Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0F02508g3.500ON1401407102e-97
KLTH0G02354g3.500ON1401405271e-69
NCAS0F035903.500ON1401334811e-62
KLLA0E03895g3.500ON1401404741e-61
TDEL0D056803.500ON1401404723e-61
YPR153W3.500ON1401404637e-60
Skud_16.4473.500ON1401404472e-57
Smik_16.4053.500ON1391394411e-56
Suva_16.4813.500ON1391394411e-56
TBLA0C045203.500ON1401384351e-55
CAGL0L08382g3.500ON1401404342e-55
TPHA0A057103.500ON1411354221e-53
Kpol_480.93.500ON1411394193e-53
KNAG0A079803.500ON1471404047e-51
ZYRO0D09724g3.500ON1391283933e-49
KAFR0G037303.500ON1441323371e-40
AFR319W3.500ON1411333319e-40
Kwal_47.189033.500ON113451602e-14
Skud_19.5singletonON23644740.16
TDEL0D042103.201ON42853618.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0F02508g
         (140 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0F02508g Chr6 complement(217712..217835,217912..218205,21827...   278   2e-97
KLTH0G02354g Chr7 complement(185220..185343,185400..185693,18576...   207   1e-69
NCAS0F03590 Chr6 (713500..713922) [423 bp, 140 aa] {ON} Anc_3.50...   189   1e-62
KLLA0E03895g Chr5 complement(355734..356151,356230..356234) [423...   187   1e-61
TDEL0D05680 Chr4 (1021413..1021417,1021479..1021896) [423 bp, 14...   186   3e-61
YPR153W Chr16 (833689..833693,833828..834245) [423 bp, 140 aa] {...   182   7e-60
Skud_16.447 Chr16 (787264..787268,787400..787817) [423 bp, 140 a...   176   2e-57
Smik_16.405 Chr16 (705749..706165) [417 bp, 139 aa] {ON} YPR153W...   174   1e-56
Suva_16.481 Chr16 (830176..830592) [417 bp, 139 aa] {ON} YPR153W...   174   1e-56
TBLA0C04520 Chr3 (1096418..1096840) [423 bp, 140 aa] {ON} Anc_3....   172   1e-55
CAGL0L08382g Chr12 complement(924096..924518) [423 bp, 140 aa] {...   171   2e-55
TPHA0A05710 Chr1 (1292410..1292835) [426 bp, 141 aa] {ON} Anc_3....   167   1e-53
Kpol_480.9 s480 complement(19229..19649,19756..19760) [426 bp, 1...   166   3e-53
KNAG0A07980 Chr1 (1272179..1272204,1272292..1272709) [444 bp, 14...   160   7e-51
ZYRO0D09724g Chr4 complement(825339..825758) [420 bp, 139 aa] {O...   155   3e-49
KAFR0G03730 Chr7 (766728..766738,766802..767225) [435 bp, 144 aa...   134   1e-40
AFR319W Chr6 (1013960..1014261,1014335..1014458) [426 bp, 141 aa...   132   9e-40
Kwal_47.18903 s47 (1020956..1021297) [342 bp, 113 aa] {ON} YPR15...    66   2e-14
Skud_19.5 Chr19 (3036..3746) [711 bp, 236 aa] {ON} YHL044W (REAL)      33   0.16 
TDEL0D04210 Chr4 complement(772040..773326) [1287 bp, 428 aa] {O...    28   8.7  

>SAKL0F02508g Chr6
           complement(217712..217835,217912..218205,218273..218277)
           [423 bp, 140 aa] {ON} similar to uniprot|Q06HN0
           Saccharomyces cerevisiae YPR153W Hypothetical ORF
          Length = 140

 Score =  278 bits (710), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 140/140 (100%), Positives = 140/140 (100%)

Query: 1   MKSFVTTGDVPLGYVTPSFPSLYWPLNNEKFSLSYLYYTSDIWRFTVYWTLILFAGFYGS 60
           MKSFVTTGDVPLGYVTPSFPSLYWPLNNEKFSLSYLYYTSDIWRFTVYWTLILFAGFYGS
Sbjct: 1   MKSFVTTGDVPLGYVTPSFPSLYWPLNNEKFSLSYLYYTSDIWRFTVYWTLILFAGFYGS 60

Query: 61  AGLIASYSHRKTAGGIWIMFFYLVAGGIQAIASGTVVGLLIAVIYKAGLFAMSTWVPLSC 120
           AGLIASYSHRKTAGGIWIMFFYLVAGGIQAIASGTVVGLLIAVIYKAGLFAMSTWVPLSC
Sbjct: 61  AGLIASYSHRKTAGGIWIMFFYLVAGGIQAIASGTVVGLLIAVIYKAGLFAMSTWVPLSC 120

Query: 121 ALMQILFNVSTSYLMAGVII 140
           ALMQILFNVSTSYLMAGVII
Sbjct: 121 ALMQILFNVSTSYLMAGVII 140

>KLTH0G02354g Chr7
           complement(185220..185343,185400..185693,185765..185769)
           [423 bp, 140 aa] {ON} similar to uniprot|Q06HN0
           Saccharomyces cerevisiae YPR153W Hypothetical ORF
          Length = 140

 Score =  207 bits (527), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 97/140 (69%), Positives = 121/140 (86%)

Query: 1   MKSFVTTGDVPLGYVTPSFPSLYWPLNNEKFSLSYLYYTSDIWRFTVYWTLILFAGFYGS 60
           MKSFVT GDVP+GY TP FPSL+WP+NN++++LSYLYYT+DIW+FTV+WTLILF GFY +
Sbjct: 1   MKSFVTIGDVPIGYTTPKFPSLFWPINNKRYTLSYLYYTNDIWKFTVFWTLILFMGFYTA 60

Query: 61  AGLIASYSHRKTAGGIWIMFFYLVAGGIQAIASGTVVGLLIAVIYKAGLFAMSTWVPLSC 120
           AGL AS SHRK A G+WIM FY++ GG QA+A+GTV GL++AV YKAGLF MSTW+PL  
Sbjct: 61  AGLWASISHRKKASGLWIMAFYILVGGFQALAAGTVTGLILAVTYKAGLFEMSTWIPLCS 120

Query: 121 ALMQILFNVSTSYLMAGVII 140
           A++ ILF+VST+Y MAG+II
Sbjct: 121 AVVLILFHVSTTYSMAGIII 140

>NCAS0F03590 Chr6 (713500..713922) [423 bp, 140 aa] {ON} Anc_3.500
           YPR153W
          Length = 140

 Score =  189 bits (481), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 83/133 (62%), Positives = 108/133 (81%)

Query: 1   MKSFVTTGDVPLGYVTPSFPSLYWPLNNEKFSLSYLYYTSDIWRFTVYWTLILFAGFYGS 60
           M+SF+T  D+P+GY+TP FPSLYWP+NN+K+ +++LY  SDIW+FT+YWTLI  A FYG+
Sbjct: 1   MRSFITNNDIPIGYITPKFPSLYWPINNKKYDITFLYNISDIWKFTLYWTLIFNAAFYGA 60

Query: 61  AGLIASYSHRKTAGGIWIMFFYLVAGGIQAIASGTVVGLLIAVIYKAGLFAMSTWVPLSC 120
           AGL+AS+SHR+T GGIWIM  YL   G+Q +A GT++G LI  IY AGLFAMSTW+PL C
Sbjct: 61  AGLLASFSHRRTGGGIWIMVIYLTFAGVQGLAMGTIMGFLIGAIYGAGLFAMSTWIPLCC 120

Query: 121 ALMQILFNVSTSY 133
           A+ QILF+V  +Y
Sbjct: 121 AVAQILFDVIMAY 133

>KLLA0E03895g Chr5 complement(355734..356151,356230..356234) [423
           bp, 140 aa] {ON} similar to uniprot|Q06HN0 Saccharomyces
           cerevisiae YPR153W Hypothetical ORF
          Length = 140

 Score =  187 bits (474), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 90/140 (64%), Positives = 110/140 (78%)

Query: 1   MKSFVTTGDVPLGYVTPSFPSLYWPLNNEKFSLSYLYYTSDIWRFTVYWTLILFAGFYGS 60
           MK+F  TGDVP+GY  P FPSLYWP+NN KFS++YLYY  DIWRFT++WT+ILFA  YG+
Sbjct: 1   MKTFFITGDVPVGYQVPDFPSLYWPMNNGKFSVAYLYYLPDIWRFTIFWTMILFAIVYGT 60

Query: 61  AGLIASYSHRKTAGGIWIMFFYLVAGGIQAIASGTVVGLLIAVIYKAGLFAMSTWVPLSC 120
            G IA  +H+K   G W++  Y++ G  QA  SGTVVG+LIA+IYKAGLFAMSTW+PL C
Sbjct: 61  TGAIAWTTHKKILFGFWMIPLYIMIGMAQAFVSGTVVGILIAIIYKAGLFAMSTWIPLCC 120

Query: 121 ALMQILFNVSTSYLMAGVII 140
           A++QILFNVSTSY M   II
Sbjct: 121 AVVQILFNVSTSYSMTSPII 140

>TDEL0D05680 Chr4 (1021413..1021417,1021479..1021896) [423 bp, 140
           aa] {ON} Anc_3.500 YPR153W
          Length = 140

 Score =  186 bits (472), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 89/140 (63%), Positives = 111/140 (79%)

Query: 1   MKSFVTTGDVPLGYVTPSFPSLYWPLNNEKFSLSYLYYTSDIWRFTVYWTLILFAGFYGS 60
           M+SF+T  DVP+GYVTPSFPSL+WP++N KFSL+ LY    IW+FT+YW+LI    FYG 
Sbjct: 1   MRSFITNNDVPIGYVTPSFPSLHWPISNGKFSLAVLYDVVVIWKFTLYWSLIFNGAFYGI 60

Query: 61  AGLIASYSHRKTAGGIWIMFFYLVAGGIQAIASGTVVGLLIAVIYKAGLFAMSTWVPLSC 120
           AGL ASYSHR+ AGG+WIM  YLV GGIQA+A+GTV+G LI  IY AGLF+MSTW+P  C
Sbjct: 61  AGLWASYSHRRRAGGLWIMAIYLVYGGIQAVAAGTVIGFLIGSIYSAGLFSMSTWIPPCC 120

Query: 121 ALMQILFNVSTSYLMAGVII 140
            ++QILF+ S SYL +G I+
Sbjct: 121 VIVQILFDFSVSYLSSGTIM 140

>YPR153W Chr16 (833689..833693,833828..834245) [423 bp, 140 aa] {ON}
           Putative protein of unknown function
          Length = 140

 Score =  182 bits (463), Expect = 7e-60,   Method: Compositional matrix adjust.
 Identities = 81/140 (57%), Positives = 110/140 (78%)

Query: 1   MKSFVTTGDVPLGYVTPSFPSLYWPLNNEKFSLSYLYYTSDIWRFTVYWTLILFAGFYGS 60
           M+SFVT  D+P+GYVTP FPSLYWP+NN K++ ++LYY SDIW+F++YWTLI    FY +
Sbjct: 1   MRSFVTNNDIPVGYVTPKFPSLYWPINNSKYNTAFLYYISDIWKFSLYWTLIFNGAFYVT 60

Query: 61  AGLIASYSHRKTAGGIWIMFFYLVAGGIQAIASGTVVGLLIAVIYKAGLFAMSTWVPLSC 120
           AG+ AS +HRK AG +WI   Y++ GG+Q + +GTV+G LI  IY++GLF+MSTWVPL C
Sbjct: 61  AGVYASLTHRKKAGSVWIFVMYVLYGGVQGLTTGTVMGFLIGAIYRSGLFSMSTWVPLCC 120

Query: 121 ALMQILFNVSTSYLMAGVII 140
           A++QILF+V  SY M G ++
Sbjct: 121 AVVQILFDVVLSYSMVGSVM 140

>Skud_16.447 Chr16 (787264..787268,787400..787817) [423 bp, 140 aa]
           {ON} YPR153W (REAL)
          Length = 140

 Score =  176 bits (447), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 77/140 (55%), Positives = 108/140 (77%)

Query: 1   MKSFVTTGDVPLGYVTPSFPSLYWPLNNEKFSLSYLYYTSDIWRFTVYWTLILFAGFYGS 60
           M+SFVT  D+P+GYVTP FPSLYWP+N+ ++++++LYY SDIW+F++YWTLI    FY +
Sbjct: 1   MRSFVTNNDIPVGYVTPKFPSLYWPINSSRYNIAFLYYISDIWKFSLYWTLIFNGAFYVT 60

Query: 61  AGLIASYSHRKTAGGIWIMFFYLVAGGIQAIASGTVVGLLIAVIYKAGLFAMSTWVPLSC 120
            GL AS +HRK  G IWI   Y++ GG+Q + +GTV+G LI  IY++GLF+MSTW+PL C
Sbjct: 61  TGLYASLTHRKKGGSIWIFVMYVIYGGVQGLTTGTVMGFLIGAIYRSGLFSMSTWIPLCC 120

Query: 121 ALMQILFNVSTSYLMAGVII 140
           A++QILF+V   Y M G ++
Sbjct: 121 AVVQILFDVILGYSMIGSVM 140

>Smik_16.405 Chr16 (705749..706165) [417 bp, 139 aa] {ON} YPR153W
           (REAL)
          Length = 139

 Score =  174 bits (441), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 77/139 (55%), Positives = 106/139 (76%)

Query: 2   KSFVTTGDVPLGYVTPSFPSLYWPLNNEKFSLSYLYYTSDIWRFTVYWTLILFAGFYGSA 61
           +SFVT  D+P+GYVTP FPSLYWP+NN +++ ++LYY SDIW+F++YWTLI    FY   
Sbjct: 1   RSFVTNNDIPVGYVTPKFPSLYWPINNPRYNTAFLYYISDIWKFSLYWTLIFNGAFYIVT 60

Query: 62  GLIASYSHRKTAGGIWIMFFYLVAGGIQAIASGTVVGLLIAVIYKAGLFAMSTWVPLSCA 121
           GL AS +HRK AG +WI   Y++ GG+Q + +GTV+G LI  IY++GLF+MSTW+PL CA
Sbjct: 61  GLYASLTHRKKAGSLWIFSMYVIYGGVQGLTTGTVMGFLIGAIYRSGLFSMSTWIPLCCA 120

Query: 122 LMQILFNVSTSYLMAGVII 140
           ++QILF+V   Y M G ++
Sbjct: 121 VVQILFDVVLGYSMVGSVM 139

>Suva_16.481 Chr16 (830176..830592) [417 bp, 139 aa] {ON} YPR153W
           (REAL)
          Length = 139

 Score =  174 bits (441), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 76/139 (54%), Positives = 107/139 (76%)

Query: 2   KSFVTTGDVPLGYVTPSFPSLYWPLNNEKFSLSYLYYTSDIWRFTVYWTLILFAGFYGSA 61
           +SF+T  D+P+GY+TP FPSLYWP+N+ +++ ++LYY SDIW+F++YWTLI    FY +A
Sbjct: 1   RSFITNNDIPVGYITPKFPSLYWPINSSRYNTAFLYYISDIWKFSLYWTLIFNGAFYVAA 60

Query: 62  GLIASYSHRKTAGGIWIMFFYLVAGGIQAIASGTVVGLLIAVIYKAGLFAMSTWVPLSCA 121
           GL AS +HRK AG IWI   Y+  GG+Q + +GT++G LI  IY++GLF+MSTW+PL CA
Sbjct: 61  GLYASLTHRKKAGSIWIFVMYVAFGGVQGLTAGTIMGFLIGAIYRSGLFSMSTWIPLCCA 120

Query: 122 LMQILFNVSTSYLMAGVII 140
           ++QILF+V   Y M G I+
Sbjct: 121 VVQILFDVVLGYSMIGSIM 139

>TBLA0C04520 Chr3 (1096418..1096840) [423 bp, 140 aa] {ON} Anc_3.500
           YPR153W
          Length = 140

 Score =  172 bits (435), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 74/138 (53%), Positives = 104/138 (75%)

Query: 1   MKSFVTTGDVPLGYVTPSFPSLYWPLNNEKFSLSYLYYTSDIWRFTVYWTLILFAGFYGS 60
           MKSF+T  D+P+GYVTP FPSLYWP+NN+K++ S+LY T+DIW+F++YW +IL   FYG 
Sbjct: 1   MKSFITNNDIPVGYVTPPFPSLYWPINNQKYNTSFLYDTTDIWKFSIYWCVILNECFYGV 60

Query: 61  AGLIASYSHRKTAGGIWIMFFYLVAGGIQAIASGTVVGLLIAVIYKAGLFAMSTWVPLSC 120
            G IA  SHR   G IWI+F YL  G +Q + +GT++G +I+ IY +GLF MSTW+P  C
Sbjct: 61  TGTIAGVSHRGKIGCIWIIFIYLFCGAVQGMVAGTIMGYMISAIYTSGLFEMSTWIPFCC 120

Query: 121 ALMQILFNVSTSYLMAGV 138
           A++QILF+V  S+ ++ +
Sbjct: 121 AVVQILFDVVQSFPISNL 138

>CAGL0L08382g Chr12 complement(924096..924518) [423 bp, 140 aa] {ON}
           highly similar to uniprot|Q06537 Saccharomyces
           cerevisiae YPR153w
          Length = 140

 Score =  171 bits (434), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 77/140 (55%), Positives = 105/140 (75%)

Query: 1   MKSFVTTGDVPLGYVTPSFPSLYWPLNNEKFSLSYLYYTSDIWRFTVYWTLILFAGFYGS 60
           MKSF+T+ DVP+GY TPSFPSLYWP+N+ ++  ++LY+  DIW+FT+YWT I    FYG 
Sbjct: 1   MKSFITSTDVPIGYKTPSFPSLYWPINDRRYDTAFLYFIEDIWKFTLYWTFIFNGAFYGG 60

Query: 61  AGLIASYSHRKTAGGIWIMFFYLVAGGIQAIASGTVVGLLIAVIYKAGLFAMSTWVPLSC 120
           AGL AS +H K  GG+WI   Y++  G+Q +  GTV+G LI  IY++GLF+MSTWVP+ C
Sbjct: 61  AGLYASLTHWKRGGGLWIFGIYMLYAGVQGMIIGTVMGFLIGAIYRSGLFSMSTWVPMCC 120

Query: 121 ALMQILFNVSTSYLMAGVII 140
           A++QIL +V+ SY M G I+
Sbjct: 121 AVVQILLDVTMSYSMVGSIM 140

>TPHA0A05710 Chr1 (1292410..1292835) [426 bp, 141 aa] {ON} Anc_3.500
           YPR153W
          Length = 141

 Score =  167 bits (422), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 76/135 (56%), Positives = 103/135 (76%)

Query: 3   SFVTTGDVPLGYVTPSFPSLYWPLNNEKFSLSYLYYTSDIWRFTVYWTLILFAGFYGSAG 62
           +F+T+ D+P+GYVTPSFPSLYWP+NN K++ +YLY +  IW FTVYW+LIL   FYG AG
Sbjct: 4   NFLTSNDMPVGYVTPSFPSLYWPINNSKYNTAYLYDSYTIWLFTVYWSLILNGFFYGVAG 63

Query: 63  LIASYSHRKTAGGIWIMFFYLVAGGIQAIASGTVVGLLIAVIYKAGLFAMSTWVPLSCAL 122
            +A ++HRK  GG WI+  YLV GG+Q I  GT++G +I+  Y + LF+MSTW+PL CA+
Sbjct: 64  ALACFTHRKKGGGFWILAIYLVLGGVQGIVLGTIIGYIISATYLSALFSMSTWIPLCCAV 123

Query: 123 MQILFNVSTSYLMAG 137
            Q+LF V+TSY + G
Sbjct: 124 AQVLFEVTTSYSLVG 138

>Kpol_480.9 s480 complement(19229..19649,19756..19760) [426 bp, 141
           aa] {ON} complement(19229..19649,19756..19760) [426 nt,
           142 aa]
          Length = 141

 Score =  166 bits (419), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 75/139 (53%), Positives = 106/139 (76%)

Query: 2   KSFVTTGDVPLGYVTPSFPSLYWPLNNEKFSLSYLYYTSDIWRFTVYWTLILFAGFYGSA 61
            SF+T+ D+P+GY  P FPSLYWP++++K+ +SYLY T  IW FTVYW++IL  GFY  +
Sbjct: 3   SSFLTSEDIPVGYHKPPFPSLYWPISSKKYHVSYLYDTKTIWEFTVYWSVILNGGFYLIS 62

Query: 62  GLIASYSHRKTAGGIWIMFFYLVAGGIQAIASGTVVGLLIAVIYKAGLFAMSTWVPLSCA 121
           GL+ASY+HRK AGG+WIM  YL  G  Q +  GTV G L++ IY +GLFAMSTW+PL CA
Sbjct: 63  GLMASYTHRKRAGGLWIMVIYLFIGCAQGVVFGTVTGYLVSQIYISGLFAMSTWIPLCCA 122

Query: 122 LMQILFNVSTSYLMAGVII 140
           + Q+LF++ +S+ + G+++
Sbjct: 123 ITQVLFDLCSSFSLGGMVM 141

>KNAG0A07980 Chr1 (1272179..1272204,1272292..1272709) [444 bp, 147
           aa] {ON} Anc_3.500 YPR153W
          Length = 147

 Score =  160 bits (404), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 73/140 (52%), Positives = 101/140 (72%)

Query: 1   MKSFVTTGDVPLGYVTPSFPSLYWPLNNEKFSLSYLYYTSDIWRFTVYWTLILFAGFYGS 60
           +++FV   ++P+GY TPSFPSLYWP++NE +SL++LY   DIW+FT+YW LIL   FYG+
Sbjct: 8   LRTFVANNEIPVGYHTPSFPSLYWPISNESYSLAFLYNIEDIWKFTMYWCLILNGAFYGT 67

Query: 61  AGLIASYSHRKTAGGIWIMFFYLVAGGIQAIASGTVVGLLIAVIYKAGLFAMSTWVPLSC 120
           +GL+A+ SH K    I I+  YL+  GIQ +  G + GLL+  IY+AGLF MSTW+PL C
Sbjct: 68  SGLVATISHWKNPHAILIVGLYLLYAGIQGVVIGIIAGLLLGAIYRAGLFTMSTWIPLCC 127

Query: 121 ALMQILFNVSTSYLMAGVII 140
           A+ QILF+V  SY   G ++
Sbjct: 128 AVAQILFDVVMSYSHVGSLL 147

>ZYRO0D09724g Chr4 complement(825339..825758) [420 bp, 139 aa] {ON}
           similar to uniprot|Q06HN0 Saccharomyces cerevisiae
           YPR153W Hypothetical ORF
          Length = 139

 Score =  155 bits (393), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 73/128 (57%), Positives = 93/128 (72%), Gaps = 1/128 (0%)

Query: 1   MKSFVTTGDVPLGYVTPSFPSLYWPLNNEKFSLSYLYYTSDIWRFTVYWTLILFAGFYGS 60
           M+SF+TT DVP+GY TPSFPSLYWP    + SL  +Y  S IW+FT+YW+LI   GFY  
Sbjct: 1   MRSFITTNDVPVGYETPSFPSLYWP-TESRTSLHVIYDVSAIWKFTLYWSLIFNFGFYAL 59

Query: 61  AGLIASYSHRKTAGGIWIMFFYLVAGGIQAIASGTVVGLLIAVIYKAGLFAMSTWVPLSC 120
            GL AS+SHRK AGG+WIM  Y   GG+Q +A GT+ G LI  IY +GLF+MSTW+P  C
Sbjct: 60  TGLWASFSHRKQAGGLWIMALYCTYGGVQGVAVGTITGFLIGNIYSSGLFSMSTWIPFCC 119

Query: 121 ALMQILFN 128
           A+ Q+L++
Sbjct: 120 AVAQVLYD 127

>KAFR0G03730 Chr7 (766728..766738,766802..767225) [435 bp, 144 aa]
           {ON} Anc_3.500 YPR153W Intron coordinates are guessed,
           not conserved begining when aligned with the rest of the
           pillar proteins.
          Length = 144

 Score =  134 bits (337), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 64/132 (48%), Positives = 89/132 (67%), Gaps = 1/132 (0%)

Query: 10  VPLGYVTPSFPSLYWPLN-NEKFSLSYLYYTSDIWRFTVYWTLILFAGFYGSAGLIASYS 68
           VP+GY+TP FPSLYWP+  +E F  ++LY   DIW+FT+YW+LI    FY SAG +A  +
Sbjct: 13  VPIGYITPKFPSLYWPIGFDESFDNAFLYSVVDIWKFTLYWSLIFNGAFYVSAGAVACLT 72

Query: 69  HRKTAGGIWIMFFYLVAGGIQAIASGTVVGLLIAVIYKAGLFAMSTWVPLSCALMQILFN 128
            +K +  + I   Y V GG+Q +  GTV+G L+  IY+AGLF MS W+P+ CA+ QIL++
Sbjct: 73  TKKKSRSLLIFATYTVFGGLQGVIVGTVMGFLVGTIYRAGLFGMSCWIPMCCAVAQILYD 132

Query: 129 VSTSYLMAGVII 140
           V  SY   G I+
Sbjct: 133 VLVSYSTVGRIM 144

>AFR319W Chr6 (1013960..1014261,1014335..1014458) [426 bp, 141 aa]
           {ON} Syntenic homolog of Saccharomyces cerevisiae
           YPR153W; 1-intron
          Length = 141

 Score =  132 bits (331), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 64/133 (48%), Positives = 92/133 (69%), Gaps = 1/133 (0%)

Query: 8   GDVPLGYVTPSFPSLYWPLNNEKFSLSYLYYTSDIWRFTVYWTLILFAGFYGSAGLIASY 67
           G+ P GY++PSFPSL W   +++ + + LYYT DI RFT++WTLIL  G YG+ GLIA Y
Sbjct: 10  GNPPAGYISPSFPSLLWT-ADDRANGALLYYTKDIVRFTIFWTLILVGGMYGAVGLIAGY 68

Query: 68  SHRKTAGGIWIMFFYLVAGGIQAIASGTVVGLLIAVIYKAGLFAMSTWVPLSCALMQILF 127
           SHR+  GG+ I+  YL+ G + AI  GT  GL+ A IY+A L AMSTW+PL+ A++Q L+
Sbjct: 69  SHRRITGGVGILAIYLLLGALHAILGGTFSGLITAAIYRAALIAMSTWIPLASAVVQALY 128

Query: 128 NVSTSYLMAGVII 140
            +  +++    +I
Sbjct: 129 LLCAAFVAQSKLI 141

>Kwal_47.18903 s47 (1020956..1021297) [342 bp, 113 aa] {ON} YPR153W
           - Hypothetical ORF [contig 189] FULL
          Length = 113

 Score = 66.2 bits (160), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 30/45 (66%), Positives = 38/45 (84%)

Query: 56  GFYGSAGLIASYSHRKTAGGIWIMFFYLVAGGIQAIASGTVVGLL 100
           GFY +AGL AS SHR+TAGG+WIM FY++ GG QA+A+GTV GL+
Sbjct: 2   GFYAAAGLWASVSHRRTAGGLWIMAFYVLVGGFQAVAAGTVTGLM 46

>Skud_19.5 Chr19 (3036..3746) [711 bp, 236 aa] {ON} YHL044W (REAL)
          Length = 236

 Score = 33.1 bits (74), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 12/44 (27%), Positives = 24/44 (54%)

Query: 88  IQAIASGTVVGLLIAVIYKAGLFAMSTWVPLSCALMQILFNVST 131
           + A++    + LL+ VI +     M TW P++C++ Q  ++  T
Sbjct: 104 LNALSDECKIKLLVEVITRKPNVDMETWDPIACSMNQYAYDRGT 147

>TDEL0D04210 Chr4 complement(772040..773326) [1287 bp, 428 aa]
          {ON} Anc_3.201 YBR004C
          Length = 428

 Score = 28.1 bits (61), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 13/53 (24%), Positives = 20/53 (37%)

Query: 37 YYTSDIWRFTVYWTLILFAGFYGSAGLIASYSHRKTAGGIWIMFFYLVAGGIQ 89
          Y+   +W   + W  + F     S   I  + H      +WI F  L AG  +
Sbjct: 47 YWNRHLWNKLLSWDAVFFIKGMTSEDGIPEFEHEYAFSPLWIRFVRLCAGNNE 99

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.328    0.141    0.453 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 14,492,060
Number of extensions: 573123
Number of successful extensions: 1572
Number of sequences better than 10.0: 36
Number of HSP's gapped: 1568
Number of HSP's successfully gapped: 37
Length of query: 140
Length of database: 53,481,399
Length adjustment: 98
Effective length of query: 42
Effective length of database: 42,244,131
Effective search space: 1774253502
Effective search space used: 1774253502
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 60 (27.7 bits)