118
                                T  QG       ++AKKS+E      +   YID+  IH 
Sbjct: 97  DETLDLSLGGAIEDGVGKLDLTNQQGLSRKHILDAAKKSVE------RLGTYIDVLQIHR 150

Query: 119 PLTNKEKRLGTWKAFQEYYETGKIKAIGVSNY-GIQHLEEMYQWDGLKIDPMVNQYELNP 177
              N   +  T +A  +  E G  + IG S+  G Q  E  +  D       VN      
Sbjct: 151 FDPNTPVK-ETMRALNDVVEMGLTRYIGASSMLGTQLAELQFTADKYNWFQFVNVQSCYN 209

Query: 178 WLTR---KELSNYCHQKGMVIQAYSP-----LTR------ARRLQDPEL----------- 212
            + R   +E+  +  +  +++  +SP     LTR      AR   D  L           
Sbjct: 210 LIYREDEREIIPFAKRHNLMLTPWSPNHGGLLTRPVGVESARSSTDIILNDWGMKHLKPW 269

Query: 213 ----VKLVEDSYPEQ--TSAQILVNWSLQMGFVPLVKTVHEDRLKENIKSCDFELSSADL 266
               V  +E+   ++  + A I   W +  G  P++      R+ +NIK+ D + ++ ++
Sbjct: 270 EITIVNRIEELAKKKNVSMAVISAAWVISKGCAPIIGMSSIARVDDNIKALDVQFTNEEM 329

Query: 267 KKL 269
           K L
Sbjct: 330 KYL 332

>NCAS0A03110 Chr1 complement(609267..610301) [1035 bp, 344 aa] {ON} 
          Length = 344

 Score = 37.0 bits (84), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 70/299 (23%), Positives = 115/299 (38%), Gaps = 57/299 (19%)

Query: 26  QTPKEETTNIVHNALKLGYRQVDSAQLYGN----------------EREACLGITKF--- 66
           Q  KE+   I+ +    G R  D+A +Y N                 RE  + +TK    
Sbjct: 37  QDDKEKVFTILKHCYDRGLRTFDTADVYSNGYSERLLGEFLKKYNIRRETVVILTKLFAP 96

Query: 67  LEESPKVSRSDIFFTTKI---KTQDQGYESAKKSIEESLNRVKELD-YIDLFLIHAPLTN 122
           ++ES K   +D   +  I    T  QG  S K  ++   N V+ L  YID+  IH    N
Sbjct: 97  VDESLKFKFADPSTSENILLDLTNQQGL-SRKHIMQAVKNSVERLGTYIDVLQIHRFDPN 155

Query: 123 KEKRLGTWKAFQEYYETGKIKAIGVSNYGIQHLEEMY----QWDGLKIDPMVNQYELNPW 178
              +  T K   +  E G ++ IG S+       EM     + D  +   + + Y L   
Sbjct: 156 TPIK-ETMKGLNDVIEGGDVRYIGASSMLPTQFVEMQGIADKHDWFQFVNVQSCYNLVYR 214

Query: 179 LTRKELSNYCHQKGMVIQAYSP-----LTR----------------ARRLQ--DPELVKL 215
              ++L  YC +  + +  +SP     LTR                A +++  DP  V++
Sbjct: 215 EDERDLFQYCKKHNIALTPWSPNHQGLLTRPVGVESTRSSKDTFINATKMKEMDPAEVEI 274

Query: 216 V----EDSYPEQTSAQIL-VNWSLQMGFVPLVKTVHEDRLKENIKSCDFELSSADLKKL 269
           +    E S  +     +L   W L     P+V     +R+ E I + D   +  ++K L
Sbjct: 275 INRIEELSKKKNVPMAVLSTAWVLSKQCSPIVGMSSINRVDEAITALDVTFTEEEIKYL 333

>KAFR0C04240 Chr3 (842806..843837) [1032 bp, 343 aa] {ON} 
          Length = 343

 Score = 36.6 bits (83), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 67/326 (20%), Positives = 128/326 (39%), Gaps = 68/326 (20%)

Query: 6   GTTHALKNGVKMPCLGLG------LYQTPKEETTNIVHNALKLGYRQVDSAQLYGN-ERE 58
           G T    + + + C+  G        +  +EE   I+      G R  D+A +Y N E E
Sbjct: 10  GNTGIKISPIVVGCMSFGSKRWQAWIEDDREEAFKILKYCYDHGLRTFDTADVYSNGESE 69

Query: 59  ACLGITKFLEESPKVSRSDIFFTTKI--KTQDQ-----GYESAKKSIEESLNRVKELDYI 111
             LG  +FL+    + R  +   TK+     D+     G++    S +  L+ V     +
Sbjct: 70  KFLG--EFLKRY-NIRRETVVILTKVYFPVDDELPEFGGFKDLAASEQMQLD-VTNQRGL 125

Query: 112 DLFLIHAPLTNKEKRLGTW-------------------KAFQEYYETGKIKAIGVSN--- 149
               I A +    +RLGT+                   ++  +   +G ++ IG S    
Sbjct: 126 SRKHILAGVAKSVERLGTYIDVLQLHRLDHGLPMKEIMRSLNDVVMSGNVRYIGASTMLA 185

Query: 150 ---YGIQHLEEMYQWDGLKIDPMVNQYELNPWLTRKELSNYCHQKGMVIQAYSP-----L 201
                +Q++ E Y W   +     +QY L      +E+  +  +  + +  +SP     L
Sbjct: 186 TEFVEMQYIAEKYNW--FQFVSWQSQYNLLYREDEREVIPFAKKHNIALIPWSPNARGIL 243

Query: 202 TRARRL----------------QDPELVKLVEDSYPEQTSAQILVN--WSLQMGFVPLVK 243
           TR   +                QD +++  VE    ++  +  +V+  W L  G  P+V 
Sbjct: 244 TRPNGVDSDRSSIDPRLQNLPEQDKQIIDRVEKVARDRGVSMAMVSTAWVLSKGCSPIVG 303

Query: 244 TVHEDRLKENIKSCDFELSSADLKKL 269
               +R++E I++ + +L+ A++K L
Sbjct: 304 LNSIERVQEAIEAVNLKLNEAEIKFL 329

>NDAI0D00600 Chr4 (131820..132803) [984 bp, 327 aa] {ON} 
          Length = 327

 Score = 36.6 bits (83), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 51/210 (24%), Positives = 88/210 (41%), Gaps = 36/210 (17%)

Query: 20  LGLGLYQTPKEETTNIVHNALKLGYRQVDSAQLYGN-EREACLGITKFLEESPKVSRSDI 78
           LGL   +  +++   I+ +   +G+R  D+A +Y N E E  LG  +FL+E      +  
Sbjct: 24  LGLNGLKMTRKKFFQILKHCYDIGFRTFDTADVYSNGESERLLG--EFLKEFNIKKGNSG 81

Query: 79  FFTTK-----------------------IKTQDQGYESAKKSIEESLNRVKEL-DYIDLF 114
           +  TK                       +   +Q   S K  ++   N V+ L  YID+ 
Sbjct: 82  YLLTKTYFPMDETLVLAMVEAPQSESGVLDLVNQQGLSRKHILQAVKNSVERLGTYIDVL 141

Query: 115 LIHAPLTNKEKRLGTWKAFQEYYETGKIKAIGVSNYGIQHLEEMY----QWDGLKIDPMV 170
            IH   +    + GT KA  +  E G ++ IG S+       EM     ++D  +   + 
Sbjct: 142 QIHRFDSTTPIK-GTMKALNDVVENGDVRYIGASSMLPTQFVEMQAVADKYDWFQFVNVQ 200

Query: 171 NQYELNPWLTRKELSNYCHQKGMVIQAYSP 200
           +QY L   L RK+  + C +  + +  +SP
Sbjct: 201 SQYNL---LYRKDERD-CKKHNIALTPWSP 226

>SAKL0H09438g Chr8 (803426..804454) [1029 bp, 342 aa] {ON} highly
           similar to uniprot|Q02895 Saccharomyces cerevisiae
           YPL088W Putative aryl alcohol dehydrogenase
           transcription is activated by paralogous transcription
           factors Yrm1p and Yrr1p along with genes involved in
           multidrug resistance
          Length = 342

 Score = 36.6 bits (83), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 71/309 (22%), Positives = 119/309 (38%), Gaps = 70/309 (22%)

Query: 29  KEETTNIVHNALKLGYRQVDSAQLYGNEREACLGITKFLEESPKVSRSDIFFTTKI---- 84
           +EE   ++ +    G R  D+A  Y N     L + KFL+    ++R  +   TK+    
Sbjct: 39  EEEIFKVLKHCYDNGLRTFDTADFYSNGLSERL-VGKFLKRY-NINRETVVILTKVFFPV 96

Query: 85  -----KTQDQGYESAKK---SIEESLNRVKELD-----------YIDLFLIHAPLTNKEK 125
                 +  +G + A +   + +  L+R   LD           YID+  IH   T    
Sbjct: 97  DETLDLSHSKGMDEATQLTVANQRGLSRKHILDGVAKSVERLGTYIDVLQIHRFDTETPV 156

Query: 126 RLGTWKAFQEYYETGKIKAIGVSNY------GIQHLEEMYQWDGLKIDPMVNQYELNPWL 179
              T KA  +    G  + IG S+        +Q + E + W   K     + Y L    
Sbjct: 157 N-ETMKALNDVVSKGYARYIGASSMLATQFAELQFVAEKHDW--FKFISSQSCYNLLYRE 213

Query: 180 TRKELSNYCHQKGMVIQAYSP-----LTR-------------------ARRLQ--DPELV 213
             +EL  +  +  + +  +SP     LTR                   A  LQ  + E+V
Sbjct: 214 DERELIPFAKRHNIGLIPWSPNARGVLTRPLGTQTLRHSTDFGLKRISAFDLQPHEEEIV 273

Query: 214 KLVEDSYPEQ--TSAQILVNWSLQMGFVPLVKTVHEDRLKENIKSCDFELSSADLKKLTH 271
           + V +   ++  T A + + W L  G  P+V     +R+ E IK+ +F        KLT 
Sbjct: 274 RRVGEIAEKRGVTMAVVSIAWVLSKGCYPIVGLSSTERVDETIKAVEF--------KLTE 325

Query: 272 DDQYYLSQP 280
           ++  YL +P
Sbjct: 326 EEATYLEEP 334

>NDAI0G04890 Chr7 (1178096..1179127) [1032 bp, 343 aa] {ON} 
          Length = 343

 Score = 35.8 bits (81), Expect = 0.098,   Method: Compositional matrix adjust.
 Identities = 69/304 (22%), Positives = 115/304 (37%), Gaps = 74/304 (24%)

Query: 29  KEETTNIVHNALKLGYRQVDSAQLYGNE-REACLGITKFLEESPKVSRSDIFFTTKIK-- 85
           KE+   I+ +    G R  D+A +Y N   E  LG  +FL++   + R  +   TK+   
Sbjct: 39  KEKIFKILKHCYDNGLRTFDTADVYSNGFSERLLG--EFLKKY-NIRRETVVILTKVNFP 95

Query: 86  --------------------TQDQGYESAKKSIEESLNRVKELD-YIDLFLIH-----AP 119
                                 +QG  S K  +E   N V+ L  YID+  IH      P
Sbjct: 96  VDETLDIAVGKPPSESEALDLANQGGLSRKHILEGVKNSVERLGTYIDVLQIHRFDHEVP 155

Query: 120 LTNKEKRLGTWKAFQEYYETGKIKAIGVSNY------GIQHLEEMYQWDGLKIDPMVNQY 173
           +        T +A  +    G  + IG S         +Q + E   W   K     + Y
Sbjct: 156 MEE------TMRALNDVVVQGLTRYIGASLMLATEFAELQFIAEKNGW--FKFISSQSYY 207

Query: 174 ELNPWLTRKELSNYCHQKGMVIQAYSPLTRAR------RLQDPELV------KLVEDSYP 221
            L      +EL  +  + G+ +  Y+P  R R       + + E+V      +LV+D   
Sbjct: 208 NLLNREDERELIPFAKRHGVGLIPYTPNARGRLCRPVGTVTEREVVDKALHPRLVQDLSD 267

Query: 222 EQ----------------TSAQILVNWSLQMGFVPLVKTVHEDRLKENIKSCDFELSSAD 265
           +Q                + A I + W+L  G  P+V     +R+ E I++ + EL+  +
Sbjct: 268 DQIEIITRVEELSKKKNVSMATISMAWTLYKGVNPIVGLSSIERVDEAIRATEVELTKEE 327

Query: 266 LKKL 269
           +  L
Sbjct: 328 VDYL 331

>KLTH0D02002g Chr4 complement(196550..197293) [744 bp, 247 aa] {ON}
           conserved hypothetical protein
          Length = 247

 Score = 35.0 bits (79), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 43/75 (57%), Gaps = 8/75 (10%)

Query: 37  HNALKLGYRQVDSAQ-----LYGNEREACLGITKFLEESPKVSRSDIFFT--TKIKTQDQ 89
           H  L     Q++S +     +Y ++ ++C+ + +  +E PK  ++DI+ T  ++ K Q+Q
Sbjct: 141 HTPLLQATPQINSGECVIRGVYASD-QSCIKMPRNGDEKPKAYKNDIYVTRPSRFKPQEQ 199

Query: 90  GYESAKKSIEESLNR 104
           GY   ++ +E +LN+
Sbjct: 200 GYRQLQQGVEPTLNK 214

>Suva_16.224 Chr16 (392092..393120) [1029 bp, 342 aa] {ON} YPL088W
           (REAL)
          Length = 342

 Score = 35.4 bits (80), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 68/298 (22%), Positives = 108/298 (36%), Gaps = 62/298 (20%)

Query: 29  KEETTNIVHNALKLGYRQVDSAQLYGNEREACLGITKFLEESPKVSRSDIFFTTKI---- 84
           K +   I+ +    G R  D+A  Y N     + I +FL+    + R  +   TKI    
Sbjct: 39  KAQIFKILKHCYDNGLRTFDTADFYSNGLSERI-IKEFLDHY-SIKRETVVIMTKIFLPI 96

Query: 85  -KTQDQGYE-----------------SAKKSIEESLNRVKELD-YIDLFLIHAPLTNKEK 125
            +T D  ++                 S K  I    N V+ L  YIDL  IH  L +   
Sbjct: 97  DETLDLRHKFTLGEAEELDLTNQRGLSRKHIIAGVKNSVERLGTYIDLLQIHR-LDHDTP 155

Query: 126 RLGTWKAFQEYYETGKIKAIGVSNY------GIQHLEEMYQWDGLKIDPMVNQYELNPWL 179
                +A  +  E G ++ IG S+        +Q + + Y W   +     + Y L    
Sbjct: 156 MKEIMRALNDVVEAGDVRYIGASSMLATEFAELQFIADKYGW--FQFISSQSYYNLLNRE 213

Query: 180 TRKELSNYCHQKGMVIQAYSPLTRA-----------RRLQDP---------------ELV 213
             +EL  +  +  + +  +SP  R            R+  DP               E+V
Sbjct: 214 DERELIPFAKRHNIGLLPWSPNARGVLTRPLDKTTDRQKSDPTFKSLKLDALEDDQMEIV 273

Query: 214 KLVEDSYPEQ--TSAQILVNWSLQMGFVPLVKTVHEDRLKENIKSCDFELSSADLKKL 269
             VE    E+  + A I + W L  G  P+V      R+ E I +    L+  D+K L
Sbjct: 274 NRVEKISKEKNVSMAMISIAWVLHKGCHPIVGLNSTSRVDEAIAALQLTLTEEDVKYL 331

>AAR033W Chr1 (401423..402448) [1026 bp, 341 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR127W
          Length = 341

 Score = 34.7 bits (78), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 32/119 (26%), Positives = 54/119 (45%), Gaps = 10/119 (8%)

Query: 93  SAKKSIEESLNRVKELDYIDLFLIHAPLTNKEKRLG------TWKAFQEYYETGKIKAIG 146
           S +KS++  L  +    YID+F   A    K    G      + +A  EY + GKI AIG
Sbjct: 104 SVRKSMDNCLREIG--GYIDIFEC-ARFDPKAVAPGELYPRASIEAVVEYVKAGKIGAIG 160

Query: 147 VSNYGIQHLEEMYQWDGLKIDPMVNQYE-LNPWLTRKELSNYCHQKGMVIQAYSPLTRA 204
           +S    + +  + +  G  +  +  ++  L+  +    L+  C + G+ I  YSPL R 
Sbjct: 161 LSEVTAEQVRAISRDYGEYLACVEVEFSMLSRDILHNGLAQTCAELGIPILCYSPLARG 219

>Kwal_26.8377 s26 (759190..760206) [1017 bp, 338 aa] {ON} YMR041C -
           Hypothetical ORF [contig 59] FULL
          Length = 338

 Score = 34.7 bits (78), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 31/131 (23%), Positives = 58/131 (44%), Gaps = 11/131 (8%)

Query: 32  TTNIVHNALKLGYRQVDSAQLYGNEREACLGITKFLEE-SPKVSRSDIFFTTKIKTQ--- 87
            + ++  A++ G R +D++  YG+  E   G  K LE    ++ R + F  TK+      
Sbjct: 45  VSEMLKYAVQHGIRAIDTSPYYGDS-EKLFG--KALESLKDEIPRENYFICTKVGRIRLD 101

Query: 88  --DQGYESAKKSIEESLNRVKELDYIDLFLIH-APLTNKEKRLGTWKAFQEYYETGKIKA 144
             D   E  + S+  S  R++  DY+D+  +H        + L   K  ++  + G +  
Sbjct: 102 EFDYSREHVRSSVLRSCERLRT-DYLDVVFLHDVEFVETAQVLEALKELRKLKDEGVLHN 160

Query: 145 IGVSNYGIQHL 155
            G+S Y +  L
Sbjct: 161 FGISGYPVDFL 171

>Skud_3.179 Chr3 (292171..293205) [1035 bp, 344 aa] {ON} YPL088W
           (REAL)
          Length = 344

 Score = 33.5 bits (75), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 63/285 (22%), Positives = 103/285 (36%), Gaps = 64/285 (22%)

Query: 43  GYRQVDSAQLYGNE-REACLGITKFLEESPKVSRSDIFFTTKI----------------- 84
           G R  D+A +Y N   E  LG  +FL+   K+ R  +   TK+                 
Sbjct: 55  GMRTFDTADVYSNGLSERILG--EFLKHY-KIKRETVVILTKVYYPVDESLELTHFGKVS 111

Query: 85  -----KTQDQGYESAKKSIEESLNRVKELD-YIDLFLIHAPLTNKEKRLGTWKAFQEYYE 138
                   +Q   S K  +E + N V+ L  YID+  IH  L +        KA     E
Sbjct: 112 EFDMLGLVNQSGLSRKHILEAAKNSVERLGTYIDVLQIHK-LDHDTPMEEIMKALNGVVE 170

Query: 139 TGKIKAIGVSNY------GIQHLEEMYQWDGLKIDPMVNQYELNPWLTRKELSNYCHQKG 192
            G  + IG S+        +Q + E   W   K     + Y L      +EL  +  + G
Sbjct: 171 LGYTRYIGASSMLATEFAELQFIAEKRDWT--KFICSQSCYSLLYREDERELIPFAKKHG 228

Query: 193 MVIQAYSPLTRA-----------RRLQDPELVKLVEDSYPEQ-----------------T 224
           + +  +SP  R            R+  DP   +L  D                      +
Sbjct: 229 IGLIPWSPNARGILTRPLNQATDRKNSDPTFKRLKFDCLESHEKGIVNRVEELAKKKGIS 288

Query: 225 SAQILVNWSLQMGFVPLVKTVHEDRLKENIKSCDFELSSADLKKL 269
            A + + W L  G  P+V     +R+ E I++ + +L+  +++ L
Sbjct: 289 MAMVSIAWVLSKGACPIVGLNSIERVDEAIRAVNVQLTEEEIQYL 333

>KLTH0D08844g Chr4 (738727..739749) [1023 bp, 340 aa] {ON} similar
           to uniprot|Q04212 Saccharomyces cerevisiae YMR041C
           Hypothetical ORF
          Length = 340

 Score = 33.5 bits (75), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 30/131 (22%), Positives = 60/131 (45%), Gaps = 11/131 (8%)

Query: 32  TTNIVHNALKLGYRQVDSAQLYGNEREACLG--ITKFLEESPKVSRSDIFFTTKI-KTQD 88
             +++  A++ G R +D++  YG+  E   G  +    EE P   R + F  TK+ + + 
Sbjct: 45  VVDMIRFAMQFGVRAIDTSPYYGDS-EVLYGAALESLKEELP---RENYFICTKVGRIRL 100

Query: 89  QGYESAKKSIEESLNRVKE---LDYIDLFLIH-APLTNKEKRLGTWKAFQEYYETGKIKA 144
           + ++ ++  I  S+ R  E     Y+D+  +H       E+ L   +  ++  + G I  
Sbjct: 101 EEFDYSRSHIHFSVLRSCERLKTKYLDVVFLHDVEFVETEQVLEALQELRKLRDEGVILN 160

Query: 145 IGVSNYGIQHL 155
            G+S Y +  L
Sbjct: 161 FGISGYPVDFL 171

>Kpol_1013.23 s1013 complement(54054..55028) [975 bp, 324 aa] {ON}
           complement(54054..55028) [975 nt, 325 aa]
          Length = 324

 Score = 33.1 bits (74), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 65/262 (24%), Positives = 101/262 (38%), Gaps = 40/262 (15%)

Query: 33  TNIVHNALKLGYRQVDSAQLYGNEREACLGITKFLEESPKVSRSDIFFTTKI-----KTQ 87
            +I+  A K G   +DS+  YG   E  LG   F E   + SR      TK+        
Sbjct: 28  ADILRTAFKNGINAIDSSPYYG-PSEILLGNALF-ELKDEFSRDQYKICTKVGRIGMNEF 85

Query: 88  DQGYESAKKSIEESLNRVKELDYIDLFLIH-APLTNKEKRLGTWKAFQEYYETGKIKAIG 146
           D   E+ + S++ S  R     Y+DL  +H    T  ++ +      ++  + G I+  G
Sbjct: 86  DYSKENVRHSVQRSCERF-HTSYLDLVYLHDVEFTTVDESIEACMELKKLKDEGIIRNFG 144

Query: 147 VSNYGIQHLEEMYQWDGLKIDPMVNQYELNPWLTRKELSNYCHQKGM--VIQAYSPLTRA 204
           +S Y + ++                 Y+L   LT    +NY  + G   V+ +Y  L   
Sbjct: 145 LSGYPLDYI-----------------YKLVYHLT----TNYKEEIGNLDVVLSYCNLNLQ 183

Query: 205 RRLQDPELVKLVEDSYPEQTSAQILVNWSLQ----MGFVPLVKTVHE--DRLKENIKSCD 258
             + +    KL+  +     +A IL    L+      F P  K + E  DR  E  KS  
Sbjct: 184 NTMLNEYYQKLMNCNLKTICNASILSMSLLRSNETRSFHPCSKELREAADRSSEYCKSNG 243

Query: 259 FELSSADLKKLTHDDQYYLSQP 280
            EL  ADL       Q+Y   P
Sbjct: 244 VEL--ADLATRYALSQWYGKGP 263

>NDAI0A04610 Chr1 complement(1035715..1036761) [1047 bp, 348 aa]
           {ON} Anc_3.462
          Length = 348

 Score = 33.1 bits (74), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 56/261 (21%), Positives = 107/261 (40%), Gaps = 41/261 (15%)

Query: 27  TPKEETTNIVHNALKLGYRQ-----VDSAQLYGNEREACLGITKFLEESPKVSRSDIFFT 81
            P ++    +H  +KL   +      +  + YG +        +F  + P + R D+  +
Sbjct: 30  VPMDQAFKTMHQVIKLAQARNHKAFFNVGEFYGPDYRNLTYCKEFFAKYPDL-RKDVIIS 88

Query: 82  TK-----IKTQDQG-YESAKKSIEESLNRVKELDYIDLF---LIHAPLTNKEKRL--GTW 130
            K     I    QG ++    S++  +  +    YID+F    +   + +K++     T+
Sbjct: 89  CKGAYDGINFVCQGKHDQVIDSVKACVQNIG--GYIDIFEPARLDMEICSKDEVYPRETF 146

Query: 131 KAFQEYYETGKIKAIGVSNYGIQHLEEMYQWDGLKIDPMVNQYELNPWLT---RKELSNY 187
           +A  E  E G I A+ +S    + +  +++ D  K    V + EL+ + T     +++  
Sbjct: 147 EALAELIEEGVIGAMSLSEVVAKEITAVHK-DFAKYLACV-EVELSMFTTDILHNDVAKV 204

Query: 188 CHQKGMVIQAYSPLTRARRLQDPELVKLVEDSYPEQTSAQILVNWSLQMGFVPLVKTVHE 247
           C + G++I  YSPL R       +      +  PE  S Q  ++W             H 
Sbjct: 205 CSEYGLIIICYSPLGRGLLTGQIK----TNNDIPE-GSYQKAISW------------FHG 247

Query: 248 DRLKENIKSCDFELSSADLKK 268
           DRLK+N+    F  +   LK+
Sbjct: 248 DRLKQNLVLVQFLENEIRLKR 268

>TDEL0C05300 Chr3 complement(943838..945118) [1281 bp, 426 aa] {ON}
           Anc_3.393 YBR130C
          Length = 426

 Score = 33.1 bits (74), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 41/83 (49%), Gaps = 14/83 (16%)

Query: 141 KIKAIGVSNYGIQHLEE--MYQWDGLKIDPMVNQYELNPWL-----TRKELSNYCHQKGM 193
           K+    V +  IQ LE+  +   +G K D MVNQ +LN W+     + + L +Y  +  +
Sbjct: 238 KLSEFDVKSDNIQQLEKDRLTHLEG-KCDDMVNQLDLNAWVNLYKESARTLLDYAEKMNI 296

Query: 194 VI-QAYSPLTRARRLQDPELVKL 215
            + Q +  LT     QDP+L  L
Sbjct: 297 TLPQQFHQLT-----QDPDLAAL 314

>Smik_16.149 Chr16 (265088..266116) [1029 bp, 342 aa] {ON} YPL088W
           (REAL)
          Length = 342

 Score = 32.7 bits (73), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 64/289 (22%), Positives = 103/289 (35%), Gaps = 72/289 (24%)

Query: 43  GYRQVDSAQLYGNEREACLGITKFLEESPKVSRSDIFFTTKIKTQDQGYESAKKSIEE-- 100
           G R  D+A  Y N     + I +FLE    + R  +   TKI      +    +++E   
Sbjct: 53  GLRTFDTADFYSNGLSERI-IKEFLELY-NIKRETVVIMTKI------FLPVDETLELHH 104

Query: 101 --SLNRVKELDY-----IDLFLIHAPLTNKEKRLGTW-------------------KAFQ 134
             ++N V+ELD      +    I A + N  +RLGT+                   KA  
Sbjct: 105 NFTMNEVQELDLTNQRGLSRKHIIAGVKNSVERLGTYIDLLQIHRLDQDTPMKEIMKALN 164

Query: 135 EYYETGKIKAIGVSNY------GIQHLEEMYQWDGLKIDPMVNQYELNPWLTRKELSNYC 188
           +  E G ++ IG S+        +Q + + Y W   +     + Y L      +EL  + 
Sbjct: 165 DVVEAGHVRYIGASSMLATEFAELQFIADKYGW--FQFISSQSYYNLLNREDERELIPFA 222

Query: 189 HQKGMVIQAYSPLTRA-----------RRLQDPELVKLVEDSYPEQ-------------- 223
            +  + +  +SP  R            R   DP    L  DS  E               
Sbjct: 223 KRHNIGLLPWSPNARGILTRPLGQNTDRIKSDPTFKSLQLDSLEEDQMEIINRVEKLSKD 282

Query: 224 ---TSAQILVNWSLQMGFVPLVKTVHEDRLKENIKSCDFELSSADLKKL 269
              + A I V W L  G  P+V      R+ E I +    L+  +++ L
Sbjct: 283 KNVSMAMISVAWVLHKGCHPIVGLNSTSRVDEVIAALQITLTEKEIEYL 331

>NDAI0I01760 Chr9 (413802..414821) [1020 bp, 339 aa] {ON} 
          Length = 339

 Score = 32.3 bits (72), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 73/295 (24%), Positives = 114/295 (38%), Gaps = 58/295 (19%)

Query: 29  KEETTNIVHNALKLGYRQVDSAQLYGN-EREACLG-ITKF--LEESPKVSRSDIFFTT-- 82
           K+E   ++      G R  D+A  Y N + E  LG   +F  ++    V  + IFF    
Sbjct: 39  KQEVFRLLKYCYDQGLRTFDTADQYSNGQSERILGEFLRFYNIKRETVVIMTKIFFEVDE 98

Query: 83  ---------------KIKTQDQGYESAKKSIEESLNRVKELD-YIDLFLIHA--PLTNKE 124
                          K+   +Q   S K  I    N    L  YID+  IH   P T  E
Sbjct: 99  TLDVPQSIKTANDEIKLAVVNQRGLSRKHIIAGVSNSCDRLGTYIDVLQIHRYDPETPME 158

Query: 125 KRLGTWKAFQEYYETGKIKAIGVSNYGIQHLEEMYQWDGLK--IDPMVN---QYELNPWL 179
           +   T +A  +   +G+++ IG S        E YQ+   K      VN   QY L    
Sbjct: 159 E---TMRALNDVINSGEVRYIGASRMLATQFAE-YQFIAGKNGWHKFVNWQSQYNLLYRE 214

Query: 180 TRKELSNYCHQKGMVIQAYSP-----LTRA------------RRLQ-----DPELVKLVE 217
             +E+  +  +  + +  YSP     LTR              RL+     D E+V+ V 
Sbjct: 215 DEREVIPFAKRHNIALTPYSPNAKGILTRPWGSSTERTGKGDPRLKMLMKCDREIVERVR 274

Query: 218 DSYPEQ--TSAQILVNWSLQMGFVPLVKTVHEDRLKENIKSC-DFELSSADLKKL 269
                +  + AQI ++W L  G  P++      R++E + +  +  LSS D+  L
Sbjct: 275 QLADRKNVSMAQISLSWILHKGCYPIIGVNSIPRVQEAVVALQELSLSSEDISFL 329

>Kwal_47.16696 s47 complement(67984..72276) [4293 bp, 1430 aa] {ON}
           YJR137C (ECM17) - Putative sulfite reductase [contig
           376] FULL
          Length = 1430

 Score = 32.3 bits (72), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 25/43 (58%)

Query: 59  ACLGITKFLEESPKVSRSDIFFTTKIKTQDQGYESAKKSIEES 101
           A L   +FL +    S S I++TT  K+ D G+ SA KS +++
Sbjct: 2   AELSSAQFLADVASASESTIYYTTDAKSLDSGFSSALKSKQDT 44

>KLTH0G07304g Chr7 (585983..591001) [5019 bp, 1672 aa] {ON} similar to
            uniprot|P47054 Saccharomyces cerevisiae YJL039C NUP192
            Essential structural subunit of the nuclear pore complex
            (NPC) localizes to the nuclear periphery of nuclear pores
            homologous to human p205
          Length = 1672

 Score = 32.3 bits (72), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 29/114 (25%), Positives = 54/114 (47%), Gaps = 4/114 (3%)

Query: 7    TTHALKNGVKMPCLGLGLYQTPKEETTNIVHNALKLGYRQVDSAQLYGNEREACLGITKF 66
            T   L +G++   L   LY+    ++T  +H  +++   +  +  L  NE    +   +F
Sbjct: 1465 TDDLLSSGLEGITLDNLLYELTAFKST--IHFLIRIAESRSGAQALVENEIFRVIESCEF 1522

Query: 67   LEESPKVSRSDIFFTTKIKTQDQGYESAKKSIEESLNRVKELDYIDLFLIHAPL 120
            LE  P +    IF  T+++TQ+        S+++SLN  K+   + LF I  P+
Sbjct: 1523 LEADPDLGLELIF--TEVRTQESQAVRVTFSLDKSLNLSKDACGLSLFEIIVPV 1574

>KLTH0D13750g Chr4 complement(1120534..1121550) [1017 bp, 338 aa]
           {ON} similar to uniprot|Q06494 Saccharomyces cerevisiae
           YPR127W Hypothetical ORF
          Length = 338

 Score = 32.0 bits (71), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 34/155 (21%), Positives = 60/155 (38%), Gaps = 27/155 (17%)

Query: 114 FLIHAPLTNKEKRLG-------TWKAFQEYYETGKIKAIGVSNYGIQHLEEMYQWDGLKI 166
           F I  P    EK  G       T++   EY + G +  + +S    + +  ++   G  I
Sbjct: 120 FDIFQPARLDEKLFGDNVYPDETFETLVEYIKKGSLGGLSLSEVNAEQIRAIHAKYGEYI 179

Query: 167 DPMVNQYEL-NPWLTRKELSNYCHQKGMVIQAYSPLTRARRLQDPELVKLVEDSYPEQTS 225
             +  ++ L +P +    + + C++ G+ I  YSPL R                     +
Sbjct: 180 CCVEVEFSLYHPEILTNGIVDACNELGIPIVCYSPLCRGL------------------LT 221

Query: 226 AQILVNWSLQMG-FVPLVKTVHEDRLKENIKSCDF 259
             I     L+ G F  ++K    + LK N+K  DF
Sbjct: 222 GAITSPEDLKAGDFKSMLKKFKGEALKHNLKLVDF 256

>YPL088W Chr16 (381965..382993) [1029 bp, 342 aa] {ON} Putative aryl
           alcohol dehydrogenase; transcription is activated by
           paralogous transcription factors Yrm1p and Yrr1p along
           with genes involved in multidrug resistance
          Length = 342

 Score = 30.8 bits (68), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 66/298 (22%), Positives = 101/298 (33%), Gaps = 62/298 (20%)

Query: 29  KEETTNIVHNALKLGYRQVDSAQLYGNEREACLGITKFLEESPKVSRSDIFFTTKI---- 84
           K +   I+ +    G R  D+A  Y N     + I +FLE    + R  +   TKI    
Sbjct: 39  KTQIFKIMKHCYDKGLRTFDTADFYSNGLSERI-IKEFLEYY-SIKRETVVIMTKIYFPV 96

Query: 85  ------------------KTQDQGYESAKKSIEESLNRVKELD-YIDLFLIHAPLTNKEK 125
                                +Q   S K  I    N VK L  YIDL  IH  L ++  
Sbjct: 97  DETLDLHHNFTLNEFEELDLSNQRGLSRKHIIAGVENSVKRLGTYIDLLQIHR-LDHETP 155

Query: 126 RLGTWKAFQEYYETGKIKAIGVSNYGIQHLEEM------YQWDGLKIDPMVNQYELNPWL 179
                KA  +  E G ++ IG S+       E+      Y W   +     + Y L    
Sbjct: 156 MKEIMKALNDVVEAGHVRYIGASSMLATEFAELQFTADKYGW--FQFISSQSYYNLLYRE 213

Query: 180 TRKELSNYCHQKGMVIQAYSPLTRA-----------RRLQDPELVKLVEDSYPEQ----- 223
             +EL  +  +  + +  +SP  R            R   DP    L  D+  E+     
Sbjct: 214 DERELIPFAKRHNIGLLPWSPNARGMLTRPLNQSTDRIKSDPTFKSLHLDNLEEEQKEII 273

Query: 224 ------------TSAQILVNWSLQMGFVPLVKTVHEDRLKENIKSCDFELSSADLKKL 269
                       + A + + W L  G  P+V      R+ E I +    L+  ++K L
Sbjct: 274 NRVEKVSKDKKVSMAMLSIAWVLHKGCHPIVGLNTTARVDEAIAALQVTLTEEEIKYL 331

>Kwal_33.13275 s33 (152348..152551) [204 bp, 67 aa] {OFF} [contig
           119] FULL
          Length = 67

 Score = 28.5 bits (62), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 34/69 (49%), Gaps = 14/69 (20%)

Query: 232 WSLQMGFVPLVKTVHEDRLKENIKSCDFELSSADLKKLTHDDQYY--LSQPK------W- 282
           WS   GFV LVK+ + +R+++N+       S  D  K+  D+Q +  L +P       W 
Sbjct: 2   WSFLQGFVVLVKSSNPERIRQNLAVLP---SKDDSWKVKIDEQLWKPLDKPDAQDVTTWG 58

Query: 283 --DPIKYEG 289
             DP  YEG
Sbjct: 59  QKDPTIYEG 67

>NCAS0I02160 Chr9 (407406..408440) [1035 bp, 344 aa] {ON} 
          Length = 344

 Score = 30.4 bits (67), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 69/313 (22%), Positives = 120/313 (38%), Gaps = 71/313 (22%)

Query: 29  KEETTNIVHNALKLGYRQVDSAQLYGNE-REACLGITKFLEESPKVSRSDIFFTTKI--- 84
           KEE   I+      G R  D+A +Y N   E  LG  +FL+   K+ R  +   TK+   
Sbjct: 39  KEEIFKILKYCYDRGLRTYDTADVYSNGLSERLLG--EFLKRY-KIKRETVVIFTKVFCP 95

Query: 85  ---------------------KTQDQGYESAKKSIEESLNRVKELD-YIDLFLIHAPLTN 122
                                   +Q   S K  +    N V+ L  Y+D+  IH  L +
Sbjct: 96  VDETLPLTHGRQAIYDESVNLDLTNQKGLSRKHIVAGVANSVERLGTYVDVLQIHR-LDH 154

Query: 123 KEKRLGTWKAFQEYYETGKIKAIGVSNYG------IQHLEEMYQWDGLKIDPMVNQYELN 176
           +       ++  +   +G+++ IG S+        +Q + E   W   K     + Y L 
Sbjct: 155 ETSMEEIMRSLNDVILSGQVRYIGASSMRATEFAELQFIAEKNGW--FKFVSSQSYYNLL 212

Query: 177 PWLTRKELSNYCHQKGMVIQAYSP-----LTRARRLQDP--------------------- 210
                +EL  +  + G+ +  +SP     LTR      P                     
Sbjct: 213 NREDERELIPFAKKHGIGLVPWSPNARGILTRPLDESTPTGRSDNIVKKLHLNALMEDEK 272

Query: 211 ELVKLVEDSYPEQTSAQILVN--WSLQMGFVPLVKTVHEDRLKENIKSCDFELSSADLKK 268
           E+VK V+    +++ +  +V+  WS++ G  P+V      R  E I + D  L+    ++
Sbjct: 273 EIVKRVQKIAQKKSVSMAMVSIAWSIKKGCNPIVGLSSISRAAEAIGALDVHLTE---EE 329

Query: 269 LTHDDQYYLSQPK 281
           +T+ ++ Y  QPK
Sbjct: 330 VTYLEETY--QPK 340

>Skud_16.195 Chr16 (353315..354343) [1029 bp, 342 aa] {ON} YPL088W
           (REAL)
          Length = 342

 Score = 30.4 bits (67), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 68/298 (22%), Positives = 103/298 (34%), Gaps = 62/298 (20%)

Query: 29  KEETTNIVHNALKLGYRQVDSAQLYGNEREACLGITKFLEESPKVSRSDIFFTTKI---- 84
           K E   I+ +    G R  D+A  Y N     + I +FLE    + R  +   TKI    
Sbjct: 39  KAEIFKILKHCYDNGLRTYDTADFYSNGLSERI-IKEFLEHY-NIKRETVVIMTKIFFPV 96

Query: 85  ------------------KTQDQGYESAKKSIEESLNRVKELD-YIDLFLIHAPLTNKEK 125
                             +  +Q   S K  I    N V+ L  YIDL  IH  L  +  
Sbjct: 97  DEKLVLHHKLTLDEIEELELSNQRGLSRKHIIAGVKNSVERLGTYIDLLQIHR-LDQETP 155

Query: 126 RLGTWKAFQEYYETGKIKAIGVSNY------GIQHLEEMYQWDGLKIDPMVNQYELNPWL 179
                +A  +  E G ++ IG S+        +Q + + Y W   +     + Y L    
Sbjct: 156 MREIMRALNDVVEAGHVRYIGASSMLATEFAELQFIADKYGW--FQFISSQSYYNLLHRE 213

Query: 180 TRKELSNYC--HQKGMV---IQAYSPLTR------ARRLQDPELVKLVEDSYPEQ----- 223
             +EL  +   H  G++     A   LTR       R   DP    L  D+  E      
Sbjct: 214 DERELIPFAKRHNIGLLPWSSNARGLLTRPLGQNTERMRSDPTFKSLQLDTLEEDQMEII 273

Query: 224 ------------TSAQILVNWSLQMGFVPLVKTVHEDRLKENIKSCDFELSSADLKKL 269
                       + A I + W L  G  P+V      R+ E I +    L+  +++ L
Sbjct: 274 NRVEKISKDKNVSMAMISIAWVLHKGCHPIVGLSSTSRVDEAIAALHVTLTEKEIEYL 331

>ZYRO0F04840g Chr6 (406288..407427) [1140 bp, 379 aa] {ON} highly
           similar to uniprot|Q02895 Saccharomyces cerevisiae
           YPL088W Putative aryl alcohol dehydrogenase
           transcription is activated by paralogous transcription
           factors Yrm1p and Yrr1p along with genes involved in
           multidrug resistance
          Length = 379

 Score = 30.4 bits (67), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 67/307 (21%), Positives = 114/307 (37%), Gaps = 66/307 (21%)

Query: 29  KEETTNIVHNALKLGYRQVDSAQLYGN----------------EREACLGITKFL---EE 69
           KEE   I+  A   G R  D+A +Y N                 RE  + +TK     +E
Sbjct: 76  KEEVFKILKRAYDRGLRTYDTADVYSNGLSERILGEFLRHYNINRETVVILTKVFFPTDE 135

Query: 70  SPKVSRSDIFFTTKIKTQDQGYESAKKSI----EESLNRVKELDYIDLFLIHAPLTNKEK 125
           S  V+    F   ++ T       ++K I    + S+ R+    YID+  IH  L ++  
Sbjct: 136 SIHVTSKFDFSEQELLTLTNQRGLSRKHILAGVKASIERLG--TYIDVLQIHR-LDHETP 192

Query: 126 RLGTWKAFQEYYETGKIKAIGVSNYGIQHLEEMY----QWDGLKIDPMVNQYELNPWLTR 181
                +A  +    G ++ IG S+       E+     + D  K     + Y L      
Sbjct: 193 MEEIMRALNDVVTQGDVRYIGASSMLATEFAELNFIAERHDWFKFVSSQSYYSLLYREDE 252

Query: 182 KELSNYCHQKGMVIQAYSPLT----------RARRLQ----------------DPELVKL 215
           +EL  +  + G+ +  +SPL+           + R Q                + E+V  
Sbjct: 253 RELIPFAKRHGIALIPWSPLSGGALTRPLGGTSNRSQTDNFKGILGVDNLKDNEKEIVNR 312

Query: 216 VEDSYPE--QTSAQILVNWSLQMGFVPLVKTVHEDRLKENIKSCDFELSSADLKKLTHDD 273
           +E    E  Q+ A +   W L  G  P++          +IK  D  L + ++ KL+  +
Sbjct: 313 LEKVANEKGQSMAAVATAWVLHKGCNPIIGF-------NSIKRVDQALDALEV-KLSEQE 364

Query: 274 QYYLSQP 280
             YL +P
Sbjct: 365 ISYLEEP 371

>Suva_2.267 Chr2 complement(463458..465476) [2019 bp, 672 aa] {ON}
           YDR107C (REAL)
          Length = 672

 Score = 30.4 bits (67), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 20/81 (24%), Positives = 38/81 (46%), Gaps = 10/81 (12%)

Query: 196 QAYSPLTRARRLQDPELVKLVEDSYPEQTSAQILVNWSLQMGF--------VPLVKTVHE 247
           + Y+   + + L+D E V L + + P + +    +N  ++ GF        +P  + V++
Sbjct: 99  RIYNSPFQLKMLEDKECVALCKSTIPGKDAK--FINTLIKNGFFQNWLVDGLPAARNVYD 156

Query: 248 DRLKENIKSCDFELSSADLKK 268
            R K N     FEL   D+K+
Sbjct: 157 SRTKTNYYGTGFELGFTDVKQ 177

>TPHA0J01520 Chr10 complement(349327..350433) [1107 bp, 368 aa] {ON}
           Anc_5.684 YKR087C
          Length = 368

 Score = 30.0 bits (66), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 16/61 (26%), Positives = 28/61 (45%), Gaps = 6/61 (9%)

Query: 107 ELDYIDLFLIHAPLTNKEKRLGTWKAFQEYYETGKIKAIGVSNYGIQH------LEEMYQ 160
           E DYI L L+     N E+ +  W  F E+    ++K+  ++ +   H      +E M +
Sbjct: 265 EADYIGLMLMSRACFNPEEAVNLWARFSEFERRHRLKSNEITEFLSTHPASERRIENMQK 324

Query: 161 W 161
           W
Sbjct: 325 W 325

>TDEL0C06010 Chr3 complement(1082207..1083241) [1035 bp, 344 aa]
           {ON} 
          Length = 344

 Score = 29.6 bits (65), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 69/313 (22%), Positives = 119/313 (38%), Gaps = 67/313 (21%)

Query: 29  KEETTNIVHNALKLGYRQVDSAQLYGN----------------EREACLGITKF---LEE 69
           KE+  +I+ +    G R  D+A +Y N                +RE  + +TK    ++E
Sbjct: 42  KEKIFSILKHCYDHGLRTFDTADVYSNGASGRLVGEFLKKYNIDRETVVILTKLFYPVDE 101

Query: 70  SPKVSRSDIFFTT-KIKTQDQGYESAKKSIEESLNRVKELD-YIDLFLIHAPLTNKEKRL 127
           S  +     F    K++       S K  I  +   ++ L  YID+  IH    ++    
Sbjct: 102 SLDLKHGGTFDEEEKLQLTHHRGLSRKHIIAGAKASMERLGTYIDVLQIHR-FDDETPME 160

Query: 128 GTWKAFQEYYETGKIKAIGVSNYG------IQHLEEMYQWDGLKIDPMVNQYELNPWLTR 181
            T +A     + G  + IG S         +Q + E + W   K     + Y L      
Sbjct: 161 ETMRALNYVVDQGFTRYIGASTMRATEFAEMQFIAEKHGW--YKFISSQSSYNLLYREDE 218

Query: 182 KELSNYCHQKGMVIQAYSP-----LTR---------------------ARRLQDPELVKL 215
           +EL  +  + G+ +  +SP     LTR                     A R    E+V  
Sbjct: 219 RELIPFAQRHGVGLIPWSPNARGVLTRPSNQTSERIKSDPTYSRLGWNALRANQKEIVDR 278

Query: 216 VEDSYPEQ--TSAQILVNWSLQMGFVPLVKTVHEDRLKENIKSCDFELSSADLKKLTHDD 273
           VE+    +  + A I + W L  G  P+V     +R+ E +++ D         +LT ++
Sbjct: 279 VEEIAKTKGVSMAVISIAWVLSKGAYPIVGLNSIERVNEALQALDV--------RLTDEE 330

Query: 274 QYYLSQPKWDPIK 286
             YL + K+ P+K
Sbjct: 331 TTYLEE-KYLPVK 342

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.134    0.397 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 31,545,171
Number of extensions: 1351883
Number of successful extensions: 4788
Number of sequences better than 10.0: 192
Number of HSP's gapped: 4560
Number of HSP's successfully gapped: 207
Length of query: 289
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 181
Effective length of database: 41,097,471
Effective search space: 7438642251
Effective search space used: 7438642251
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 65 (29.6 bits)