Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0F02486g3.501ON2302308461e-115
Skud_16.4483.501ON2082305333e-68
Smik_16.4063.501ON2122305265e-67
YPR154W (PIN3)3.501ON2152315111e-64
TPHA0A057203.501ON2202375023e-63
Suva_16.4823.501ON2352304912e-61
KNAG0A079903.501ON2211204884e-61
NDAI0B059203.501ON2351174694e-58
TDEL0D056903.501ON2012304649e-58
KLTH0G02332g3.501ON2331154452e-54
Kwal_47.189053.501ON2361174349e-53
NCAS0F036003.501ON2371264322e-52
Kpol_480.83.501ON2391164218e-51
AFR320W3.501ON2571143723e-43
TBLA0C045303.501ON2221173684e-43
KAFR0G037403.501ON2341433634e-42
Skud_7.4473.501ON2381153582e-41
YGR136W (LSB1)3.501ON2411153583e-41
Smik_6.2323.501ON2411153565e-41
CAGL0F04829g3.501ON2021173501e-40
Suva_7.4243.501ON2491153523e-40
KLLA0E03873g3.501ON2201042921e-31
KNAG0B007503.501ON2171202851e-30
Ecym_12283.501ON2531192843e-30
ZYRO0D09702g3.501ON158582564e-27
ZYRO0G20372gsingletonON150592146e-21
TBLA0D029103.501ON2691122138e-20
TBLA0A025705.470ON493781501e-10
Kpol_1008.251.356ON449771446e-10
TBLA0B054702.502ON539751446e-10
Smik_8.811.356ON468691439e-10
AEL017W1.356ON416831439e-10
Ecym_27471.356ON452511402e-09
TPHA0C040202.502ON4851091402e-09
NDAI0A043505.470ON459601393e-09
TBLA0D049501.356ON468621393e-09
NCAS0A089901.356ON434511367e-09
KNAG0C020401.356ON464641351e-08
KAFR0A009701.356ON396871332e-08
TPHA0O012801.356ON454511332e-08
Suva_15.1991.356ON457511332e-08
KLTH0H12980g1.356ON399681332e-08
Kwal_0.3711.356ON217621302e-08
CAGL0I08965g1.356ON437771322e-08
YHR016C (YSC84)1.356ON468511322e-08
Skud_8.681.356ON475511322e-08
SAKL0D09702g1.356ON428511313e-08
NDAI0G059601.356ON423651295e-08
Smik_7.3351.356ON460511296e-08
Kpol_1056.372.502ON501591296e-08
YFR024C-A (LSB3)1.356ON459511296e-08
KAFR0C044001.356ON459611296e-08
SAKL0G03454g5.470ON468581297e-08
NCAS0B072501.356ON441511287e-08
YHR114W (BZZ1)2.159ON633611287e-08
TDEL0D022401.356ON433511288e-08
KAFR0D033602.502ON455621279e-08
CAGL0K02761g2.502ON450761279e-08
TDEL0A027802.502ON451671271e-07
KLLA0A08360g1.356ON423511261e-07
KLLA0B13475g2.502ON508561271e-07
Kpol_440.105.470ON470611261e-07
SAKL0E02200g2.502ON511551252e-07
Smik_8.472.502ON447731242e-07
KAFR0E036405.470ON441561243e-07
Ecym_23165.470ON421791233e-07
Skud_6.1081.356ON459511233e-07
ACR266W2.159ON626661234e-07
KNAG0C046305.470ON516711234e-07
ZYRO0B01298g2.502ON411531224e-07
TDEL0A033405.470ON473611234e-07
NCAS0A119205.470ON463551224e-07
Suva_6.961.356ON455511224e-07
ZYRO0D11110g5.470ON459571225e-07
NDAI0B045801.356ON424511215e-07
Ecym_24402.502ON459531215e-07
KLTH0D06138g2.502ON489731216e-07
Skud_4.6615.470ON460551216e-07
TBLA0F034901.356ON511511217e-07
YHL002W (HSE1)2.502ON452521208e-07
CAGL0M01650g5.470ON466561208e-07
Suva_8.512.502ON456521209e-07
NDAI0K021302.502ON4591061209e-07
AFR140C5.470ON388751191e-06
KLTH0F15114g5.470ON435551191e-06
YDR388W (RVS167)5.470ON482551181e-06
Smik_8.1922.159ON633611191e-06
Smik_4.6585.470ON472551182e-06
TPHA0E015005.470ON457551172e-06
ZYRO0G00792g1.356ON469511172e-06
ABR008C2.502ON443501172e-06
TPHA0A022101.356ON397511162e-06
Kwal_26.79022.502ON532581172e-06
Kwal_55.212875.470ON461551153e-06
Skud_8.1752.159ON633521154e-06
CAGL0A02145g1.356ON391561145e-06
Kwal_47.178942.159ON621521136e-06
KLTH0E09790g2.159ON622751137e-06
Skud_8.432.502ON454521128e-06
SAKL0E10780g2.159ON625681129e-06
NCAS0A050802.502ON450521111e-05
Kpol_1072.562.159ON637581121e-05
KNAG0I015801.356ON581601083e-05
Suva_15.3102.159ON634611083e-05
KLLA0E03059g5.470ON428591074e-05
TPHA0B028902.159ON634671074e-05
AGR306C5.170ON923691066e-05
ZYRO0D17358g6.366ON668761057e-05
Ecym_23082.591ON678561041e-04
KNAG0A067102.502ON419751022e-04
Ecym_25266.366ON524511022e-04
Ecym_54262.159ON672601012e-04
KNAG0H035002.159ON634561003e-04
ABR082W2.591ON68356995e-04
TDEL0B052202.159ON61361985e-04
KLLA0F23848g2.159ON64949977e-04
KAFR0L015807.365ON34481968e-04
TDEL0E055204.45ON158963940.002
KAFR0J026506.366ON55350930.002
TBLA0C055602.159ON67362920.003
Suva_10.2877.365ON39271910.003
KLLA0E06953g7.419ON35752910.004
TBLA0D004507.413ON100554910.004
Kpol_538.255.170ON70764910.005
YLR191W (PEX13)7.365ON38671900.005
Skud_3.1606.366ON58653910.005
Smik_3.1866.366ON59153910.005
Kpol_325.126.366ON57050900.006
CAGL0C03597g6.366ON58053900.006
Suva_3.1246.366ON60053900.006
ZYRO0G10098g4.108ON139261900.007
Smik_13.2022.591ON66371890.007
YCR088W (ABP1)6.366ON59253890.008
TBLA0I010807.413ON155563890.008
NCAS0A145707.419ON35553880.008
TBLA0F002806.366ON57651880.009
KLLA0E23365g8.539ON57558880.010
ZYRO0B16214g2.159ON65960880.011
KLLA0A04983g4.108ON125164880.011
Kwal_33.148357.365ON38473870.012
NCAS0D047406.366ON59481870.012
SAKL0A00594g6.366ON63651870.013
Suva_2.1184.108ON116652870.015
CAGL0E03476g4.45ON156463870.017
NDAI0B043202.159ON63261860.018
NCAS0B069802.159ON63960860.019
CAGL0C01881g7.413ON99958860.019
SAKL0H10098g8.539ON55565850.021
Smik_12.2517.365ON38861850.022
NDAI0I002206.366ON61553850.025
KNAG0B050005.170ON85553850.027
KAFR0L018807.413ON93049850.028
CAGL0I02750g2.159ON61960840.028
TPHA0H023806.366ON52857840.033
TDEL0A078106.366ON55857830.038
ADL288C2.319ON92562830.042
TPHA0F031007.365ON38162830.043
Smik_2.1134.108ON123052830.044
YBL007C (SLA1)4.108ON124452830.044
TPHA0K006807.419ON35552820.051
AGL237C6.366ON57851820.051
Skud_2.1044.108ON121452820.056
SAKL0G17600g4.335ON441106820.057
AGR170C4.108ON112161820.059
KNAG0B022307.413ON90455820.059
Suva_2.564singletonON4339730.066
KNAG0I027006.366ON57553810.068
YMR032W (HOF1)2.591ON66970810.072
Ecym_47107.365ON39962810.073
KLTH0B04818g7.365ON38061800.082
TBLA0B096202.319ON94154810.082
TPHA0F003804.45ON161852810.086
NDAI0A033304.108ON122664810.086
Kwal_23.64376.366ON63151800.12
NDAI0A014707.419ON36754790.12
KAFR0F007502.159ON60252790.13
Ecym_11474.335ON42275790.14
ACR230C7.365ON39878790.14
Ecym_72314.108ON114664790.14
AGL286C7.419ON33052780.15
Skud_13.1882.591ON66970790.16
Kpol_1045.217.419ON35852780.16
ZYRO0B04004g7.419ON37152780.17
NCAS0D019505.170ON93951780.19
KAFR0K020007.419ON33259770.20
Kwal_27.107337.413ON101473780.20
Ecym_71347.419ON33252770.20
SAKL0H24222g4.45ON152659780.21
Suva_13.2012.591ON66870770.22
Skud_12.2567.365ON40361770.22
KAFR0J005805.170ON90263770.24
Kpol_1045.277.413ON88054770.26
KLLA0F10175g6.366ON57663760.30
CAGL0E02783g4.108ON120352770.30
TPHA0G009302.319ON82453760.35
KNAG0C029104.108ON124462760.36
KLTH0A07348g6.366ON62651760.36
NCAS0A034904.108ON123564760.38
NDAI0E043907.365ON44562750.39
NCAS0B060202.319ON86455750.40
KNAG0C034207.413ON101849750.41
NDAI0A015007.413ON104749750.41
Skud_2.237.413ON98254750.41
YBL085W (BOI1)7.413ON98054750.45
Ecym_11678.539ON55055750.46
KLTH0C06182g7.413ON102553750.46
AGL293C7.413ON98454750.49
Suva_2.337.413ON98269750.50
SAKL0F12958g7.413ON102754750.51
KLTH0E07744g4.108ON124964750.51
Kwal_26.83232.591ON62763740.53
KLLA0E20879g7.413ON101554740.55
TBLA0A076107.365ON41361740.57
Kwal_27.107077.419ON34367730.60
AER140C4.335ON41474730.63
KAFR0A068702.319ON85453740.65
TPHA0K007207.413ON101166740.67
Kwal_47.169434.335ON46057730.69
Smik_2.357.413ON98554740.70
TDEL0F023804.108ON125566740.71
KLTH0C06028g7.419ON34258730.71
Suva_5.2397.419ON36852730.72
KNAG0C033907.419ON34252720.77
TDEL0G024902.319ON85053730.78
ZYRO0B03850g7.413ON108948730.78
SAKL0H21912g4.108ON125373730.81
NCAS0A145307.413ON102354730.85
Kpol_534.62.319ON88656730.87
NDAI0B033302.319ON91953730.89
Suva_5.2357.413ON104349721.1
TBLA0C041004.108ON130264721.1
Ecym_71417.413ON102949721.1
TDEL0C027307.413ON101645711.3
TBLA0I010507.419ON37152701.4
KLLA0D16874g8.344ON22751691.5
TPHA0E007307.413ON97849711.5
ZYRO0A02662g2.319ON88653711.5
TDEL0C028107.419ON33753701.5
Kpol_1025.404.108ON120260711.6
KLTH0B02354g5.170ON121456701.7
Smik_5.2637.419ON36852701.7
Smik_10.2515.170ON112262701.9
Ecym_82195.170ON102466702.0
TBLA0A006108.539ON59779702.0
CAGL0G06842g5.170ON103955702.1
Smik_5.2597.413ON104178692.2
ZYRO0F01166g2.591ON74864692.3
Kwal_33.153395.170ON118456692.5
YJL020C (BBC1)5.170ON115762692.5
Suva_10.4064.45ON158763692.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0F02486g
         (230 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0F02486g Chr6 complement(216399..217091) [693 bp, 230 aa] {O...   330   e-115
Skud_16.448 Chr16 (788136..788762) [627 bp, 208 aa] {ON} YPR154W...   209   3e-68
Smik_16.406 Chr16 (706485..707123) [639 bp, 212 aa] {ON} YPR154W...   207   5e-67
YPR154W Chr16 (834565..835212) [648 bp, 215 aa] {ON}  PIN3Protei...   201   1e-64
TPHA0A05720 Chr1 (1293214..1293876) [663 bp, 220 aa] {ON} Anc_3....   197   3e-63
Suva_16.482 Chr16 (830850..831557) [708 bp, 235 aa] {ON} YPR154W...   193   2e-61
KNAG0A07990 Chr1 (1272958..1273623) [666 bp, 221 aa] {ON} Anc_3....   192   4e-61
NDAI0B05920 Chr2 (1429564..1430271) [708 bp, 235 aa] {ON} Anc_3....   185   4e-58
TDEL0D05690 Chr4 (1022136..1022741) [606 bp, 201 aa] {ON} Anc_3....   183   9e-58
KLTH0G02332g Chr7 complement(184383..185084) [702 bp, 233 aa] {O...   176   2e-54
Kwal_47.18905 s47 (1021428..1022138) [711 bp, 236 aa] {ON} YPR15...   171   9e-53
NCAS0F03600 Chr6 (715784..716497) [714 bp, 237 aa] {ON} Anc_3.50...   171   2e-52
Kpol_480.8 s480 complement(17610..18329) [720 bp, 239 aa] {ON} c...   166   8e-51
AFR320W Chr6 (1014675..1015448) [774 bp, 257 aa] {ON} Syntenic h...   147   3e-43
TBLA0C04530 Chr3 (1097179..1097847) [669 bp, 222 aa] {ON} Anc_3....   146   4e-43
KAFR0G03740 Chr7 (767426..768130) [705 bp, 234 aa] {ON} Anc_3.50...   144   4e-42
Skud_7.447 Chr7 (741615..742331) [717 bp, 238 aa] {ON} YGR136W (...   142   2e-41
YGR136W Chr7 (762428..763153) [726 bp, 241 aa] {ON}  LSB1Protein...   142   3e-41
Smik_6.232 Chr6 (380319..381044) [726 bp, 241 aa] {ON} YGR136W (...   141   5e-41
CAGL0F04829g Chr6 (487684..488292) [609 bp, 202 aa] {ON} similar...   139   1e-40
Suva_7.424 Chr7 (732619..733368) [750 bp, 249 aa] {ON} YGR136W (...   140   3e-40
KLLA0E03873g Chr5 complement(354700..355362) [663 bp, 220 aa] {O...   117   1e-31
KNAG0B00750 Chr2 complement(140620..141273) [654 bp, 217 aa] {ON...   114   1e-30
Ecym_1228 Chr1 complement(473518..474279) [762 bp, 253 aa] {ON} ...   114   3e-30
ZYRO0D09702g Chr4 complement(823900..824376) [477 bp, 158 aa] {O...   103   4e-27
ZYRO0G20372g Chr7 (1680364..1680816) [453 bp, 150 aa] {ON} weakl...    87   6e-21
TBLA0D02910 Chr4 complement(717010..717819) [810 bp, 269 aa] {ON...    87   8e-20
TBLA0A02570 Chr1 complement(622892..624373) [1482 bp, 493 aa] {O...    62   1e-10
Kpol_1008.25 s1008 complement(50905..52207,52597..52643) [1350 b...    60   6e-10
TBLA0B05470 Chr2 complement(1301018..1302637) [1620 bp, 539 aa] ...    60   6e-10
Smik_8.81 Chr8 complement(117184..118543,118714..118760) [1407 b...    60   9e-10
AEL017W Chr5 (603303..603349,603451..604654) [1251 bp, 416 aa] {...    60   9e-10
Ecym_2747 Chr2 complement(1449887..1451198,1451401..1451447) [13...    59   2e-09
TPHA0C04020 Chr3 complement(861629..863086) [1458 bp, 485 aa] {O...    59   2e-09
NDAI0A04350 Chr1 complement(979014..980393) [1380 bp, 459 aa] {O...    58   3e-09
TBLA0D04950 Chr4 complement(1216633..1218039) [1407 bp, 468 aa] ...    58   3e-09
NCAS0A08990 Chr1 complement(1780800..1782036,1782134..1782201) [...    57   7e-09
KNAG0C02040 Chr3 complement(397447..398841) [1395 bp, 464 aa] {O...    57   1e-08
KAFR0A00970 Chr1 (181162..182352) [1191 bp, 396 aa] {ON} Anc_1.3...    56   2e-08
TPHA0O01280 Chr15 complement(252746..254110) [1365 bp, 454 aa] {...    56   2e-08
Suva_15.199 Chr15 complement(345409..346735,346904..346950) [137...    56   2e-08
KLTH0H12980g Chr8 complement(1110123..1111259,1111344..1111406) ...    56   2e-08
Kwal_0.371 s0 complement(179002..179655) [654 bp, 217 aa] {ON} Y...    55   2e-08
CAGL0I08965g Chr9 complement(869942..871255) [1314 bp, 437 aa] {...    55   2e-08
YHR016C Chr8 complement(136881..138240,138409..138455) [1407 bp,...    55   2e-08
Skud_8.68 Chr8 complement(118475..119855,120025..120071) [1428 b...    55   2e-08
SAKL0D09702g Chr4 complement(805912..807151,807326..807372) [128...    55   3e-08
NDAI0G05960 Chr7 (1474282..1475553) [1272 bp, 423 aa] {ON} Anc_1...    54   5e-08
Smik_7.335 Chr7 complement(563424..564759,564853..564899) [1383 ...    54   6e-08
Kpol_1056.37 s1056 (92852..94357) [1506 bp, 501 aa] {ON} (92852....    54   6e-08
YFR024C-A Chr6 complement(201960..203292,203387..203433) [1380 b...    54   6e-08
KAFR0C04400 Chr3 (868668..868714,868802..870134) [1380 bp, 459 a...    54   6e-08
SAKL0G03454g Chr7 (284017..285423) [1407 bp, 468 aa] {ON} some s...    54   7e-08
NCAS0B07250 Chr2 complement(1371597..1372875,1373026..1373072) [...    54   7e-08
YHR114W Chr8 (338083..339984) [1902 bp, 633 aa] {ON}  BZZ1SH3 do...    54   7e-08
TDEL0D02240 Chr4 (431160..431206,431314..432568) [1302 bp, 433 a...    54   8e-08
KAFR0D03360 Chr4 complement(658469..659836) [1368 bp, 455 aa] {O...    54   9e-08
CAGL0K02761g Chr11 (249893..251245) [1353 bp, 450 aa] {ON} simil...    54   9e-08
TDEL0A02780 Chr1 (504696..506051) [1356 bp, 451 aa] {ON} Anc_2.5...    54   1e-07
KLLA0A08360g Chr1 complement(739092..740316,740718..740764) [127...    53   1e-07
KLLA0B13475g Chr2 complement(1178856..1180382) [1527 bp, 508 aa]...    54   1e-07
Kpol_440.10 s440 (25697..27109) [1413 bp, 470 aa] {ON} (25697..2...    53   1e-07
SAKL0E02200g Chr5 complement(171315..172850) [1536 bp, 511 aa] {...    53   2e-07
Smik_8.47 Chr8 (81503..82846) [1344 bp, 447 aa] {ON} YHL002W (REAL)    52   2e-07
KAFR0E03640 Chr5 complement(731325..732650) [1326 bp, 441 aa] {O...    52   3e-07
Ecym_2316 Chr2 complement(619368..620633) [1266 bp, 421 aa] {ON}...    52   3e-07
Skud_6.108 Chr6 complement(197616..198948,199044..199090) [1380 ...    52   3e-07
ACR266W Chr3 (838689..840569) [1881 bp, 626 aa] {ON} Syntenic ho...    52   4e-07
KNAG0C04630 Chr3 (908312..909862) [1551 bp, 516 aa] {ON} Anc_5.4...    52   4e-07
ZYRO0B01298g Chr2 (110004..111239) [1236 bp, 411 aa] {ON} simila...    52   4e-07
TDEL0A03340 Chr1 (592752..594173) [1422 bp, 473 aa] {ON} Anc_5.4...    52   4e-07
NCAS0A11920 Chr1 (2363750..2365141) [1392 bp, 463 aa] {ON} Anc_5...    52   4e-07
Suva_6.96 Chr6 complement(167266..168586,168693..168739) [1368 b...    52   4e-07
ZYRO0D11110g Chr4 (939064..940443) [1380 bp, 459 aa] {ON} simila...    52   5e-07
NDAI0B04580 Chr2 complement(1138779..1140053) [1275 bp, 424 aa] ...    51   5e-07
Ecym_2440 Chr2 (858070..859449) [1380 bp, 459 aa] {ON} similar t...    51   5e-07
KLTH0D06138g Chr4 (544661..546130) [1470 bp, 489 aa] {ON} simila...    51   6e-07
Skud_4.661 Chr4 (1170843..1172225) [1383 bp, 460 aa] {ON} YDR388...    51   6e-07
TBLA0F03490 Chr6 (859156..859202,859415..860903) [1536 bp, 511 a...    51   7e-07
YHL002W Chr8 (102612..103970) [1359 bp, 452 aa] {ON}  HSE1Subuni...    51   8e-07
CAGL0M01650g Chr13 complement(184085..185485) [1401 bp, 466 aa] ...    51   8e-07
Suva_8.51 Chr8 (98991..100361) [1371 bp, 456 aa] {ON} YHL002W (R...    51   9e-07
NDAI0K02130 Chr11 (481352..482731) [1380 bp, 459 aa] {ON} Anc_2....    51   9e-07
AFR140C Chr6 complement(692042..693208) [1167 bp, 388 aa] {ON} S...    50   1e-06
KLTH0F15114g Chr6 complement(1238921..1240228) [1308 bp, 435 aa]...    50   1e-06
YDR388W Chr4 (1250186..1251634) [1449 bp, 482 aa] {ON}  RVS167Ac...    50   1e-06
Smik_8.192 Chr8 (314456..316357) [1902 bp, 633 aa] {ON} YHR114W ...    50   1e-06
Smik_4.658 Chr4 (1170707..1172125) [1419 bp, 472 aa] {ON} YDR388...    50   2e-06
TPHA0E01500 Chr5 complement(304130..305503) [1374 bp, 457 aa] {O...    50   2e-06
ZYRO0G00792g Chr7 (61277..61323,61435..62797) [1410 bp, 469 aa] ...    50   2e-06
ABR008C Chr2 complement(406780..408111) [1332 bp, 443 aa] {ON} S...    50   2e-06
TPHA0A02210 Chr1 (455888..457081) [1194 bp, 397 aa] {ON} Anc_1.3...    49   2e-06
Kwal_26.7902 s26 (560454..562052) [1599 bp, 532 aa] {ON} YHL002W...    50   2e-06
Kwal_55.21287 s55 complement(768495..769880) [1386 bp, 461 aa] {...    49   3e-06
Skud_8.175 Chr8 (311857..313758) [1902 bp, 633 aa] {ON} YHR114W ...    49   4e-06
CAGL0A02145g Chr1 (224026..224036,225280..226444) [1176 bp, 391 ...    49   5e-06
Kwal_47.17894 s47 (597826..599691) [1866 bp, 621 aa] {ON} YHR114...    48   6e-06
KLTH0E09790g Chr5 (881284..883152) [1869 bp, 622 aa] {ON} simila...    48   7e-06
Skud_8.43 Chr8 (84125..85489) [1365 bp, 454 aa] {ON} YHL002W (REAL)    48   8e-06
SAKL0E10780g Chr5 (897714..899591) [1878 bp, 625 aa] {ON} simila...    48   9e-06
NCAS0A05080 Chr1 (1011572..1012924) [1353 bp, 450 aa] {ON} Anc_2...    47   1e-05
Kpol_1072.56 s1072 complement(127771..129684) [1914 bp, 637 aa] ...    48   1e-05
KNAG0I01580 Chr9 (306534..306580,306733..308431) [1746 bp, 581 a...    46   3e-05
Suva_15.310 Chr15 (540462..542366) [1905 bp, 634 aa] {ON} YHR114...    46   3e-05
KLLA0E03059g Chr5 (281543..282829) [1287 bp, 428 aa] {ON} simila...    46   4e-05
TPHA0B02890 Chr2 complement(659614..661518) [1905 bp, 634 aa] {O...    46   4e-05
AGR306C Chr7 complement(1305647..1308418) [2772 bp, 923 aa] {ON}...    45   6e-05
ZYRO0D17358g Chr4 (1429127..1431133) [2007 bp, 668 aa] {ON} simi...    45   7e-05
Ecym_2308 Chr2 complement(597163..599199) [2037 bp, 678 aa] {ON}...    45   1e-04
KNAG0A06710 Chr1 complement(1045213..1046472) [1260 bp, 419 aa] ...    44   2e-04
Ecym_2526 Chr2 (1025422..1026996) [1575 bp, 524 aa] {ON} similar...    44   2e-04
Ecym_5426 Chr5 (877285..879303) [2019 bp, 672 aa] {ON} similar t...    44   2e-04
KNAG0H03500 Chr8 (652236..654140) [1905 bp, 634 aa] {ON} Anc_2.1...    43   3e-04
ABR082W Chr2 (537500..539551) [2052 bp, 683 aa] {ON} Syntenic ho...    43   5e-04
TDEL0B05220 Chr2 complement(918098..919939) [1842 bp, 613 aa] {O...    42   5e-04
KLLA0F23848g Chr6 (2224951..2226900) [1950 bp, 649 aa] {ON} simi...    42   7e-04
KAFR0L01580 Chr12 complement(286684..287718) [1035 bp, 344 aa] {...    42   8e-04
TDEL0E05520 Chr5 (1015520..1020289) [4770 bp, 1589 aa] {ON} Anc_...    41   0.002
KAFR0J02650 Chr10 complement(510356..512017) [1662 bp, 553 aa] {...    40   0.002
TBLA0C05560 Chr3 complement(1346488..1348509) [2022 bp, 673 aa] ...    40   0.003
Suva_10.287 Chr10 (509884..511062) [1179 bp, 392 aa] {ON} YLR191...    40   0.003
KLLA0E06953g Chr5 (629777..630850) [1074 bp, 357 aa] {ON} unipro...    40   0.004
TBLA0D00450 Chr4 (109529..112546) [3018 bp, 1005 aa] {ON} Anc_7....    40   0.004
Kpol_538.25 s538 (50807..52930) [2124 bp, 707 aa] {ON} (50807..5...    40   0.005
YLR191W Chr12 (537272..538432) [1161 bp, 386 aa] {ON}  PEX13Inte...    39   0.005
Skud_3.160 Chr3 (249584..251344) [1761 bp, 586 aa] {ON} YCR088W ...    40   0.005
Smik_3.186 Chr3 (264667..266442) [1776 bp, 591 aa] {ON} YCR088W ...    40   0.005
Kpol_325.12 s325 (19571..21283) [1713 bp, 570 aa] {ON} (19571..2...    39   0.006
CAGL0C03597g Chr3 complement(358731..360473) [1743 bp, 580 aa] {...    39   0.006
Suva_3.124 Chr3 (182459..184261) [1803 bp, 600 aa] {ON} YCR088W ...    39   0.006
ZYRO0G10098g Chr7 complement(808399..812577) [4179 bp, 1392 aa] ...    39   0.007
Smik_13.202 Chr13 (329496..331487) [1992 bp, 663 aa] {ON} YMR032...    39   0.007
YCR088W Chr3 (265068..266846) [1779 bp, 592 aa] {ON}  ABP1Actin-...    39   0.008
TBLA0I01080 Chr9 (218200..222867) [4668 bp, 1555 aa] {ON} Anc_7....    39   0.008
NCAS0A14570 Chr1 complement(2869713..2870780) [1068 bp, 355 aa] ...    39   0.008
TBLA0F00280 Chr6 complement(58186..59916) [1731 bp, 576 aa] {ON}...    39   0.009
KLLA0E23365g Chr5 complement(2077042..2078760,2078979..2078987) ...    39   0.010
ZYRO0B16214g Chr2 (1312950..1314929) [1980 bp, 659 aa] {ON} simi...    39   0.011
KLLA0A04983g Chr1 complement(445032..448787) [3756 bp, 1251 aa] ...    39   0.011
Kwal_33.14835 s33 (834951..836105) [1155 bp, 384 aa] {ON} YLR191...    38   0.012
NCAS0D04740 Chr4 complement(909728..911512) [1785 bp, 594 aa] {O...    38   0.012
SAKL0A00594g Chr1 complement(68426..70336) [1911 bp, 636 aa] {ON...    38   0.013
Suva_2.118 Chr2 complement(206707..206754,206785..206832,206899....    38   0.015
CAGL0E03476g Chr5 complement(319193..323887) [4695 bp, 1564 aa] ...    38   0.017
NDAI0B04320 Chr2 (1084783..1086681) [1899 bp, 632 aa] {ON} Anc_2...    38   0.018
NCAS0B06980 Chr2 (1328203..1330122) [1920 bp, 639 aa] {ON} Anc_2...    38   0.019
CAGL0C01881g Chr3 (196299..199298) [3000 bp, 999 aa] {ON} simila...    38   0.019
SAKL0H10098g Chr8 (865874..865882,865987..867645) [1668 bp, 555 ...    37   0.021
Smik_12.251 Chr12 (484225..485391) [1167 bp, 388 aa] {ON} YLR191...    37   0.022
NDAI0I00220 Chr9 (32281..34128) [1848 bp, 615 aa] {ON} Anc_6.366...    37   0.025
KNAG0B05000 Chr2 (955989..958556) [2568 bp, 855 aa] {ON} Anc_5.1...    37   0.027
KAFR0L01880 Chr12 complement(348028..350820) [2793 bp, 930 aa] {...    37   0.028
CAGL0I02750g Chr9 complement(242879..244738) [1860 bp, 619 aa] {...    37   0.028
TPHA0H02380 Chr8 (558973..560559) [1587 bp, 528 aa] {ON} Anc_6.3...    37   0.033
TDEL0A07810 Chr1 (1355773..1357449) [1677 bp, 558 aa] {ON} Anc_6...    37   0.038
ADL288C Chr4 complement(194687..197464) [2778 bp, 925 aa] {ON} S...    37   0.042
TPHA0F03100 Chr6 complement(680407..681552) [1146 bp, 381 aa] {O...    37   0.043
Smik_2.113 Chr2 complement(205503..206218,206252..209228) [3693 ...    37   0.044
YBL007C Chr2 complement(212632..216366) [3735 bp, 1244 aa] {ON} ...    37   0.044
TPHA0K00680 Chr11 (134675..135742) [1068 bp, 355 aa] {ON} Anc_7....    36   0.051
AGL237C Chr7 complement(254636..256372) [1737 bp, 578 aa] {ON} S...    36   0.051
Skud_2.104 Chr2 complement(196129..199773) [3645 bp, 1214 aa] {O...    36   0.056
SAKL0G17600g Chr7 complement(1523623..1524948) [1326 bp, 441 aa]...    36   0.057
AGR170C Chr7 complement(1066831..1070196) [3366 bp, 1121 aa] {ON...    36   0.059
KNAG0B02230 Chr2 (431524..434238) [2715 bp, 904 aa] {ON} Anc_7.4...    36   0.059
Suva_2.564 Chr2 (1002523..1002651) [129 bp, 43 aa] {ON} YDR388W ...    33   0.066
KNAG0I02700 Chr9 complement(531880..533607) [1728 bp, 575 aa] {O...    36   0.068
YMR032W Chr13 (335298..337307) [2010 bp, 669 aa] {ON}  HOF1Bud n...    36   0.072
Ecym_4710 Chr4 (1391055..1392254) [1200 bp, 399 aa] {ON} similar...    36   0.073
KLTH0B04818g Chr2 complement(395490..396632) [1143 bp, 380 aa] {...    35   0.082
TBLA0B09620 Chr2 complement(2277581..2280406) [2826 bp, 941 aa] ...    36   0.082
TPHA0F00380 Chr6 (85560..90416) [4857 bp, 1618 aa] {ON} Anc_4.45...    36   0.086
NDAI0A03330 Chr1 complement(756761..760441) [3681 bp, 1226 aa] {...    36   0.086
Kwal_23.6437 s23 (1581839..1583734) [1896 bp, 631 aa] {ON} YCR08...    35   0.12 
NDAI0A01470 Chr1 (326531..327634) [1104 bp, 367 aa] {ON} Anc_7.4...    35   0.12 
KAFR0F00750 Chr6 complement(145999..147807) [1809 bp, 602 aa] {O...    35   0.13 
Ecym_1147 Chr1 (305106..306374) [1269 bp, 422 aa] {ON} similar t...    35   0.14 
ACR230C Chr3 complement(763430..764626) [1197 bp, 398 aa] {ON} S...    35   0.14 
Ecym_7231 Chr7 complement(480473..483913) [3441 bp, 1146 aa] {ON...    35   0.14 
AGL286C Chr7 complement(174535..175527) [993 bp, 330 aa] {ON} Sy...    35   0.15 
Skud_13.188 Chr13 (322010..324019) [2010 bp, 669 aa] {ON} YMR032...    35   0.16 
Kpol_1045.21 s1045 (44318..45394) [1077 bp, 358 aa] {ON} (44320....    35   0.16 
ZYRO0B04004g Chr2 complement(337594..338709) [1116 bp, 371 aa] {...    35   0.17 
NCAS0D01950 Chr4 (358938..361757) [2820 bp, 939 aa] {ON} Anc_5.170     35   0.19 
KAFR0K02000 Chr11 complement(410316..411314) [999 bp, 332 aa] {O...    34   0.20 
Kwal_27.10733 s27 (473078..476122) [3045 bp, 1014 aa] {ON} YER11...    35   0.20 
Ecym_7134 Chr7 (266402..267400) [999 bp, 332 aa] {ON} similar to...    34   0.20 
SAKL0H24222g Chr8 complement(2089734..2094314) [4581 bp, 1526 aa...    35   0.21 
Suva_13.201 Chr13 (325718..327724) [2007 bp, 668 aa] {ON} YMR032...    34   0.22 
Skud_12.256 Chr12 (483859..485070) [1212 bp, 403 aa] {ON} YLR191...    34   0.22 
KAFR0J00580 Chr10 (99508..102216) [2709 bp, 902 aa] {ON} Anc_5.1...    34   0.24 
Kpol_1045.27 s1045 (60696..63338) [2643 bp, 880 aa] {ON} (60698....    34   0.26 
KLLA0F10175g Chr6 complement(944501..946231) [1731 bp, 576 aa] {...    34   0.30 
CAGL0E02783g Chr5 (261665..265276) [3612 bp, 1203 aa] {ON} simil...    34   0.30 
TPHA0G00930 Chr7 (179525..181999) [2475 bp, 824 aa] {ON} Anc_2.3...    34   0.35 
KNAG0C02910 Chr3 complement(577437..581171) [3735 bp, 1244 aa] {...    34   0.36 
KLTH0A07348g Chr1 (610049..611929) [1881 bp, 626 aa] {ON} simila...    34   0.36 
NCAS0A03490 Chr1 complement(689871..693578) [3708 bp, 1235 aa] {...    34   0.38 
NDAI0E04390 Chr5 (993398..994735) [1338 bp, 445 aa] {ON} Anc_7.3...    33   0.39 
NCAS0B06020 Chr2 (1138359..1140953) [2595 bp, 864 aa] {ON} Anc_2...    33   0.40 
KNAG0C03420 Chr3 (670941..673997) [3057 bp, 1018 aa] {ON} Anc_7....    33   0.41 
NDAI0A01500 Chr1 (331951..335094) [3144 bp, 1047 aa] {ON} Anc_7....    33   0.41 
Skud_2.23 Chr2 (47507..50455) [2949 bp, 982 aa] {ON} YBL085W (REAL)    33   0.41 
YBL085W Chr2 (63876..66818) [2943 bp, 980 aa] {ON}  BOI1Protein ...    33   0.45 
Ecym_1167 Chr1 (341453..341461,341739..343382) [1653 bp, 550 aa]...    33   0.46 
KLTH0C06182g Chr3 (535274..538351) [3078 bp, 1025 aa] {ON} simil...    33   0.46 
AGL293C Chr7 complement(156902..159856) [2955 bp, 984 aa] {ON} S...    33   0.49 
Suva_2.33 Chr2 (60529..63477) [2949 bp, 982 aa] {ON} YBL085W (REAL)    33   0.50 
SAKL0F12958g Chr6 complement(1019015..1022098) [3084 bp, 1027 aa...    33   0.51 
KLTH0E07744g Chr5 complement(710793..714542) [3750 bp, 1249 aa] ...    33   0.51 
Kwal_26.8323 s26 (739043..740926) [1884 bp, 627 aa] {ON} YMR032W...    33   0.53 
KLLA0E20879g Chr5 complement(1862894..1865941) [3048 bp, 1015 aa...    33   0.55 
TBLA0A07610 Chr1 complement(1888564..1889805) [1242 bp, 413 aa] ...    33   0.57 
Kwal_27.10707 s27 (457482..458513) [1032 bp, 343 aa] {ON} YER118...    33   0.60 
AER140C Chr5 complement(901101..902345) [1245 bp, 414 aa] {ON} N...    33   0.63 
KAFR0A06870 Chr1 complement(1387865..1390429) [2565 bp, 854 aa] ...    33   0.65 
TPHA0K00720 Chr11 (147285..150320) [3036 bp, 1011 aa] {ON} Anc_7...    33   0.67 
Kwal_47.16943 s47 (182308..183690) [1383 bp, 460 aa] {ON} YDR388...    33   0.69 
Smik_2.35 Chr2 (57476..60433) [2958 bp, 985 aa] {ON} YBL085W (REAL)    33   0.70 
TDEL0F02380 Chr6 (438262..442029) [3768 bp, 1255 aa] {ON} Anc_4....    33   0.71 
KLTH0C06028g Chr3 (520445..521473) [1029 bp, 342 aa] {ON} simila...    33   0.71 
Suva_5.239 Chr5 complement(373672..374778) [1107 bp, 368 aa] {ON...    33   0.72 
KNAG0C03390 Chr3 (667055..668083) [1029 bp, 342 aa] {ON} Anc_7.4...    32   0.77 
TDEL0G02490 Chr7 (478524..481076) [2553 bp, 850 aa] {ON} Anc_2.3...    33   0.78 
ZYRO0B03850g Chr2 complement(320570..323839) [3270 bp, 1089 aa] ...    33   0.78 
SAKL0H21912g Chr8 complement(1913307..1917068) [3762 bp, 1253 aa...    33   0.81 
NCAS0A14530 Chr1 complement(2863100..2866171) [3072 bp, 1023 aa]...    33   0.85 
Kpol_534.6 s534 (20451..23111) [2661 bp, 886 aa] {ON} (20451..23...    33   0.87 
NDAI0B03330 Chr2 (848506..851265) [2760 bp, 919 aa] {ON} Anc_2.3...    33   0.89 
Suva_5.235 Chr5 complement(366285..369416) [3132 bp, 1043 aa] {O...    32   1.1  
TBLA0C04100 Chr3 (990555..994463) [3909 bp, 1302 aa] {ON} Anc_4....    32   1.1  
Ecym_7141 Chr7 (283803..286892) [3090 bp, 1029 aa] {ON} similar ...    32   1.1  
TDEL0C02730 Chr3 complement(479746..482796) [3051 bp, 1016 aa] {...    32   1.3  
TBLA0I01050 Chr9 (210595..211710) [1116 bp, 371 aa] {ON} Anc_7.4...    32   1.4  
KLLA0D16874g Chr4 complement(1430953..1431636) [684 bp, 227 aa] ...    31   1.5  
TPHA0E00730 Chr5 (139190..142126) [2937 bp, 978 aa] {ON} Anc_7.4...    32   1.5  
ZYRO0A02662g Chr1 (213322..215982) [2661 bp, 886 aa] {ON} simila...    32   1.5  
TDEL0C02810 Chr3 complement(498625..499638) [1014 bp, 337 aa] {O...    32   1.5  
Kpol_1025.40 s1025 (104879..108487) [3609 bp, 1202 aa] {ON} (104...    32   1.6  
KLTH0B02354g Chr2 (186128..189772) [3645 bp, 1214 aa] {ON} weakl...    32   1.7  
Smik_5.263 Chr5 complement(407025..408131) [1107 bp, 368 aa] {ON...    32   1.7  
Smik_10.251 Chr10 complement(395243..398611) [3369 bp, 1122 aa] ...    32   1.9  
Ecym_8219 Chr8 (447011..450085) [3075 bp, 1024 aa] {ON} similar ...    32   2.0  
TBLA0A00610 Chr1 complement(119166..120959) [1794 bp, 597 aa] {O...    32   2.0  
CAGL0G06842g Chr7 complement(651033..654152) [3120 bp, 1039 aa] ...    32   2.1  
Smik_5.259 Chr5 complement(399447..402572) [3126 bp, 1041 aa] {O...    31   2.2  
ZYRO0F01166g Chr6 complement(90553..92799) [2247 bp, 748 aa] {ON...    31   2.3  
Kwal_33.15339 s33 complement(1065599..1069153) [3555 bp, 1184 aa...    31   2.5  
YJL020C Chr10 complement(398937..402410) [3474 bp, 1157 aa] {ON}...    31   2.5  
Suva_10.406 Chr10 complement(713226..717989) [4764 bp, 1587 aa] ...    31   2.5  
Skud_10.200 Chr10 complement(366708..370013) [3306 bp, 1101 aa] ...    31   2.6  
KAFR0I01040 Chr9 (201597..205208) [3612 bp, 1203 aa] {ON} Anc_4....    31   2.8  
AEL241W Chr5 (184639..184647,184836..186476) [1650 bp, 549 aa] {...    31   2.8  
CAGL0G03597g Chr7 complement(348369..349430) [1062 bp, 353 aa] {...    31   2.9  
NDAI0C02830 Chr3 complement(651724..654657) [2934 bp, 977 aa] {O...    31   3.0  
YER114C Chr5 complement(390590..393712) [3123 bp, 1040 aa] {ON} ...    31   3.0  
Kpol_414.1 s414 (1989..6635) [4647 bp, 1548 aa] {ON} (1989..6635...    31   3.1  
Skud_5.265 Chr5 (427799..430930) [3132 bp, 1043 aa] {ON} YER114C...    31   3.1  
KAFR0K01960 Chr11 complement(403631..406459) [2829 bp, 942 aa] {...    31   3.2  
KLLA0D09306g Chr4 (783852..788465) [4614 bp, 1537 aa] {ON} simil...    31   3.4  
YDL117W Chr4 (248581..251238) [2658 bp, 885 aa] {ON}  CYK3SH3-do...    31   3.4  
KLLA0F14575g Chr6 complement(1351796..1354351) [2556 bp, 851 aa]...    31   3.4  
KNAG0J02750 Chr10 complement(521086..526044) [4959 bp, 1652 aa] ...    30   4.3  
TBLA0C06440 Chr3 (1558190..1562134) [3945 bp, 1314 aa] {ON} Anc_...    30   4.4  
Suva_12.60 Chr12 complement(81323..84748) [3426 bp, 1141 aa] {ON...    30   4.6  
CAGL0F05885g Chr6 (588828..590966) [2139 bp, 712 aa] {ON} simila...    30   5.0  
Smik_4.119 Chr4 (225256..227919) [2664 bp, 887 aa] {ON} YDL117W ...    30   5.1  
Kpol_1024.45 s1024 (120171..121835) [1665 bp, 554 aa] {ON} (1201...    30   5.1  
Suva_4.129 Chr4 (237039..239702) [2664 bp, 887 aa] {ON} YDL117W ...    30   5.5  
Skud_4.137 Chr4 (244217..246880) [2664 bp, 887 aa] {ON} YDL117W ...    30   5.9  
Kwal_53.19449 s53 (58..657) [600 bp, 199 aa] {ON} YDR162C (NBP2)...    29   6.1  
TBLA0H03590 Chr8 complement(874695..876497) [1803 bp, 600 aa] {O...    30   6.2  
SAKL0F13112g Chr6 complement(1037049..1038071) [1023 bp, 340 aa]...    30   6.4  
TPHA0K01600 Chr11 (338182..341592) [3411 bp, 1136 aa] {ON} Anc_4...    30   6.5  
Kpol_1060.48 s1060 (115796..118939) [3144 bp, 1047 aa] {ON} (115...    30   6.6  
Skud_12.51 Chr12 (103635..107399) [3765 bp, 1254 aa] {ON} YLL016...    30   6.9  
Skud_5.261 Chr5 (422454..423572) [1119 bp, 372 aa] {ON} YER118C ...    30   7.0  
SAKL0H15048g Chr8 (1304135..1304758) [624 bp, 207 aa] {ON} some ...    29   7.2  
Ecym_4228 Chr4 (475985..476770) [786 bp, 261 aa] {ON} similar to...    29   7.5  
TPHA0L01660 Chr12 complement(348715..350358) [1644 bp, 547 aa] {...    29   8.9  
KLTH0E12518g Chr5 complement(1109548..1111197,1111361..1111369) ...    29   9.7  
NCAS0C05710 Chr3 complement(1170253..1175283) [5031 bp, 1676 aa]...    29   10.0 

>SAKL0F02486g Chr6 complement(216399..217091) [693 bp, 230 aa] {ON}
           similar to uniprot|Q06449 Saccharomyces cerevisiae
           YPR154W PIN3 Protein that induces appearance of [PIN ]
           prion when overproduced
          Length = 230

 Score =  330 bits (846), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 171/230 (74%), Positives = 171/230 (74%)

Query: 1   MSASLINRSLTTIRTELDFLRESEVISEETFQQISNSLPQRYDPNANGNRSSSPSLEYVE 60
           MSASLINRSLTTIRTELDFLRESEVISEETFQQISNSLPQRYDPNANGNRSSSPSLEYVE
Sbjct: 1   MSASLINRSLTTIRTELDFLRESEVISEETFQQISNSLPQRYDPNANGNRSSSPSLEYVE 60

Query: 61  AIYAFQAQQDGDLNLKPGDKIQVLEKPSSEWYKGKCNGSVGMFPSNYVKPAFSGSNGFTX 120
           AIYAFQAQQDGDLNLKPGDKIQVLEKPSSEWYKGKCNGSVGMFPSNYVKPAFSGSNGFT 
Sbjct: 61  AIYAFQAQQDGDLNLKPGDKIQVLEKPSSEWYKGKCNGSVGMFPSNYVKPAFSGSNGFTR 120

Query: 121 XXXXXXXXXXXXXXXXXXTVXXXXXXXXXXXXXXXXXXFPPPSTGFXXXXXXXXXXXXXX 180
                             TV                  FPPPSTGF              
Sbjct: 121 EEPARPNLPPPPQYQSSPTVALQPQQTSSSTQLASQPQFPPPSTGFYQQPPQQYYQQPPV 180

Query: 181 XXXXXXXXAPEQHAGHNGSQAFKKFGSKLGNAAIFGAGATIGSDIVNSIF 230
                   APEQHAGHNGSQAFKKFGSKLGNAAIFGAGATIGSDIVNSIF
Sbjct: 181 QQSPVQQPAPEQHAGHNGSQAFKKFGSKLGNAAIFGAGATIGSDIVNSIF 230

>Skud_16.448 Chr16 (788136..788762) [627 bp, 208 aa] {ON} YPR154W
           (REAL)
          Length = 208

 Score =  209 bits (533), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 120/230 (52%), Positives = 138/230 (60%), Gaps = 22/230 (9%)

Query: 1   MSASLINRSLTTIRTELDFLRESEVISEETFQQISNSLPQRYDPNANGNRSSSPSLEYVE 60
           MSASLINRSLTTIRTELDFL+ES VIS + F QI+ SLP R++P++    +SS SLEYVE
Sbjct: 1   MSASLINRSLTTIRTELDFLKESNVISSDVFDQINKSLPVRWNPSSAARDTSSASLEYVE 60

Query: 61  AIYAFQAQQDGDLNLKPGDKIQVLEKPSSEWYKGKCNGSVGMFPSNYVKPAFSGSNGFTX 120
           A+Y F  QQDGDL LKPGDK+Q+LEK S EWYKG CNG VG+FP+NYVKPAFSGSNG + 
Sbjct: 61  ALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSCNGRVGIFPANYVKPAFSGSNGSSN 120

Query: 121 XXXXXXXXXXXXXXXXXXTVXXXXXXXXXXXXXXXXXXFPPPSTGFXXXXXXXXXXXXXX 180
                                                 FPPPST +              
Sbjct: 121 LPPPPQYKAQELQQAPTQN---------SAVSSYQQQPFPPPSTNYYQQPQQQPQQAPPQ 171

Query: 181 XXXXXXXXAPEQHAGHNGSQAFKKFGSKLGNAAIFGAGATIGSDIVNSIF 230
                     +Q + HN     K FGSKLGNAAIFGAGA+IGSDIVNSIF
Sbjct: 172 ----------QQPSSHN---HLKSFGSKLGNAAIFGAGASIGSDIVNSIF 208

>Smik_16.406 Chr16 (706485..707123) [639 bp, 212 aa] {ON} YPR154W
           (REAL)
          Length = 212

 Score =  207 bits (526), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 119/230 (51%), Positives = 133/230 (57%), Gaps = 18/230 (7%)

Query: 1   MSASLINRSLTTIRTELDFLRESEVISEETFQQISNSLPQRYDPNANGNRSSSPSLEYVE 60
           MSASLINRSLT IRTELDFL+ES VIS + F QI+ SLP R+DP +    +SS SLEYVE
Sbjct: 1   MSASLINRSLTNIRTELDFLKESNVISNDVFDQINKSLPMRWDPPSASRNTSSTSLEYVE 60

Query: 61  AIYAFQAQQDGDLNLKPGDKIQVLEKPSSEWYKGKCNGSVGMFPSNYVKPAFSGSNGFTX 120
           A+Y F  QQDGDL LKPGDKIQ+LEK S EWYKG CNG  G+FP+NYVKPAFSGSNG + 
Sbjct: 61  ALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWYKGSCNGRTGIFPANYVKPAFSGSNGQSN 120

Query: 121 XXXXXXXXXXXXXXXXXXTVXXXXXXXXXXXXXXXXXXFPPPSTGFXXXXXXXXXXXXXX 180
                                                 FPPPST +              
Sbjct: 121 LPPPPQYKAQELQPVPTQN---------SAVSSYQQQPFPPPSTNYYQQPQQAPAPAPQQ 171

Query: 181 XXXXXXXXAPEQHAGHNGSQAFKKFGSKLGNAAIFGAGATIGSDIVNSIF 230
                     +Q    N     K FGSKLGNAAIFGAGA+IGSDIVNSIF
Sbjct: 172 Q---------QQQQQPNSHNHLKSFGSKLGNAAIFGAGASIGSDIVNSIF 212

>YPR154W Chr16 (834565..835212) [648 bp, 215 aa] {ON}  PIN3Protein
           that induces appearance of [PIN+] prion when
           overproduced
          Length = 215

 Score =  201 bits (511), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 116/231 (50%), Positives = 134/231 (58%), Gaps = 17/231 (7%)

Query: 1   MSASLINRSLTTIRTELDFLRESEVISEETFQQISNSLPQRYDPNANGNRSSSP-SLEYV 59
           MSASLINRSLT IRTELDFL+ S VIS + + QI+ SLP ++DP AN  R++SP SLEYV
Sbjct: 1   MSASLINRSLTNIRTELDFLKGSNVISNDVYDQINKSLPAKWDP-ANAPRNASPASLEYV 59

Query: 60  EAIYAFQAQQDGDLNLKPGDKIQVLEKPSSEWYKGKCNGSVGMFPSNYVKPAFSGSNGFT 119
           EA+Y F  QQDGDL LKPGDK+Q+LEK S EWYKG CNG  G+FP+NYVKPAFSGSNG +
Sbjct: 60  EALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSCNGRTGIFPANYVKPAFSGSNGPS 119

Query: 120 XXXXXXXXXXXXXXXXXXXTVXXXXXXXXXXXXXXXXXXFPPPSTGFXXXXXXXXXXXXX 179
                                                  FPPPST +             
Sbjct: 120 NLPPPPQYKAQELQQIPTQN---------SAASSYQQQPFPPPSTNYYQQPQQQPQQAPP 170

Query: 180 XXXXXXXXXAPEQHAGHNGSQAFKKFGSKLGNAAIFGAGATIGSDIVNSIF 230
                        H+        K FGSKLGNAAIFGAGA+IGSDIVN+IF
Sbjct: 171 PQQQQQQQQHQSSHS------HLKSFGSKLGNAAIFGAGASIGSDIVNNIF 215

>TPHA0A05720 Chr1 (1293214..1293876) [663 bp, 220 aa] {ON} Anc_3.501
           YPR154W
          Length = 220

 Score =  197 bits (502), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 117/237 (49%), Positives = 136/237 (57%), Gaps = 24/237 (10%)

Query: 1   MSASLINRSLTTIRTELDFLRESEVISEETFQQISNSLPQRYDPN-------ANGNRSSS 53
           MS SLINRSLTTIRTEL+FL+ES+VIS+  F++I++SLP+RYDP+       A   R S+
Sbjct: 1   MSTSLINRSLTTIRTELEFLKESKVISDSVFKEINSSLPERYDPSNAPSMLSATTTRDST 60

Query: 54  PSLEYVEAIYAFQAQQDGDLNLKPGDKIQVLEKPSSEWYKGKCNGSVGMFPSNYVKPAFS 113
            +LEYVEAIY F  QQDGDL ++PGDKIQVLEK S EWYKG CNG VG+FPSNY KPAFS
Sbjct: 61  -ALEYVEAIYRFDPQQDGDLAIQPGDKIQVLEKISPEWYKGSCNGKVGVFPSNYTKPAFS 119

Query: 114 GSNGFTXXXXXXXXXXXXXXXXXXXTVXXXXXXXXXXXXXXXXXXFPPPSTGFXXXXXXX 173
           GS                                           FPP ST +       
Sbjct: 120 GSTN---------ASKSELTPVPPQYQQQQQPIQQVQSYHSYQQPFPPQSTNYYQQAPQQ 170

Query: 174 XXXXXXXXXXXXXXXAPEQHAGHNGSQAFKKFGSKLGNAAIFGAGATIGSDIVNSIF 230
                            + H+  N  +  K FGSKLGNAAIFGAGATIGSDIVNSIF
Sbjct: 171 QQQQQQPEQQQQ-----QHHS--NTGKHLKSFGSKLGNAAIFGAGATIGSDIVNSIF 220

>Suva_16.482 Chr16 (830850..831557) [708 bp, 235 aa] {ON} YPR154W
           (REAL)
          Length = 235

 Score =  193 bits (491), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 110/230 (47%), Positives = 132/230 (57%), Gaps = 13/230 (5%)

Query: 1   MSASLINRSLTTIRTELDFLRESEVISEETFQQISNSLPQRYDPNANGNRSSSPSLEYVE 60
           MSASL+NRSLT IRTELDFL+ES VIS++ F QI+ SLP ++DP++    S+S SLEYVE
Sbjct: 19  MSASLVNRSLTNIRTELDFLKESNVISDDVFDQINKSLPVKWDPSSAPRGSNSASLEYVE 78

Query: 61  AIYAFQAQQDGDLNLKPGDKIQVLEKPSSEWYKGKCNGSVGMFPSNYVKPAFSGSNGFTX 120
           A+Y F  QQDGDL LK GDK+Q+LEK S EWYKG CNG  G+FP+NYVKP FS S+G   
Sbjct: 79  AVYQFDPQQDGDLGLKQGDKVQLLEKLSPEWYKGSCNGRTGIFPANYVKPVFSDSDG--- 135

Query: 121 XXXXXXXXXXXXXXXXXXTVXXXXXXXXXXXXXXXXXXFPPPSTGFXXXXXXXXXXXXXX 180
                                                 FPPPST +              
Sbjct: 136 ------QHRLPPPPQYKAQELQQIPTQNSNVSSYQPQPFPPPSTNYYQQPLQQPQLQPQQ 189

Query: 181 XXXXXXXXAPEQHAGHNGSQAFKKFGSKLGNAAIFGAGATIGSDIVNSIF 230
                     +  + ++     K FGSKLGNAAIFGAGA+IGSDIVNSIF
Sbjct: 190 PPPPQQQQQQQSSSNNH----LKSFGSKLGNAAIFGAGASIGSDIVNSIF 235

>KNAG0A07990 Chr1 (1272958..1273623) [666 bp, 221 aa] {ON} Anc_3.501
           YPR154W
          Length = 221

 Score =  192 bits (488), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 95/120 (79%), Positives = 102/120 (85%), Gaps = 6/120 (5%)

Query: 1   MSASLINRSLTTIRTELDFLRESEVISEETFQQISNSLPQRYDPNA-NGNRS-----SSP 54
           MSASLINRSLT +RTELDFLRESEVISEETF +I +SLPQ+YDPN  N NRS     S  
Sbjct: 1   MSASLINRSLTNVRTELDFLRESEVISEETFNKIMHSLPQKYDPNQHNDNRSRDSSESHA 60

Query: 55  SLEYVEAIYAFQAQQDGDLNLKPGDKIQVLEKPSSEWYKGKCNGSVGMFPSNYVKPAFSG 114
            LEYVEA+YAFQ QQDGDL L+PGDKIQVLEKPS+EWYKGKC G VGMFPSNYVKPAFSG
Sbjct: 61  KLEYVEALYAFQPQQDGDLELRPGDKIQVLEKPSAEWYKGKCGGQVGMFPSNYVKPAFSG 120

 Score = 61.6 bits (148), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 29/30 (96%), Positives = 30/30 (100%)

Query: 201 AFKKFGSKLGNAAIFGAGATIGSDIVNSIF 230
           AFKKFGS+LGNAAIFGAGATIGSDIVNSIF
Sbjct: 192 AFKKFGSQLGNAAIFGAGATIGSDIVNSIF 221

>NDAI0B05920 Chr2 (1429564..1430271) [708 bp, 235 aa] {ON} Anc_3.501
          Length = 235

 Score =  185 bits (469), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 89/117 (76%), Positives = 100/117 (85%), Gaps = 2/117 (1%)

Query: 1   MSASLINRSLTTIRTELDFLRESEVISEETFQQISNSLPQRYDPNANGNRSSS--PSLEY 58
           MSASLINRSLT IRTELDFL+ES VISEETF QI+N LPQRYDPN +    SS  P+LEY
Sbjct: 1   MSASLINRSLTNIRTELDFLKESNVISEETFNQINNQLPQRYDPNGSRESVSSQAPTLEY 60

Query: 59  VEAIYAFQAQQDGDLNLKPGDKIQVLEKPSSEWYKGKCNGSVGMFPSNYVKPAFSGS 115
           VEAIY F+ QQ+GDL LK GDKIQV+EKPS EW+KGKCNG VG+FPSNYV+PAFSG+
Sbjct: 61  VEAIYPFEPQQEGDLALKAGDKIQVIEKPSPEWFKGKCNGQVGIFPSNYVRPAFSGT 117

 Score = 62.0 bits (149), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 31/38 (81%), Positives = 32/38 (84%), Gaps = 1/38 (2%)

Query: 193 HAGHNGSQAFKKFGSKLGNAAIFGAGATIGSDIVNSIF 230
           H  H G +  KKFGSKLGNAAIFGAGATIGSDIVNSIF
Sbjct: 199 HHHHTG-EHLKKFGSKLGNAAIFGAGATIGSDIVNSIF 235

>TDEL0D05690 Chr4 (1022136..1022741) [606 bp, 201 aa] {ON} Anc_3.501
           YPR154W
          Length = 201

 Score =  183 bits (464), Expect = 9e-58,   Method: Compositional matrix adjust.
 Identities = 108/230 (46%), Positives = 127/230 (55%), Gaps = 29/230 (12%)

Query: 1   MSASLINRSLTTIRTELDFLRESEVISEETFQQISNSLPQRYDPNANGNRSSSPSLEYVE 60
           MSAS INRSL T+RTELDFLRES VIS+E +  ++ SLPQ          +S+   EY+E
Sbjct: 1   MSASQINRSLATVRTELDFLRESNVISQEIYDMVNQSLPQN---------ASNKGGEYME 51

Query: 61  AIYAFQAQQDGDLNLKPGDKIQVLEKPSSEWYKGKCNGSVGMFPSNYVKPAFSGSNGFTX 120
           A+Y F  QQDGDL L PGDKI+VLEKPS+EW+KG+CNG VGMFP+NYVK A+SGS+    
Sbjct: 52  ALYQFDPQQDGDLALSPGDKIEVLEKPSNEWFKGRCNGRVGMFPANYVKAAYSGSD---- 107

Query: 121 XXXXXXXXXXXXXXXXXXTVXXXXXXXXXXXXXXXXXXFPPPSTGFXXXXXXXXXXXXXX 180
                                                 FPPPST +              
Sbjct: 108 ----------RPSVPPPPQYEQAQRTNTGQSSGSYQQPFPPPSTNYYQQPPQQYQQPQQQ 157

Query: 181 XXXXXXXXAPEQHAGHNGSQAFKKFGSKLGNAAIFGAGATIGSDIVNSIF 230
                       H  HN     KKFGSKLGNAAIFGAGAT+GSD+VNSIF
Sbjct: 158 QPQQEQQQQ---HHSHN---HLKKFGSKLGNAAIFGAGATMGSDLVNSIF 201

>KLTH0G02332g Chr7 complement(184383..185084) [702 bp, 233 aa] {ON}
           similar to uniprot|Q06449 Saccharomyces cerevisiae
           YPR154W PIN3 Protein that induces appearance of [PIN ]
           prion when overproduced
          Length = 233

 Score =  176 bits (445), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 81/115 (70%), Positives = 100/115 (86%)

Query: 1   MSASLINRSLTTIRTELDFLRESEVISEETFQQISNSLPQRYDPNANGNRSSSPSLEYVE 60
           MSAS INRSL+T+RTEL+FLRES+VI+E +++ I ++LP+RYDP+    + S+   E+VE
Sbjct: 1   MSASSINRSLSTVRTELEFLRESDVITENSYRDILSALPERYDPSRGPQQPSATQGEFVE 60

Query: 61  AIYAFQAQQDGDLNLKPGDKIQVLEKPSSEWYKGKCNGSVGMFPSNYVKPAFSGS 115
           AIYAFQAQQDGDLNL+ GDK++VLEKPS EW+KGKCNG VGMFPSNYVKPAFSGS
Sbjct: 61  AIYAFQAQQDGDLNLQVGDKVEVLEKPSPEWFKGKCNGRVGMFPSNYVKPAFSGS 115

 Score = 62.0 bits (149), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 31/38 (81%), Positives = 33/38 (86%), Gaps = 2/38 (5%)

Query: 195 GHN--GSQAFKKFGSKLGNAAIFGAGATIGSDIVNSIF 230
           GH+   S AFKKFG KLGNAA+FGAGATIGSDIVNSIF
Sbjct: 196 GHSSQASSAFKKFGGKLGNAAVFGAGATIGSDIVNSIF 233

>Kwal_47.18905 s47 (1021428..1022138) [711 bp, 236 aa] {ON} YPR154W
           (PIN3) -  [contig 189] FULL
          Length = 236

 Score =  171 bits (434), Expect = 9e-53,   Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 96/117 (82%)

Query: 1   MSASLINRSLTTIRTELDFLRESEVISEETFQQISNSLPQRYDPNANGNRSSSPSLEYVE 60
           MSAS INRSL+T+RTEL+FLRES VI+E +++ I   LP+RY+P  +     S   E+VE
Sbjct: 1   MSASSINRSLSTVRTELEFLRESNVINETSYRDILGMLPERYEPPRSTPTVPSSQSEFVE 60

Query: 61  AIYAFQAQQDGDLNLKPGDKIQVLEKPSSEWYKGKCNGSVGMFPSNYVKPAFSGSNG 117
           AIYAFQAQQDGDLNL+ GDKI+VLEKPS EWYKG+CNG VGMFPSNYVKPAFSGSN 
Sbjct: 61  AIYAFQAQQDGDLNLQVGDKIEVLEKPSPEWYKGRCNGRVGMFPSNYVKPAFSGSNA 117

 Score = 62.0 bits (149), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 31/35 (88%), Positives = 32/35 (91%), Gaps = 1/35 (2%)

Query: 196 HNGSQAFKKFGSKLGNAAIFGAGATIGSDIVNSIF 230
           H G+ AFKKFG KLGNAAIFGAGATIGSDIVNSIF
Sbjct: 203 HTGA-AFKKFGGKLGNAAIFGAGATIGSDIVNSIF 236

>NCAS0F03600 Chr6 (715784..716497) [714 bp, 237 aa] {ON} Anc_3.501
           YGR136W
          Length = 237

 Score =  171 bits (432), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 83/126 (65%), Positives = 98/126 (77%), Gaps = 9/126 (7%)

Query: 1   MSASLINRSLTTIRTELDFLRESEVISEETFQQISNSLPQRYDPNA---------NGNRS 51
           MSAS INRSL TIRTELDFL+ES VIS+ETF QI+++LP +YDP+A         N N+ 
Sbjct: 1   MSASSINRSLATIRTELDFLKESNVISQETFDQITSTLPVKYDPDASRAPSIHSSNNNQP 60

Query: 52  SSPSLEYVEAIYAFQAQQDGDLNLKPGDKIQVLEKPSSEWYKGKCNGSVGMFPSNYVKPA 111
                E+VEAIY F+ QQ GDL LKPGDKI+V+EKPS EW+KG+CNG  GMFPSNYVKPA
Sbjct: 61  QDQGNEFVEAIYPFEPQQQGDLALKPGDKIEVIEKPSPEWFKGRCNGQTGMFPSNYVKPA 120

Query: 112 FSGSNG 117
           FSGS+G
Sbjct: 121 FSGSSG 126

 Score = 62.0 bits (149), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 29/35 (82%), Positives = 30/35 (85%)

Query: 196 HNGSQAFKKFGSKLGNAAIFGAGATIGSDIVNSIF 230
           H+     KKFGSKLGNAAIFGAGATIGSDIVNSIF
Sbjct: 203 HHSHHGLKKFGSKLGNAAIFGAGATIGSDIVNSIF 237

>Kpol_480.8 s480 complement(17610..18329) [720 bp, 239 aa] {ON}
           complement(17610..18329) [720 nt, 240 aa]
          Length = 239

 Score =  166 bits (421), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 80/116 (68%), Positives = 95/116 (81%), Gaps = 2/116 (1%)

Query: 1   MSASLINRSLTTIRTELDFLRESEVISEETFQQISNSLPQRYDPNAN--GNRSSSPSLEY 58
           MS++ INRSLT+++TEL+FLR+S VIS E F QI+N LP R+DP+       +SSP+LEY
Sbjct: 1   MSSASINRSLTSVKTELEFLRDSNVISGEAFDQINNLLPDRHDPSRESLATNNSSPNLEY 60

Query: 59  VEAIYAFQAQQDGDLNLKPGDKIQVLEKPSSEWYKGKCNGSVGMFPSNYVKPAFSG 114
           VEAIY F  QQDGDL ++PGDKIQVLEK S EWYKGKCNG VG+FPSNYVKPAFSG
Sbjct: 61  VEAIYRFDPQQDGDLAIQPGDKIQVLEKISPEWYKGKCNGKVGVFPSNYVKPAFSG 116

 Score = 59.7 bits (143), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 31/34 (91%)

Query: 197 NGSQAFKKFGSKLGNAAIFGAGATIGSDIVNSIF 230
           N S+ FK FGSKLGNAAIFGAGAT+GSD+VNSIF
Sbjct: 206 NASKHFKSFGSKLGNAAIFGAGATLGSDLVNSIF 239

>AFR320W Chr6 (1014675..1015448) [774 bp, 257 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR136W (LSB1) and
           YPR154W (PIN3)
          Length = 257

 Score =  147 bits (372), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 71/114 (62%), Positives = 89/114 (78%)

Query: 1   MSASLINRSLTTIRTELDFLRESEVISEETFQQISNSLPQRYDPNANGNRSSSPSLEYVE 60
           MS++LINRSL TIRTEL FL +S VI+ +  +QI ++LP   +       +++  +EYVE
Sbjct: 1   MSSTLINRSLATIRTELAFLVDSGVITRQQSEQIESNLPNPNEALRGAPANNAGPVEYVE 60

Query: 61  AIYAFQAQQDGDLNLKPGDKIQVLEKPSSEWYKGKCNGSVGMFPSNYVKPAFSG 114
           A+YAFQAQQ GDL+ K G+KI+VLEKPS EWYKG+CNG VGMFPSNYVKPAFSG
Sbjct: 61  ALYAFQAQQPGDLDFKVGEKIEVLEKPSPEWYKGRCNGKVGMFPSNYVKPAFSG 114

 Score = 58.2 bits (139), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 33/40 (82%)

Query: 191 EQHAGHNGSQAFKKFGSKLGNAAIFGAGATIGSDIVNSIF 230
           EQ A    S A KKFGSKLGNAAIFGAGAT+GSD+V+SIF
Sbjct: 218 EQGADSGMSGAAKKFGSKLGNAAIFGAGATLGSDLVHSIF 257

>TBLA0C04530 Chr3 (1097179..1097847) [669 bp, 222 aa] {ON} Anc_3.501
           YPR154W
          Length = 222

 Score =  146 bits (368), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 73/117 (62%), Positives = 90/117 (76%), Gaps = 1/117 (0%)

Query: 1   MSASLINRSLTTIRTELDFLRESEVISEETFQQISNSLPQRYDPNANGNRS-SSPSLEYV 59
           MS+SLIN+SL+TI TELDFL +S  I ++T+ +I + LP+R     +  +S SS + E+V
Sbjct: 1   MSSSLINKSLSTIDTELDFLLKSNAIDKKTYSKIHDLLPRRAPEVPSRQQSNSSKNEEWV 60

Query: 60  EAIYAFQAQQDGDLNLKPGDKIQVLEKPSSEWYKGKCNGSVGMFPSNYVKPAFSGSN 116
           EAIY F  QQDGDL L PGDKI V EKPS EW+KGKCNG VG+FPSNYV+PAFSGSN
Sbjct: 61  EAIYQFDPQQDGDLQLMPGDKILVTEKPSPEWFKGKCNGKVGVFPSNYVRPAFSGSN 117

 Score = 57.8 bits (138), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 30/35 (85%)

Query: 196 HNGSQAFKKFGSKLGNAAIFGAGATIGSDIVNSIF 230
           H+  +  K FGSKLGNAAIFGAGAT+GSD+VNSIF
Sbjct: 188 HHEHKHLKNFGSKLGNAAIFGAGATLGSDLVNSIF 222

>KAFR0G03740 Chr7 (767426..768130) [705 bp, 234 aa] {ON} Anc_3.501
           YPR154W
          Length = 234

 Score =  144 bits (363), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 69/143 (48%), Positives = 94/143 (65%), Gaps = 28/143 (19%)

Query: 1   MSASLINRSLTTIRTELDFLRESEVISEETFQQISNSLPQRYDPNAN------------- 47
           MS++LINR++T I+TELDFLRESE+I+++   +I   LP++YDP++              
Sbjct: 1   MSSALINRAITNIKTELDFLRESEIITQQQLDEILKQLPEKYDPSSKQAQSNEKLPLQTV 60

Query: 48  -----------GNRSSSP----SLEYVEAIYAFQAQQDGDLNLKPGDKIQVLEKPSSEWY 92
                       + S++P     LEYVEA+YAF+ QQ+GDL L  GDK+Q+LEKPS+EWY
Sbjct: 61  NAAANSSSASVDHASATPPPANQLEYVEALYAFEPQQEGDLRLVAGDKVQILEKPSAEWY 120

Query: 93  KGKCNGSVGMFPSNYVKPAFSGS 115
           KG CNG +GMFP+NYVKP    S
Sbjct: 121 KGTCNGQIGMFPANYVKPVTKDS 143

 Score = 57.0 bits (136), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 25/31 (80%), Positives = 29/31 (93%)

Query: 200 QAFKKFGSKLGNAAIFGAGATIGSDIVNSIF 230
           +  K+FGSKLGNAAIFGAGAT+GSD+VNSIF
Sbjct: 204 EQLKRFGSKLGNAAIFGAGATLGSDLVNSIF 234

>Skud_7.447 Chr7 (741615..742331) [717 bp, 238 aa] {ON} YGR136W
           (REAL)
          Length = 238

 Score =  142 bits (358), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 71/115 (61%), Positives = 90/115 (78%), Gaps = 1/115 (0%)

Query: 1   MSASLINRSLTTIRTELDFLRESEVISEETFQQISNSLPQRYDPNANGNRSSSPSLEYVE 60
           MSASLINRSL  IR EL+FL+ES VIS E F  I ++LP ++D N+    ++S + EYVE
Sbjct: 1   MSASLINRSLNNIRNELEFLKESNVISGELFHFIDSNLPGKWDENSKSANNAS-TEEYVE 59

Query: 61  AIYAFQAQQDGDLNLKPGDKIQVLEKPSSEWYKGKCNGSVGMFPSNYVKPAFSGS 115
           A+Y F+AQQDGDL+LK GDKIQ+LEK S +WYKGK N  +G+FP+NYVKPAF+ S
Sbjct: 60  ALYDFEAQQDGDLSLKTGDKIQILEKISLDWYKGKANDMIGIFPANYVKPAFTRS 114

 Score = 55.1 bits (131), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 25/29 (86%), Positives = 28/29 (96%)

Query: 202 FKKFGSKLGNAAIFGAGATIGSDIVNSIF 230
           FK FGSKLG+AAIFGAG+TIGSDI+NSIF
Sbjct: 210 FKSFGSKLGDAAIFGAGSTIGSDIINSIF 238

>YGR136W Chr7 (762428..763153) [726 bp, 241 aa] {ON}  LSB1Protein
           containing an N-terminal SH3 domain; binds Las17p, which
           is a homolog of human Wiskott-Aldrich Syndrome protein
           involved in actin patch assembly and actin
           polymerization
          Length = 241

 Score =  142 bits (358), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 68/115 (59%), Positives = 91/115 (79%), Gaps = 1/115 (0%)

Query: 1   MSASLINRSLTTIRTELDFLRESEVISEETFQQISNSLPQRYDPNANGNRSSSPSLEYVE 60
           MSASL+NRSL  IR EL+FL+ES VIS + F+ I++ LP+++D N    +++  + EYVE
Sbjct: 1   MSASLVNRSLKNIRNELEFLKESNVISGDIFELINSKLPEKWDGNQRSPQNAD-TEEYVE 59

Query: 61  AIYAFQAQQDGDLNLKPGDKIQVLEKPSSEWYKGKCNGSVGMFPSNYVKPAFSGS 115
           A+Y F+AQQDGDL+LK GDKIQVLEK S +WY+GK N  +G+FP+NYVKPAF+ S
Sbjct: 60  ALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYRGKSNNKIGIFPANYVKPAFTRS 114

 Score = 60.8 bits (146), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 31/41 (75%), Positives = 34/41 (82%), Gaps = 2/41 (4%)

Query: 190 PEQHAGHNGSQAFKKFGSKLGNAAIFGAGATIGSDIVNSIF 230
           P+Q +G   S AFK FGSKLGNAAIFGAG+ IGSDIVNSIF
Sbjct: 203 PQQSSG--ASSAFKSFGSKLGNAAIFGAGSAIGSDIVNSIF 241

>Smik_6.232 Chr6 (380319..381044) [726 bp, 241 aa] {ON} YGR136W
           (REAL)
          Length = 241

 Score =  141 bits (356), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 69/115 (60%), Positives = 89/115 (77%), Gaps = 1/115 (0%)

Query: 1   MSASLINRSLTTIRTELDFLRESEVISEETFQQISNSLPQRYDPNANGNRSSSPSLEYVE 60
           MSA+L+NRSL  IR EL+FLRES VIS + F  I++ LP++++ N     ++  + EYVE
Sbjct: 1   MSATLVNRSLKNIRNELEFLRESNVISGDIFDLINSKLPEKWNDNTRSPNNAD-TEEYVE 59

Query: 61  AIYAFQAQQDGDLNLKPGDKIQVLEKPSSEWYKGKCNGSVGMFPSNYVKPAFSGS 115
           A+Y F+AQQDGDL+LK GDKIQVLEK S +WYKGK N  VG+FP+NYVKPAF+ S
Sbjct: 60  ALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKGKANNRVGIFPANYVKPAFTRS 114

 Score = 55.5 bits (132), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 26/29 (89%), Positives = 27/29 (93%)

Query: 202 FKKFGSKLGNAAIFGAGATIGSDIVNSIF 230
           FK FGSKLGNAAIFGAG+ IGSDIVNSIF
Sbjct: 213 FKSFGSKLGNAAIFGAGSAIGSDIVNSIF 241

>CAGL0F04829g Chr6 (487684..488292) [609 bp, 202 aa] {ON} similar to
           uniprot|Q06449 Saccharomyces cerevisiae YPR154w
          Length = 202

 Score =  139 bits (350), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 73/117 (62%), Positives = 83/117 (70%), Gaps = 8/117 (6%)

Query: 1   MSASLINRSLTTIRTELDFLRESEVISEETFQQISNSLPQRYDPNANGNRSSSP--SLEY 58
           MS S INRSL  IR ELDFLRES VISE  F++I   LP      +NG     P  SLEY
Sbjct: 1   MSQSAINRSLNNIRNELDFLRESNVISEGCFKEIMMKLP------SNGASPVPPPMSLEY 54

Query: 59  VEAIYAFQAQQDGDLNLKPGDKIQVLEKPSSEWYKGKCNGSVGMFPSNYVKPAFSGS 115
           VEA+Y FQ QQDGDL ++ GDKIQVLEKPS+EWY+G  NG  GMFPSNYV+PA + S
Sbjct: 55  VEALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTVNGREGMFPSNYVRPAAAPS 111

 Score = 57.8 bits (138), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 28/37 (75%), Positives = 31/37 (83%), Gaps = 3/37 (8%)

Query: 194 AGHNGSQAFKKFGSKLGNAAIFGAGATIGSDIVNSIF 230
           + HNG    K FGSKLGNAAIFGAGAT+GSD+VNSIF
Sbjct: 169 SAHNG---LKSFGSKLGNAAIFGAGATLGSDLVNSIF 202

>Suva_7.424 Chr7 (732619..733368) [750 bp, 249 aa] {ON} YGR136W
           (REAL)
          Length = 249

 Score =  140 bits (352), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 69/115 (60%), Positives = 89/115 (77%), Gaps = 1/115 (0%)

Query: 1   MSASLINRSLTTIRTELDFLRESEVISEETFQQISNSLPQRYDPNANGNRSSSPSLEYVE 60
           MSASLINRSL  IR ELDFL+ESEVIS++ F  I++ LP+++D N     ++S   E+VE
Sbjct: 1   MSASLINRSLKNIRNELDFLKESEVISDDIFNLINSKLPEKWDVNLRPVPNASVE-EFVE 59

Query: 61  AIYAFQAQQDGDLNLKPGDKIQVLEKPSSEWYKGKCNGSVGMFPSNYVKPAFSGS 115
           A+Y F+ QQ+GDL LK GDKIQ+LEK S +WY+GK N  VG+FP+NYVKPAF+ S
Sbjct: 60  ALYDFEPQQEGDLPLKTGDKIQILEKISPDWYRGKANNRVGIFPANYVKPAFARS 114

 Score = 58.2 bits (139), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 28/33 (84%), Positives = 30/33 (90%)

Query: 198 GSQAFKKFGSKLGNAAIFGAGATIGSDIVNSIF 230
            S AFK FGSKLGNAAIFGAG+TIGSDIV+SIF
Sbjct: 217 ASSAFKSFGSKLGNAAIFGAGSTIGSDIVHSIF 249

>KLLA0E03873g Chr5 complement(354700..355362) [663 bp, 220 aa] {ON}
           similar to uniprot|Q06449 Saccharomyces cerevisiae
           YPR154W PIN3 Protein that induces appearance of [PIN ]
           prion when overproduced
          Length = 220

 Score =  117 bits (292), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 56/104 (53%), Positives = 73/104 (70%), Gaps = 1/104 (0%)

Query: 6   INRSLTTIRTELDFLRESEVISEETFQQISNSLPQRYDPNANGNRSSSPSLEYVEAIYAF 65
           +  S+ TI++EL +L+E   ++E  ++ I + LP R  P      +   + E VEA+YAF
Sbjct: 4   VEESVATIKSELKYLKEQGALAELAYKDIESLLP-RVRPQPPVADTMGQNNEIVEALYAF 62

Query: 66  QAQQDGDLNLKPGDKIQVLEKPSSEWYKGKCNGSVGMFPSNYVK 109
           Q QQDGDL LKPGDKI++LEK S EWYKGKCNG VG+FPSNYVK
Sbjct: 63  QPQQDGDLALKPGDKIEILEKLSPEWYKGKCNGQVGVFPSNYVK 106

 Score = 67.8 bits (164), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 32/35 (91%), Positives = 33/35 (94%)

Query: 196 HNGSQAFKKFGSKLGNAAIFGAGATIGSDIVNSIF 230
           H GS AFKKFGSKLGNAAIFGAGATIGSD+VNSIF
Sbjct: 186 HQGSAAFKKFGSKLGNAAIFGAGATIGSDLVNSIF 220

>KNAG0B00750 Chr2 complement(140620..141273) [654 bp, 217 aa] {ON}
           Anc_3.501 YPR154W
          Length = 217

 Score =  114 bits (285), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 57/120 (47%), Positives = 80/120 (66%), Gaps = 4/120 (3%)

Query: 1   MSASLINRSLTTIRTELDFLRESEVISEETFQQISNSLPQRYDPN---ANGNRSSSPSLE 57
           MS   +NRS+T IRTEL++L ES+VIS +TF + +  LP  +D       G +      E
Sbjct: 1   MSVGSVNRSITNIRTELEYLLESKVISRDTFDEFNRKLPDNWDGKPIGGAGEKHPPHEPE 60

Query: 58  YVEAIYAFQAQQDGDLNLKPGDKIQVLEKPSSEWYKGKCNGSVGMFPSNYVKPA-FSGSN 116
           YVEAI+ ++ Q+  DL L+ GDK+++LEK S++WY+GK  G VG+FPSNYVK   FSG +
Sbjct: 61  YVEAIFRYKPQEKEDLELQVGDKVEILEKLSADWYRGKNKGKVGVFPSNYVKAVKFSGVD 120

 Score = 37.0 bits (84), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 18/34 (52%), Positives = 22/34 (64%)

Query: 196 HNGSQAFKKFGSKLGNAAIFGAGATIGSDIVNSI 229
           H+ S A K    + GN+ +FGAG  IGSDIVN I
Sbjct: 180 HHHSGAGKNLLKQFGNSIVFGAGQRIGSDIVNGI 213

>Ecym_1228 Chr1 complement(473518..474279) [762 bp, 253 aa] {ON}
           similar to Ashbya gossypii AFR320W
          Length = 253

 Score =  114 bits (284), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 68/119 (57%), Positives = 84/119 (70%), Gaps = 5/119 (4%)

Query: 1   MSASLINRSLTTIRTELDFLRESEVISEETFQQISNSLPQRYDPNANGNRSSSPSL--EY 58
           MS+SLINRSL  I+TEL+FL ES VIS+   QQI + L    +P     +++S  +  EY
Sbjct: 1   MSSSLINRSLANIKTELEFLVESNVISQSQSQQILSML---SNPREGTMKAASQQVLKEY 57

Query: 59  VEAIYAFQAQQDGDLNLKPGDKIQVLEKPSSEWYKGKCNGSVGMFPSNYVKPAFSGSNG 117
           VEA+YAF  QQ GDL  K GDKI+VLEKPS++WYKG+ NG VGMFPSNYVK   +  NG
Sbjct: 58  VEALYAFVPQQPGDLEFKVGDKIEVLEKPSADWYKGQHNGRVGMFPSNYVKSLRTLPNG 116

 Score = 56.6 bits (135), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 29/44 (65%), Positives = 35/44 (79%), Gaps = 2/44 (4%)

Query: 189 APEQHAGHN--GSQAFKKFGSKLGNAAIFGAGATIGSDIVNSIF 230
           A EQ  G +  GS  FKKFGSKLGNAA+FGAGAT+GS++V+ IF
Sbjct: 210 AVEQAQGQSSGGSDIFKKFGSKLGNAAVFGAGATMGSELVHHIF 253

>ZYRO0D09702g Chr4 complement(823900..824376) [477 bp, 158 aa] {ON}
           weakly similar to uniprot|Q06449 Saccharomyces
           cerevisiae YPR154W PIN3 Protein that induces appearance
           of [PIN ] prion when overproduced
          Length = 158

 Score =  103 bits (256), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 45/58 (77%), Positives = 51/58 (87%)

Query: 57  EYVEAIYAFQAQQDGDLNLKPGDKIQVLEKPSSEWYKGKCNGSVGMFPSNYVKPAFSG 114
           E+VEAIY F  QQ+GDL L PGDKI+VLEKPS EW++G+CNG VGMFPSNYVKPAFSG
Sbjct: 4   EFVEAIYRFDPQQEGDLALHPGDKIEVLEKPSPEWFRGRCNGRVGMFPSNYVKPAFSG 61

 Score = 54.7 bits (130), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 32/40 (80%), Gaps = 3/40 (7%)

Query: 191 EQHAGHNGSQAFKKFGSKLGNAAIFGAGATIGSDIVNSIF 230
           EQ   H+G     KFGSKLGNAAIFGAGAT+GSD++NSIF
Sbjct: 122 EQGKRHHG---LGKFGSKLGNAAIFGAGATLGSDLINSIF 158

>ZYRO0G20372g Chr7 (1680364..1680816) [453 bp, 150 aa] {ON} weakly
           similar to uniprot|Q06449 Saccharomyces cerevisiae
           YPR154W PIN3 Protein that induces appearance of [PIN ]
           prion when overproduced
          Length = 150

 Score = 87.0 bits (214), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 46/59 (77%)

Query: 57  EYVEAIYAFQAQQDGDLNLKPGDKIQVLEKPSSEWYKGKCNGSVGMFPSNYVKPAFSGS 115
           EYVE +Y F+ Q   DL++KPGDK++V+EK S++WYKGKCNG  GMFP+NYVKP   G 
Sbjct: 15  EYVEVLYEFKPQNKEDLHIKPGDKVEVVEKLSADWYKGKCNGKEGMFPANYVKPVGGGD 73

 Score = 48.9 bits (115), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 29/40 (72%)

Query: 191 EQHAGHNGSQAFKKFGSKLGNAAIFGAGATIGSDIVNSIF 230
           EQ    +   A  K GSKLGNAAIFG GAT+G+D+V+SIF
Sbjct: 111 EQDKPKHRHHALGKVGSKLGNAAIFGVGATLGNDLVDSIF 150

>TBLA0D02910 Chr4 complement(717010..717819) [810 bp, 269 aa] {ON}
           Anc_3.501 YPR154W
          Length = 269

 Score = 86.7 bits (213), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 48/112 (42%), Positives = 69/112 (61%), Gaps = 8/112 (7%)

Query: 6   INRSLTTIRTELDFLRESEVISEETFQQISNSL-PQRYDPNAN-------GNRSSSPSLE 57
           I  + T IR  L+ L +++ ISE  + +I + L  +R  P+A+       G  S     +
Sbjct: 10  IKDAYTEIRRCLELLIDTKEISENDYDEIQDILRHKRRSPSASSYSNPTKGALSPRNGPQ 69

Query: 58  YVEAIYAFQAQQDGDLNLKPGDKIQVLEKPSSEWYKGKCNGSVGMFPSNYVK 109
           YVEAIYA+  +Q GDL L PGD I+V+ K S +WY+G+ NG VG+FP+NYVK
Sbjct: 70  YVEAIYAWSGEQKGDLELCPGDIIEVITKKSPQWYEGRLNGKVGVFPTNYVK 121

>TBLA0A02570 Chr1 complement(622892..624373) [1482 bp, 493 aa] {ON}
           Anc_5.470 YDR388W
          Length = 493

 Score = 62.4 bits (150), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 51/78 (65%), Gaps = 3/78 (3%)

Query: 34  ISNSLPQRYDPNANGNRSSSPSLEYVEAIYAFQAQQDGDLNLKPGDKIQVLEKPS--SEW 91
           ++ S+P  Y  +A G   S+P+ E V A+Y +QAQ +GDL+   G  I+++++ +  +EW
Sbjct: 413 LAGSVPPSYT-SATGVPQSAPAFETVTALYEYQAQAEGDLSFPAGAVIEIVQRTADINEW 471

Query: 92  YKGKCNGSVGMFPSNYVK 109
           + GK NG  G+FP NYVK
Sbjct: 472 WTGKYNGQQGVFPGNYVK 489

>Kpol_1008.25 s1008 complement(50905..52207,52597..52643) [1350 bp,
           449 aa] {ON} complement(50905..52207,52597..52643) [1350
           nt, 450 aa]
          Length = 449

 Score = 60.1 bits (144), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 48/77 (62%), Gaps = 3/77 (3%)

Query: 35  SNSLPQRYDPNANGNRSSSPSLEYVEAIYAFQAQQDGDLNLKPGDKIQVLEKPSS--EWY 92
           S+S P    P+  G R SS + + + A+Y+F  ++ GDL  K GD I +L+K  S  +W+
Sbjct: 372 SHSRPAAEKPSFGGTRQSSSTPKAI-ALYSFAGEESGDLRFKKGDVITILKKSDSQDDWW 430

Query: 93  KGKCNGSVGMFPSNYVK 109
            G+ N S G+FP+NYV+
Sbjct: 431 TGRVNTSEGIFPANYVE 447

>TBLA0B05470 Chr2 complement(1301018..1302637) [1620 bp, 539 aa]
           {ON} Anc_2.502 YHL002W
          Length = 539

 Score = 60.1 bits (144), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 45/75 (60%)

Query: 36  NSLPQRYDPNANGNRSSSPSLEYVEAIYAFQAQQDGDLNLKPGDKIQVLEKPSSEWYKGK 95
           +S+P   +PN   +      ++ V A+Y   A + G+L+ K GD I+V+E+   +W++G 
Sbjct: 222 DSVPNSNNPNQQIDEQKPAVVKRVRAMYDLTASEPGELSFKKGDIIKVIEQVYRDWWRGS 281

Query: 96  CNGSVGMFPSNYVKP 110
             G+VG+FP NYV P
Sbjct: 282 LRGTVGIFPLNYVNP 296

>Smik_8.81 Chr8 complement(117184..118543,118714..118760) [1407 bp,
           468 aa] {ON} YHR016C (REAL)
          Length = 468

 Score = 59.7 bits (143), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 44/69 (63%), Gaps = 5/69 (7%)

Query: 43  DPNANGNRSSSPSLEYVEAIYAFQAQQDGDLNLKPGDKIQVLEKPSS--EWYKGKCNGSV 100
           D  ++G +SS+P+     A+Y F  +Q GDL  K GD I +L+K  S  +W+ G+ NG  
Sbjct: 401 DDESSGAKSSTPT---AVALYNFAGEQSGDLAFKKGDVISILKKSDSQNDWWTGRANGKE 457

Query: 101 GMFPSNYVK 109
           G+FP+NYV+
Sbjct: 458 GIFPANYVR 466

>AEL017W Chr5 (603303..603349,603451..604654) [1251 bp, 416 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YFR024C-A
           (LSB3) and YHR016C (YSC84); 1-intron
          Length = 416

 Score = 59.7 bits (143), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 28/83 (33%), Positives = 49/83 (59%), Gaps = 2/83 (2%)

Query: 28  EETFQQISNSLPQRYDPNANGNRSSSPSLEYVEAIYAFQAQQDGDLNLKPGDKIQVLEKP 87
           E+  Q+ + + P    P+   + +SS ++    A+Y F+ +Q GDL  + GD I +L++ 
Sbjct: 331 EQNSQRRAPARPTSAKPDFGSHSTSSGAIPKAVALYTFKGEQKGDLPFRKGDVIMILKRT 390

Query: 88  SS--EWYKGKCNGSVGMFPSNYV 108
            S  +W+ G+ NG  G+FP+NYV
Sbjct: 391 ESQDDWWTGRINGQEGIFPANYV 413

>Ecym_2747 Chr2 complement(1449887..1451198,1451401..1451447) [1359
           bp, 452 aa] {ON} similar to Ashbya gossypii AEL017W
           1-intron
          Length = 452

 Score = 58.5 bits (140), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 37/51 (72%), Gaps = 2/51 (3%)

Query: 61  AIYAFQAQQDGDLNLKPGDKIQVLEKPSS--EWYKGKCNGSVGMFPSNYVK 109
           A+Y F+ +QDGDL  + GD I +L+K +S  +W+ G+ NG  G+FP+NYV+
Sbjct: 400 ALYTFKGEQDGDLPFRTGDVIAILKKSNSQDDWWTGRVNGQEGIFPANYVE 450

>TPHA0C04020 Chr3 complement(861629..863086) [1458 bp, 485 aa] {ON}
           Anc_2.502 YHL002W
          Length = 485

 Score = 58.5 bits (140), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 53/109 (48%), Gaps = 12/109 (11%)

Query: 20  LRESEVISEETFQQISNSLP------------QRYDPNANGNRSSSPSLEYVEAIYAFQA 67
           LRE EV  E+   ++S S P            Q      NG       +  V A+Y   +
Sbjct: 183 LREFEVEKEKNESKVSQSQPEMQAQTHTQALQQSQILQQNGQPQKPNIIRKVRAMYELIS 242

Query: 68  QQDGDLNLKPGDKIQVLEKPSSEWYKGKCNGSVGMFPSNYVKPAFSGSN 116
           Q++ +L+ + GD I VLE+   +W++G  +G +G+FP NYV P    SN
Sbjct: 243 QEENELSFRKGDVITVLEQVYRDWWRGTLHGKIGIFPLNYVTPIIELSN 291

>NDAI0A04350 Chr1 complement(979014..980393) [1380 bp, 459 aa] {ON}
           Anc_5.470
          Length = 459

 Score = 58.2 bits (139), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 41/60 (68%), Gaps = 2/60 (3%)

Query: 52  SSPSLEYVEAIYAFQAQQDGDLNLKPGDKIQVLEKPS--SEWYKGKCNGSVGMFPSNYVK 109
           ++P +E V A+Y +QAQ  GDL+   G  I+++E+ S  +EW+ GK NG  G+FP NYV+
Sbjct: 396 AAPGVETVTALYDYQAQAAGDLSFPAGAVIEIVERTSDANEWWTGKYNGQQGVFPGNYVQ 455

>TBLA0D04950 Chr4 complement(1216633..1218039) [1407 bp, 468 aa]
           {ON} Anc_1.356 YFR024C-A
          Length = 468

 Score = 58.2 bits (139), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 41/62 (66%), Gaps = 2/62 (3%)

Query: 50  RSSSPSLEYVEAIYAFQAQQDGDLNLKPGDKIQVLEKPSS--EWYKGKCNGSVGMFPSNY 107
           R ++ +L    A+Y F  ++ GDL+ + GD I +++K  S  +W+ G+CNG  G+FP+NY
Sbjct: 405 RQTNNNLPKAVALYTFDGEERGDLSFRKGDIIVIIKKSESQDDWWSGRCNGEEGIFPANY 464

Query: 108 VK 109
           V+
Sbjct: 465 VE 466

>NCAS0A08990 Chr1 complement(1780800..1782036,1782134..1782201)
           [1305 bp, 434 aa] {ON} Anc_1.356 YFR024C-A
          Length = 434

 Score = 57.0 bits (136), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 36/51 (70%), Gaps = 2/51 (3%)

Query: 61  AIYAFQAQQDGDLNLKPGDKIQVLEKPSS--EWYKGKCNGSVGMFPSNYVK 109
           A+Y F  +Q GDL+ + GDKI +L++  S  +W+ G+ NG  G+FP+NYV+
Sbjct: 382 ALYRFTGEQKGDLSFQKGDKITILKRTESQNDWWSGRVNGKEGIFPANYVE 432

>KNAG0C02040 Chr3 complement(397447..398841) [1395 bp, 464 aa] {ON}
           Anc_1.356 YFR024C-A
          Length = 464

 Score = 56.6 bits (135), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 28/64 (43%), Positives = 41/64 (64%), Gaps = 5/64 (7%)

Query: 51  SSSPSLE---YVEAIYAFQAQQDGDLNLKPGDKIQVLEKPSS--EWYKGKCNGSVGMFPS 105
           SSSPS+       A+Y+F  ++ GDL  + GD I VL+K  S  +W+ G+ NG  G+FP+
Sbjct: 399 SSSPSISGAPKAVALYSFTGEESGDLPFRKGDVITVLKKSDSQNDWWTGRVNGREGIFPA 458

Query: 106 NYVK 109
           NYV+
Sbjct: 459 NYVE 462

>KAFR0A00970 Chr1 (181162..182352) [1191 bp, 396 aa] {ON} Anc_1.356
           YFR024C-A
          Length = 396

 Score = 55.8 bits (133), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 31/87 (35%), Positives = 50/87 (57%), Gaps = 13/87 (14%)

Query: 28  EETFQ---QISNSLPQRYDPNANGNRSSSPSLEYVEAIYAFQAQQDGDLNLKPGDKIQVL 84
           EE ++   Q S+ LPQ  D N +G ++         A+Y F  +++GDL  K GD I ++
Sbjct: 316 EELYEHRGQHSDHLPQLSDKNQSGMKAV--------ALYNFGGKEEGDLIFKRGDIIAIV 367

Query: 85  EKPSS--EWYKGKCNGSVGMFPSNYVK 109
           ++  S  +W+ G  NG  G+FP+NYV+
Sbjct: 368 KRSDSQYDWWTGNLNGKEGLFPANYVE 394

>TPHA0O01280 Chr15 complement(252746..254110) [1365 bp, 454 aa] {ON}
           Anc_1.356 YFR024C-A
          Length = 454

 Score = 55.8 bits (133), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 35/51 (68%), Gaps = 2/51 (3%)

Query: 61  AIYAFQAQQDGDLNLKPGDKIQVLEKPSS--EWYKGKCNGSVGMFPSNYVK 109
           A+Y F  ++ GDL+ K GD I +L+K  S  +W+ G+ NG  G+FP+NYV+
Sbjct: 402 ALYTFSGEESGDLSFKKGDVIAILKKSDSQDDWWTGRVNGKEGIFPANYVE 452

>Suva_15.199 Chr15 complement(345409..346735,346904..346950) [1374
           bp, 457 aa] {ON} YHR016C (REAL)
          Length = 457

 Score = 55.8 bits (133), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 34/51 (66%), Gaps = 2/51 (3%)

Query: 61  AIYAFQAQQDGDLNLKPGDKIQVLEKPSS--EWYKGKCNGSVGMFPSNYVK 109
           A+Y F  +Q GDL  K GD I +L+K  S  +W+ G+ NG  G+FP+NYV+
Sbjct: 405 ALYNFAGEQSGDLAFKKGDVITILKKSDSQNDWWTGRVNGKEGIFPANYVR 455

>KLTH0H12980g Chr8 complement(1110123..1111259,1111344..1111406)
           [1200 bp, 399 aa] {ON} similar to Saccharomyces
           cerevisiae YFR024C-A LSB3 or to YHR016C uniprot|P32793
           Saccharomyces cerevisiae YHR016C YSC84
          Length = 399

 Score = 55.8 bits (133), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 45/68 (66%), Gaps = 3/68 (4%)

Query: 44  PNANGNRSSSPSLEYVEAIYAFQAQQDGDLNLKPGDKIQVLEKPSS--EWYKGKCNGSVG 101
           P+A+   +SS + + V A+Y F+ +Q GDL  + GD I +L+K  S  +W+ G+ NG  G
Sbjct: 331 PSAHSRTASSGAPKAV-ALYTFKGEQSGDLPFRKGDVITILKKSESQDDWWTGRNNGQEG 389

Query: 102 MFPSNYVK 109
           +FP+NYV+
Sbjct: 390 IFPANYVE 397

>Kwal_0.371 s0 complement(179002..179655) [654 bp, 217 aa] {ON}
           YFR024C - Hypothetical ORF [contig 89] FULL
          Length = 217

 Score = 54.7 bits (130), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 26/62 (41%), Positives = 38/62 (61%), Gaps = 2/62 (3%)

Query: 50  RSSSPSLEYVEAIYAFQAQQDGDLNLKPGDKIQVLEKPSS--EWYKGKCNGSVGMFPSNY 107
           RS+S       A+Y F  +Q GDL  + GD I +L+K  S  +W+ G+ NG  G+FP+NY
Sbjct: 154 RSTSSGAPKAVALYTFNGEQSGDLPFRKGDVITILKKSESQDDWWTGRNNGQEGIFPANY 213

Query: 108 VK 109
           V+
Sbjct: 214 VE 215

>CAGL0I08965g Chr9 complement(869942..871255) [1314 bp, 437 aa] {ON}
           highly similar to uniprot|P43603 Saccharomyces
           cerevisiae YFR024ca or uniprot|P32793 Saccharomyces
           cerevisiae YHR016c YSC84
          Length = 437

 Score = 55.5 bits (132), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 29/77 (37%), Positives = 44/77 (57%), Gaps = 6/77 (7%)

Query: 35  SNSLPQRYDPNANGNRSSSPSLEYVEAIYAFQAQQDGDLNLKPGDKIQVLEKPSS--EWY 92
           SNS P    P     R +S       A+Y+F  ++ GDL+ + GD I +++K  S  +W+
Sbjct: 363 SNSRPADEPPR----RDASSGAPKAVALYSFAGEEAGDLSFRKGDVITIIKKSDSQNDWW 418

Query: 93  KGKCNGSVGMFPSNYVK 109
            GK NG  G+FP+NYV+
Sbjct: 419 TGKVNGREGIFPANYVE 435

>YHR016C Chr8 complement(136881..138240,138409..138455) [1407 bp,
           468 aa] {ON}  YSC84Actin-binding protein involved in
           bundling of actin filaments and endocytosis of actin
           cortical patches; activity stimulated by Las17p;
           contains SH3 domain similar to Rvs167p
          Length = 468

 Score = 55.5 bits (132), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 34/51 (66%), Gaps = 2/51 (3%)

Query: 61  AIYAFQAQQDGDLNLKPGDKIQVLEKPSS--EWYKGKCNGSVGMFPSNYVK 109
           A+Y F  +Q GDL  K GD I +L+K  S  +W+ G+ NG  G+FP+NYV+
Sbjct: 416 ALYNFAGEQPGDLAFKKGDVITILKKSDSQNDWWTGRTNGKEGIFPANYVR 466

>Skud_8.68 Chr8 complement(118475..119855,120025..120071) [1428 bp,
           475 aa] {ON} YHR016C (REAL)
          Length = 475

 Score = 55.5 bits (132), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 34/51 (66%), Gaps = 2/51 (3%)

Query: 61  AIYAFQAQQDGDLNLKPGDKIQVLEKPSS--EWYKGKCNGSVGMFPSNYVK 109
           A+Y F  +Q GDL  K GD I +L+K  S  +W+ G+ NG  G+FP+NYV+
Sbjct: 423 ALYNFAGEQPGDLAFKKGDAISILKKSDSQNDWWTGRINGKEGIFPANYVR 473

>SAKL0D09702g Chr4 complement(805912..807151,807326..807372) [1287
           bp, 428 aa] {ON} similar to Saccharomyces cerevisiae
           YFR024C-A LSB3 or to YHR016C uniprot|P32793
           Saccharomyces cerevisiae YHR016C YSC84
          Length = 428

 Score = 55.1 bits (131), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 35/51 (68%), Gaps = 2/51 (3%)

Query: 61  AIYAFQAQQDGDLNLKPGDKIQVLEKPSS--EWYKGKCNGSVGMFPSNYVK 109
           A+Y F+ +Q GDL  + GD + +L+K  S  +W+ G+ NG  G+FP+NYV+
Sbjct: 376 ALYTFKGEQSGDLPFRKGDVVTILKKSDSQDDWWTGRVNGQEGIFPANYVE 426

>NDAI0G05960 Chr7 (1474282..1475553) [1272 bp, 423 aa] {ON}
           Anc_1.356
          Length = 423

 Score = 54.3 bits (129), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 29/65 (44%), Positives = 39/65 (60%), Gaps = 7/65 (10%)

Query: 52  SSPSL-----EYVEAIYAFQAQQDGDLNLKPGDKIQVLEKPSS--EWYKGKCNGSVGMFP 104
           SSPS+     E V A+Y F  +Q GDL  K GD I V++K  S  +W+ GK     G+FP
Sbjct: 357 SSPSIGLEKAEKVVALYTFVGEQKGDLAFKKGDIITVIKKTKSQDDWWTGKLGNKEGIFP 416

Query: 105 SNYVK 109
           +NYV+
Sbjct: 417 ANYVE 421

>Smik_7.335 Chr7 complement(563424..564759,564853..564899) [1383 bp,
           460 aa] {ON} YFR024C-A (REAL)
          Length = 460

 Score = 54.3 bits (129), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 35/51 (68%), Gaps = 2/51 (3%)

Query: 61  AIYAFQAQQDGDLNLKPGDKIQVLEKPSS--EWYKGKCNGSVGMFPSNYVK 109
           A+Y+F  ++ GDL  + GD I +L+K  S  +W+ G+ NG  G+FP+NYV+
Sbjct: 408 ALYSFAGEESGDLPFRKGDVITILKKSDSQNDWWTGRVNGREGIFPANYVE 458

>Kpol_1056.37 s1056 (92852..94357) [1506 bp, 501 aa] {ON}
           (92852..94357) [1506 nt, 502 aa]
          Length = 501

 Score = 54.3 bits (129), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 24/59 (40%), Positives = 35/59 (59%)

Query: 59  VEAIYAFQAQQDGDLNLKPGDKIQVLEKPSSEWYKGKCNGSVGMFPSNYVKPAFSGSNG 117
           V A+Y   + +  +L+ K GD I VLE+   +W+KG   G++G+FP NYV P    SN 
Sbjct: 240 VRAMYDLSSNEPDELSFKKGDIITVLEQVYRDWWKGTLRGNIGIFPLNYVTPISDLSNA 298

>YFR024C-A Chr6 complement(201960..203292,203387..203433) [1380 bp,
           459 aa] {ON}  LSB3Protein containing a C-terminal SH3
           domain; binds Las17p, which is a homolog of human
           Wiskott-Aldrich Syndrome protein involved in actin patch
           assembly and actin polymerization
          Length = 459

 Score = 54.3 bits (129), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 35/51 (68%), Gaps = 2/51 (3%)

Query: 61  AIYAFQAQQDGDLNLKPGDKIQVLEKPSS--EWYKGKCNGSVGMFPSNYVK 109
           A+Y+F  ++ GDL  + GD I +L+K  S  +W+ G+ NG  G+FP+NYV+
Sbjct: 407 ALYSFAGEESGDLPFRKGDVITILKKSDSQNDWWTGRVNGREGIFPANYVE 457

>KAFR0C04400 Chr3 (868668..868714,868802..870134) [1380 bp, 459 aa]
           {ON} Anc_1.356 YFR024C-A
          Length = 459

 Score = 54.3 bits (129), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 39/61 (63%), Gaps = 2/61 (3%)

Query: 51  SSSPSLEYVEAIYAFQAQQDGDLNLKPGDKIQVLEKPSS--EWYKGKCNGSVGMFPSNYV 108
           SSS +     A+Y+F  ++ GDL  + GD I +L+K  S  +W+ G+ NG  G+FP+NYV
Sbjct: 397 SSSSNAPKAVALYSFAGEESGDLPFRKGDVITILKKSESQNDWWTGRVNGREGIFPANYV 456

Query: 109 K 109
           +
Sbjct: 457 E 457

>SAKL0G03454g Chr7 (284017..285423) [1407 bp, 468 aa] {ON} some
           similarities with uniprot|P39743 Saccharomyces
           cerevisiae YDR388W RVS167 BAR adaptor protein subunit of
           a complex (Rvs161p-Rvs167p) that regulates actin
           endocytosis and viability following starvation or
           osmotic stress
          Length = 468

 Score = 54.3 bits (129), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 37/58 (63%), Gaps = 2/58 (3%)

Query: 54  PSLEYVEAIYAFQAQQDGDLNLKPGDKIQVLEKPSSE--WYKGKCNGSVGMFPSNYVK 109
           P +E V A+Y +QAQ +GDL    G  I+V+E+ +    W+ G+ NG  G+FP NYV+
Sbjct: 407 PGVETVTALYDYQAQAEGDLTFPVGAIIEVVERTTDTNGWWTGRYNGQQGVFPGNYVQ 464

>NCAS0B07250 Chr2 complement(1371597..1372875,1373026..1373072)
           [1326 bp, 441 aa] {ON} Anc_1.356 YFR024C-A
          Length = 441

 Score = 53.9 bits (128), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 35/51 (68%), Gaps = 2/51 (3%)

Query: 61  AIYAFQAQQDGDLNLKPGDKIQVLEKPSS--EWYKGKCNGSVGMFPSNYVK 109
           A+Y+F  ++ GDL  + GD I +L+K  S  +W+ G+ NG  G+FP+NYV+
Sbjct: 389 ALYSFSGEESGDLPFRKGDVITILKKSESQNDWWTGRVNGREGIFPANYVE 439

>YHR114W Chr8 (338083..339984) [1902 bp, 633 aa] {ON}  BZZ1SH3
           domain protein implicated in the regulation of actin
           polymerization, able to recruit actin polymerization
           machinery through its SH3 domains, colocalizes with
           cortical actin patches and Las17p, interacts with type I
           myosins
          Length = 633

 Score = 53.9 bits (128), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 40/61 (65%), Gaps = 1/61 (1%)

Query: 50  RSSSPSLEYVEAIYAFQAQQDGDLNLKPGDKIQVLE-KPSSEWYKGKCNGSVGMFPSNYV 108
           R S+  +  +EAIYA++AQ D ++++ PGD I V+     S W  G+C+G  G+FP++Y 
Sbjct: 573 RRSTLPVRTMEAIYAYEAQGDDEISIDPGDIITVIRGDDGSGWTYGECDGLKGLFPTSYC 632

Query: 109 K 109
           K
Sbjct: 633 K 633

 Score = 35.4 bits (80), Expect = 0.098,   Method: Compositional matrix adjust.
 Identities = 15/53 (28%), Positives = 30/53 (56%), Gaps = 3/53 (5%)

Query: 60  EAIYAFQAQQDGDLNLKPGDKIQVLEKPS-SEWYK--GKCNGSVGMFPSNYVK 109
           + +YA+  + D ++ + PGDKI ++ + + S W K      G  G+ P+ Y++
Sbjct: 499 KVLYAYVQKDDDEITITPGDKISLVARDTGSGWTKINNDTTGETGLVPTTYIR 551

>TDEL0D02240 Chr4 (431160..431206,431314..432568) [1302 bp, 433 aa]
           {ON} Anc_1.356 YFR024C-A
          Length = 433

 Score = 53.9 bits (128), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 35/51 (68%), Gaps = 2/51 (3%)

Query: 61  AIYAFQAQQDGDLNLKPGDKIQVLEKPSS--EWYKGKCNGSVGMFPSNYVK 109
           A+Y+F  ++ GDL  + GD I +L+K  S  +W+ G+ NG  G+FP+NYV+
Sbjct: 381 ALYSFAGEESGDLPFRKGDVITILKKSESQDDWWTGRVNGREGIFPANYVE 431

>KAFR0D03360 Chr4 complement(658469..659836) [1368 bp, 455 aa] {ON}
           Anc_2.502 YHL002W
          Length = 455

 Score = 53.5 bits (127), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 38/62 (61%)

Query: 51  SSSPSLEYVEAIYAFQAQQDGDLNLKPGDKIQVLEKPSSEWYKGKCNGSVGMFPSNYVKP 110
           S+S  ++ V A+Y F + +  +L+ K GD I VLE+   +W++G   G +G+FP NYV P
Sbjct: 208 STSAGVKKVRAMYDFPSTEADELSFKKGDIIIVLEQVYRDWWRGSLRGRIGIFPLNYVTP 267

Query: 111 AF 112
             
Sbjct: 268 IM 269

>CAGL0K02761g Chr11 (249893..251245) [1353 bp, 450 aa] {ON} similar
           to uniprot|P38753 Saccharomyces cerevisiae YHL002w
          Length = 450

 Score = 53.5 bits (127), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 41/76 (53%)

Query: 35  SNSLPQRYDPNANGNRSSSPSLEYVEAIYAFQAQQDGDLNLKPGDKIQVLEKPSSEWYKG 94
           SNSL           + ++  +  V A+Y   A +  +L+ + GD I VLE+   +W++G
Sbjct: 193 SNSLQDHNQGQQQPQQQTTSGIRRVRALYDLNANEQDELSFRKGDVIVVLEQVYRDWWRG 252

Query: 95  KCNGSVGMFPSNYVKP 110
             +G +G+FP NYV P
Sbjct: 253 SLHGKIGIFPLNYVTP 268

>TDEL0A02780 Chr1 (504696..506051) [1356 bp, 451 aa] {ON} Anc_2.502
           YHL002W
          Length = 451

 Score = 53.5 bits (127), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 41/67 (61%), Gaps = 1/67 (1%)

Query: 45  NANGNRSSSPS-LEYVEAIYAFQAQQDGDLNLKPGDKIQVLEKPSSEWYKGKCNGSVGMF 103
           N    +SS+P+ +  V A+Y   +++  +L+ + GD I VLE+   +W++G   G VG+F
Sbjct: 213 NQGEAKSSAPAVIRKVRAMYDLSSEEPDELSFRKGDVIVVLEQVYRDWWRGTLCGKVGIF 272

Query: 104 PSNYVKP 110
           P NYV P
Sbjct: 273 PLNYVTP 279

>KLLA0A08360g Chr1 complement(739092..740316,740718..740764) [1272
           bp, 423 aa] {ON} similar to Saccharomyces cerevisiae
           YFR024C-A LSB3 or to YHR016C uniprot|P32793
           Saccharomyces cerevisiae YHR016C YSC84
          Length = 423

 Score = 53.1 bits (126), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 35/51 (68%), Gaps = 2/51 (3%)

Query: 61  AIYAFQAQQDGDLNLKPGDKIQVLEKPSS--EWYKGKCNGSVGMFPSNYVK 109
           A+Y F+ ++ GDL  + GD I +++K  S  +W+ G+ NG  G+FP+NYV+
Sbjct: 371 ALYTFKGEESGDLPFRKGDVISIIKKSESQDDWWTGRVNGKEGIFPANYVE 421

>KLLA0B13475g Chr2 complement(1178856..1180382) [1527 bp, 508 aa]
           {ON} similar to uniprot|P38753 Saccharomyces cerevisiae
           YHL002W HSE1 Subunit of the endosomal Vps27p-Hse1p
           complex required for sorting of ubiquitinated membrane
           proteins into intralumenal vesicles prior to vacuolar
           degradation, as well as for recycling of Golgi proteins
           and formation of lumenal membranes
          Length = 508

 Score = 53.5 bits (127), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 35/56 (62%)

Query: 56  LEYVEAIYAFQAQQDGDLNLKPGDKIQVLEKPSSEWYKGKCNGSVGMFPSNYVKPA 111
           +  V A+Y F + +  +L+ K GD I V+E+   +W++G   GSVG+FP NYV P 
Sbjct: 224 IRKVRAMYDFNSTEQDELSFKKGDLICVVEQVYRDWWRGTLAGSVGIFPLNYVTPV 279

>Kpol_440.10 s440 (25697..27109) [1413 bp, 470 aa] {ON}
           (25697..27109) [1413 nt, 471 aa]
          Length = 470

 Score = 53.1 bits (126), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 40/61 (65%), Gaps = 2/61 (3%)

Query: 51  SSSPSLEYVEAIYAFQAQQDGDLNLKPGDKIQVLEKPSS--EWYKGKCNGSVGMFPSNYV 108
           S++P  E   ++Y +QAQ  GDL+   G  I+++E+ ++  EW+ G+ NG  G+FP NYV
Sbjct: 407 SAAPQAETCTSLYEYQAQAAGDLSFPAGVLIEIVERTANVNEWWTGRYNGQQGVFPGNYV 466

Query: 109 K 109
           +
Sbjct: 467 Q 467

>SAKL0E02200g Chr5 complement(171315..172850) [1536 bp, 511 aa] {ON}
           similar to uniprot|P38753 Saccharomyces cerevisiae
           YHL002W HSE1 Subunit of the endosomal Vps27p-Hse1p
           complex required for sorting of ubiquitinated membrane
           proteins into intralumenal vesicles prior to vacuolar
           degradation as well as for recycling of Golgi proteins
           and formation of lumenal membranes
          Length = 511

 Score = 52.8 bits (125), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 34/55 (61%)

Query: 56  LEYVEAIYAFQAQQDGDLNLKPGDKIQVLEKPSSEWYKGKCNGSVGMFPSNYVKP 110
           ++ V A+Y   A +  +L+ K GD I V+E+   +W++G   G VG+FP NYV P
Sbjct: 230 IKRVRAMYDLTATESDELSFKKGDVITVVEQVYRDWWRGNIRGRVGIFPLNYVTP 284

>Smik_8.47 Chr8 (81503..82846) [1344 bp, 447 aa] {ON} YHL002W (REAL)
          Length = 447

 Score = 52.4 bits (124), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 40/73 (54%)

Query: 38  LPQRYDPNANGNRSSSPSLEYVEAIYAFQAQQDGDLNLKPGDKIQVLEKPSSEWYKGKCN 97
           LPQ+ +  +    S    ++ V A+Y     +  +L+ + GD I VLE+   +W+KG   
Sbjct: 196 LPQQRNQPSAHTTSRQTVVKKVRALYDLATNESEELSFRKGDVIIVLEQVYRDWWKGALR 255

Query: 98  GSVGMFPSNYVKP 110
           G +G+FP NYV P
Sbjct: 256 GKMGIFPLNYVTP 268

>KAFR0E03640 Chr5 complement(731325..732650) [1326 bp, 441 aa] {ON}
           Anc_5.470 YDR388W
          Length = 441

 Score = 52.4 bits (124), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 38/56 (67%), Gaps = 2/56 (3%)

Query: 56  LEYVEAIYAFQAQQDGDLNLKPGDKIQVLEKPS--SEWYKGKCNGSVGMFPSNYVK 109
           +E V A+Y +QAQ  GDL+   G  I+++++ +  +EW+ G+ NG  G+FP NYV+
Sbjct: 383 METVTALYEYQAQAAGDLSFPAGAVIEIVQRTANENEWWTGRYNGQQGVFPGNYVQ 438

>Ecym_2316 Chr2 complement(619368..620633) [1266 bp, 421 aa] {ON}
           similar to Ashbya gossypii AFR140C
          Length = 421

 Score = 52.0 bits (123), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 45/79 (56%), Gaps = 4/79 (5%)

Query: 35  SNSLPQRYDPN---ANGNRSSSPSLEYVEAIYAFQAQQDGDLNLKPGDKIQVLEKP-SSE 90
           ++ +P  Y P+   A    S++P+ E   ++YAF AQ   DL       I++L++  SS 
Sbjct: 339 TSDMPPAYSPSPYTAYTTPSTAPAPETCTSLYAFAAQDKADLTFPANAVIEILDRADSSG 398

Query: 91  WYKGKCNGSVGMFPSNYVK 109
           W+ G+ NG  G+FP NYV+
Sbjct: 399 WWTGRYNGQEGLFPGNYVR 417

>Skud_6.108 Chr6 complement(197616..198948,199044..199090) [1380 bp,
           459 aa] {ON} YFR024C-A (REAL)
          Length = 459

 Score = 52.0 bits (123), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 34/51 (66%), Gaps = 2/51 (3%)

Query: 61  AIYAFQAQQDGDLNLKPGDKIQVLEKPSS--EWYKGKCNGSVGMFPSNYVK 109
           A+Y F  ++ GDL  + GD I +L+K  S  +W+ G+ +G  G+FP+NYV+
Sbjct: 407 ALYTFAGEESGDLPFRKGDVITILKKSDSQNDWWTGRVSGREGIFPANYVE 457

>ACR266W Chr3 (838689..840569) [1881 bp, 626 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR114W (BZZ1)
          Length = 626

 Score = 52.0 bits (123), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 27/66 (40%), Positives = 39/66 (59%), Gaps = 1/66 (1%)

Query: 44  PNANGNRSSSPSLEYVEAIYAFQAQQDGDLNLKPGDKIQVLEKPSSE-WYKGKCNGSVGM 102
           P A   R  +  L+ V AIY + AQ D +++++ GD I+VL   +   W  G+ NGS G+
Sbjct: 560 PRAPPPRKGAAPLKTVTAIYDYSAQDDDEISIRAGDVIKVLRGDTGNGWTYGEVNGSKGL 619

Query: 103 FPSNYV 108
           FPSNY 
Sbjct: 620 FPSNYC 625

>KNAG0C04630 Chr3 (908312..909862) [1551 bp, 516 aa] {ON} Anc_5.470
           YDR388W
          Length = 516

 Score = 52.0 bits (123), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 43/71 (60%), Gaps = 5/71 (7%)

Query: 44  PNANGNRSSSP---SLEYVEAIYAFQAQQDGDLNLKPGDKIQVLEKPS--SEWYKGKCNG 98
           P A     ++P    +E V A+Y +QAQ  GDL+   G  I+++++ +  +EW+ G+ NG
Sbjct: 443 PTAQPGMGAAPMPTGVETVTALYDYQAQAAGDLSFPAGATIEIVQRTADVNEWWTGRYNG 502

Query: 99  SVGMFPSNYVK 109
             G+FP NYV+
Sbjct: 503 QQGVFPGNYVQ 513

>ZYRO0B01298g Chr2 (110004..111239) [1236 bp, 411 aa] {ON} similar
           to uniprot|P38753 Saccharomyces cerevisiae YHL002W HSE1
           Subunit of the endosomal Vps27p-Hse1p complex required
           for sorting of ubiquitinated membrane proteins into
           intralumenal vesicles prior to vacuolar degradation as
           well as for recycling of Golgi proteins and formation of
           lumenal membranes
          Length = 411

 Score = 51.6 bits (122), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 33/53 (62%)

Query: 59  VEAIYAFQAQQDGDLNLKPGDKIQVLEKPSSEWYKGKCNGSVGMFPSNYVKPA 111
           V+A+Y   + +  +L  K GD I VLE+   +W++G   GS+G+FP NYV P 
Sbjct: 232 VKALYDLASNEPDELAFKKGDIIVVLEQVYRDWWRGSLRGSIGIFPLNYVTPV 284

>TDEL0A03340 Chr1 (592752..594173) [1422 bp, 473 aa] {ON} Anc_5.470
           YDR388W
          Length = 473

 Score = 52.0 bits (123), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 39/61 (63%), Gaps = 2/61 (3%)

Query: 51  SSSPSLEYVEAIYAFQAQQDGDLNLKPGDKIQVLEKPS--SEWYKGKCNGSVGMFPSNYV 108
           ++ P+   V A+Y +QAQ  GDL+   G  I+V+++    +EW+ G+ NG  G+FP NYV
Sbjct: 409 TAPPAANTVTALYDYQAQAPGDLSFTAGAVIEVVQRTDDPNEWWTGRYNGQQGVFPGNYV 468

Query: 109 K 109
           +
Sbjct: 469 Q 469

>NCAS0A11920 Chr1 (2363750..2365141) [1392 bp, 463 aa] {ON}
           Anc_5.470
          Length = 463

 Score = 51.6 bits (122), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 24/55 (43%), Positives = 36/55 (65%), Gaps = 2/55 (3%)

Query: 57  EYVEAIYAFQAQQDGDLNLKPGDKIQVLEKPS--SEWYKGKCNGSVGMFPSNYVK 109
           E V A+Y +QAQ  GDL+   G  I+++E+    +EW+ G+ NG  G+FP NYV+
Sbjct: 405 ETVTALYEYQAQAAGDLSFPAGAVIEIVERTPDVNEWWTGRYNGQQGVFPGNYVQ 459

>Suva_6.96 Chr6 complement(167266..168586,168693..168739) [1368 bp,
           455 aa] {ON} YFR024C-A (REAL)
          Length = 455

 Score = 51.6 bits (122), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 35/51 (68%), Gaps = 2/51 (3%)

Query: 61  AIYAFQAQQDGDLNLKPGDKIQVLEKPSS--EWYKGKCNGSVGMFPSNYVK 109
           A+++F  ++ GDL  + GD + +L+K  S  +W+ G+ NG  G+FP+NYV+
Sbjct: 403 ALFSFAGEESGDLPFRKGDVVTILKKSDSQNDWWTGRVNGREGIFPANYVE 453

>ZYRO0D11110g Chr4 (939064..940443) [1380 bp, 459 aa] {ON} similar
           to DEHA0G12903g and some similarites with YDR388W
           uniprot|P39743 Saccharomyces cerevisiae YDR388W RVS167
           BAR adaptor protein subunit of a complex (Rvs161p-
           Rvs167p) that regulates actin endocytosis and viability
           following starvation or osmotic stress
          Length = 459

 Score = 51.6 bits (122), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 39/57 (68%), Gaps = 2/57 (3%)

Query: 55  SLEYVEAIYAFQAQQDGDLNLKPGDKIQVLEKP--SSEWYKGKCNGSVGMFPSNYVK 109
           S+E V A+Y +QAQ  GDL+      I+++++   ++EW+ G+ +G VG+FP NYV+
Sbjct: 399 SVETVTALYDYQAQAPGDLSFPANAVIEIVQRTQDTNEWWTGRYHGQVGVFPGNYVQ 455

>NDAI0B04580 Chr2 complement(1138779..1140053) [1275 bp, 424 aa]
           {ON} Anc_1.356
          Length = 424

 Score = 51.2 bits (121), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 34/51 (66%), Gaps = 2/51 (3%)

Query: 61  AIYAFQAQQDGDLNLKPGDKIQVLEKPSS--EWYKGKCNGSVGMFPSNYVK 109
           A+Y+F  ++  DL  + GD I +L+K  S  +W+ G+ NG  G+FP+NYV+
Sbjct: 372 ALYSFAGEETDDLPFRKGDVITILKKSESQNDWWTGRVNGREGIFPANYVE 422

>Ecym_2440 Chr2 (858070..859449) [1380 bp, 459 aa] {ON} similar to
           Ashbya gossypii ABR008C
          Length = 459

 Score = 51.2 bits (121), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 32/53 (60%)

Query: 59  VEAIYAFQAQQDGDLNLKPGDKIQVLEKPSSEWYKGKCNGSVGMFPSNYVKPA 111
           V A+Y+  A +  +L+   GD I V+E+   +W++G   G VG+FP NYV P 
Sbjct: 231 VRAMYSLNASESDELSFVKGDVITVIEQVYKDWWRGTLRGKVGIFPLNYVTPC 283

>KLTH0D06138g Chr4 (544661..546130) [1470 bp, 489 aa] {ON} similar
           to uniprot|P38753 Saccharomyces cerevisiae YHL002W HSE1
           Subunit of the endosomal Vps27p- Hse1p complex required
           for sorting of ubiquitinated membrane proteins into
           intralumenal vesicles prior to vacuolar degradation as
           well as for recycling of Golgi proteins and formation of
           lumenal membranes
          Length = 489

 Score = 51.2 bits (121), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 44/73 (60%), Gaps = 1/73 (1%)

Query: 40  QRYDPNANGNRSSSP-SLEYVEAIYAFQAQQDGDLNLKPGDKIQVLEKPSSEWYKGKCNG 98
           Q++  +++ N S +  ++  V A++    ++  +L+ + GD I V+E+   +W++G+  G
Sbjct: 197 QKHIESSHHNESQTQNTVRKVRALHDLTGRESDELSFRKGDIIVVIEQVYKDWWRGRLRG 256

Query: 99  SVGMFPSNYVKPA 111
            VG+FP NYV P 
Sbjct: 257 RVGIFPLNYVTPV 269

>Skud_4.661 Chr4 (1170843..1172225) [1383 bp, 460 aa] {ON} YDR388W
           (REAL)
          Length = 460

 Score = 51.2 bits (121), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 37/55 (67%), Gaps = 2/55 (3%)

Query: 57  EYVEAIYAFQAQQDGDLNLKPGDKIQVLEKP--SSEWYKGKCNGSVGMFPSNYVK 109
           E V A+Y +QAQ  GDL+   G  I+++++   ++EW+ G+ NG  G+FP NYV+
Sbjct: 402 ETVSALYDYQAQAAGDLSFPAGAVIEIVQRTPDANEWWTGRYNGQQGVFPGNYVQ 456

>TBLA0F03490 Chr6 (859156..859202,859415..860903) [1536 bp, 511 aa]
           {ON} Anc_1.356 YFR024C-A
          Length = 511

 Score = 51.2 bits (121), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 36/51 (70%), Gaps = 2/51 (3%)

Query: 61  AIYAFQAQQDGDLNLKPGDKIQVLEKPSS--EWYKGKCNGSVGMFPSNYVK 109
           A+Y+F  ++ GDL+ + GD I +++K  S  +W+ G+ +G  G+FP+NYV+
Sbjct: 459 ALYSFTGEERGDLSFRKGDVITIIKKSESQNDWWTGRVSGREGIFPANYVE 509

>YHL002W Chr8 (102612..103970) [1359 bp, 452 aa] {ON}  HSE1Subunit
           of the endosomal Vps27p-Hse1p complex required for
           sorting of ubiquitinated membrane proteins into
           intralumenal vesicles prior to vacuolar degradation, as
           well as for recycling of Golgi proteins and formation of
           lumenal membranes
          Length = 452

 Score = 50.8 bits (120), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 32/52 (61%)

Query: 59  VEAIYAFQAQQDGDLNLKPGDKIQVLEKPSSEWYKGKCNGSVGMFPSNYVKP 110
           V A+Y     +  +L+ + GD I VLE+   +W+KG   G++G+FP NYV P
Sbjct: 222 VRALYDLTTNEPDELSFRKGDVITVLEQVYRDWWKGALRGNMGIFPLNYVTP 273

>CAGL0M01650g Chr13 complement(184085..185485) [1401 bp, 466 aa]
           {ON} highly similar to uniprot|P39743 Saccharomyces
           cerevisiae YDR388w RVS167
          Length = 466

 Score = 50.8 bits (120), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 24/56 (42%), Positives = 37/56 (66%), Gaps = 2/56 (3%)

Query: 56  LEYVEAIYAFQAQQDGDLNLKPGDKIQVLEKP--SSEWYKGKCNGSVGMFPSNYVK 109
           +E V A+Y +QAQ  GDL+   G  I+V+++    +EW+ G+ NG  G+FP NYV+
Sbjct: 409 VETVTALYDYQAQAAGDLSFPAGAVIEVVQRTPDVNEWWTGRYNGQQGVFPGNYVQ 464

>Suva_8.51 Chr8 (98991..100361) [1371 bp, 456 aa] {ON} YHL002W
           (REAL)
          Length = 456

 Score = 50.8 bits (120), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 31/52 (59%)

Query: 59  VEAIYAFQAQQDGDLNLKPGDKIQVLEKPSSEWYKGKCNGSVGMFPSNYVKP 110
           V A+Y     +  +L+ + GD I VLE+   +W+KG   G +G+FP NYV P
Sbjct: 226 VRAMYDLSTNEPDELSFRKGDVITVLEQVYRDWWKGALRGRMGIFPLNYVTP 277

>NDAI0K02130 Chr11 (481352..482731) [1380 bp, 459 aa] {ON} Anc_2.502
          Length = 459

 Score = 50.8 bits (120), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 48/106 (45%), Gaps = 23/106 (21%)

Query: 21  RESEVISEETFQQISNSLPQRYDPNANGNRSSSPSLEY---------------VEAIYAF 65
           R ++ IS ++ QQ +N+  Q        N+SS P   Y               V A+Y  
Sbjct: 188 RSTQNISMDSSQQSANTSAQ--------NQSSQPQSNYYYSTEQQQQPTIVRKVRALYDL 239

Query: 66  QAQQDGDLNLKPGDKIQVLEKPSSEWYKGKCNGSVGMFPSNYVKPA 111
                 +L+ K GD I VLE+   +W+KGK     G+FP NYV P 
Sbjct: 240 AGSGSDELSFKKGDVIMVLEQVYKDWWKGKLRDQTGIFPLNYVTPV 285

>AFR140C Chr6 complement(692042..693208) [1167 bp, 388 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR388W
           (RVS167)
          Length = 388

 Score = 50.4 bits (119), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 43/75 (57%), Gaps = 5/75 (6%)

Query: 39  PQRYDPNANGNRSSSPSL----EYVEAIYAFQAQQDGDLNLKPGDKIQVLEKPSSE-WYK 93
           P  Y   + G+ S+SP+     E   A+Y F AQ DGDL+      I++L++  +  W+ 
Sbjct: 310 PPAYSEPSYGSSSASPATTAAPETCIALYDFAAQADGDLSFPVNAIIEILDRSDAAGWWT 369

Query: 94  GKCNGSVGMFPSNYV 108
           G+ NG  G+FP+NYV
Sbjct: 370 GRYNGREGLFPANYV 384

>KLTH0F15114g Chr6 complement(1238921..1240228) [1308 bp, 435 aa]
           {ON} some similarities with uniprot|P39743 Saccharomyces
           cerevisiae YDR388W RVS167 BAR adaptor protein subunit of
           a complex (Rvs161p-Rvs167p) that regulates actin
           endocytosis and viability following starvation or
           osmotic stress
          Length = 435

 Score = 50.4 bits (119), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 24/55 (43%), Positives = 35/55 (63%), Gaps = 2/55 (3%)

Query: 57  EYVEAIYAFQAQQDGDLNLKPGDKIQVLEKPSSE--WYKGKCNGSVGMFPSNYVK 109
           E V A+Y +QAQ +GDL    G  I+V+E+ +    W+ G+ NG  G+FP NYV+
Sbjct: 378 ETVTALYDYQAQAEGDLTFPAGAIIEVVERTNDTNGWWTGRYNGYQGVFPGNYVQ 432

>YDR388W Chr4 (1250186..1251634) [1449 bp, 482 aa] {ON}
           RVS167Actin-associated protein with roles in endocytosis
           and exocytosis; interacts with Rvs161p to regulate actin
           cytoskeleton, endocytosis, and viability following
           starvation or osmotic stress; recruited to bud tips by
           Gyl1p and Gyp5p during polarized growth; homolog of
           mammalian amphiphysin
          Length = 482

 Score = 50.1 bits (118), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 36/55 (65%), Gaps = 2/55 (3%)

Query: 57  EYVEAIYAFQAQQDGDLNLKPGDKIQVLEKP--SSEWYKGKCNGSVGMFPSNYVK 109
           E V A+Y +QAQ  GDL+   G  I+++++    +EW+ G+ NG  G+FP NYV+
Sbjct: 424 ETVTALYDYQAQAAGDLSFPAGAVIEIVQRTPDVNEWWTGRYNGQQGVFPGNYVQ 478

>Smik_8.192 Chr8 (314456..316357) [1902 bp, 633 aa] {ON} YHR114W
           (REAL)
          Length = 633

 Score = 50.4 bits (119), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 39/61 (63%), Gaps = 1/61 (1%)

Query: 50  RSSSPSLEYVEAIYAFQAQQDGDLNLKPGDKIQVLE-KPSSEWYKGKCNGSVGMFPSNYV 108
           R S+  +  +EA+YA++AQ D ++++  GD I V+     S W  G+C+G  G+FP++Y 
Sbjct: 573 RRSTLPIRTLEAMYAYEAQGDDEISIDVGDVITVIRGDDGSGWTYGECDGLKGLFPTSYC 632

Query: 109 K 109
           K
Sbjct: 633 K 633

 Score = 35.8 bits (81), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 15/53 (28%), Positives = 31/53 (58%), Gaps = 3/53 (5%)

Query: 60  EAIYAFQAQQDGDLNLKPGDKIQVLEKPS-SEWYK--GKCNGSVGMFPSNYVK 109
           + +YA+  Q D ++++ PGD+I ++ + + S W K      G  G+ P+ Y++
Sbjct: 499 KVLYAYVKQDDDEISISPGDRISLVARDTGSGWTKINNDSTGESGLVPTTYIR 551

>Smik_4.658 Chr4 (1170707..1172125) [1419 bp, 472 aa] {ON} YDR388W
           (REAL)
          Length = 472

 Score = 50.1 bits (118), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 36/55 (65%), Gaps = 2/55 (3%)

Query: 57  EYVEAIYAFQAQQDGDLNLKPGDKIQVLEKPS--SEWYKGKCNGSVGMFPSNYVK 109
           E V A+Y +QAQ  GDL+   G  I+++++    +EW+ G+ NG  G+FP NYV+
Sbjct: 414 ETVTALYDYQAQAAGDLSFPAGAVIEIVQRTPDVNEWWTGRYNGQQGVFPGNYVQ 468

>TPHA0E01500 Chr5 complement(304130..305503) [1374 bp, 457 aa] {ON}
           Anc_5.470 YDR388W
          Length = 457

 Score = 49.7 bits (117), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 36/55 (65%), Gaps = 2/55 (3%)

Query: 57  EYVEAIYAFQAQQDGDLNLKPGDKIQVLEKPS--SEWYKGKCNGSVGMFPSNYVK 109
           EY  ++Y +QAQ  GDL+   G  IQ++++ +  ++W+ G  NG  G+FP NYV+
Sbjct: 400 EYCTSLYEYQAQAQGDLSFPAGAVIQIVQRSADVNDWWTGVYNGQQGVFPGNYVQ 454

>ZYRO0G00792g Chr7 (61277..61323,61435..62797) [1410 bp, 469 aa]
           {ON} similar to Saccharomyces cerevisiae YFR024C-A LSB3
           or to YHR016C uniprot|P32793 Saccharomyces cerevisiae
           YHR016C YSC84
          Length = 469

 Score = 49.7 bits (117), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%), Gaps = 2/51 (3%)

Query: 61  AIYAFQAQQDGDLNLKPGDKIQVLEKPSS--EWYKGKCNGSVGMFPSNYVK 109
           A+Y F  ++ GDL  + GD I +L+K  S  +W+ G+  G  G+FP+NYV+
Sbjct: 417 ALYTFSGEEYGDLPFRKGDVITILKKSDSQDDWWTGRVGGREGIFPANYVE 467

>ABR008C Chr2 complement(406780..408111) [1332 bp, 443 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YHL002W
          Length = 443

 Score = 49.7 bits (117), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 32/50 (64%)

Query: 59  VEAIYAFQAQQDGDLNLKPGDKIQVLEKPSSEWYKGKCNGSVGMFPSNYV 108
           V+AI+   A +  +L+ K GD I V+E+   +W++G   G VG+FP NYV
Sbjct: 215 VKAIFDLNASEPDELSFKKGDVITVIEQVYKDWWRGLLRGKVGIFPVNYV 264

>TPHA0A02210 Chr1 (455888..457081) [1194 bp, 397 aa] {ON} Anc_1.356
           YFR024C-A
          Length = 397

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 34/51 (66%), Gaps = 2/51 (3%)

Query: 61  AIYAFQAQQDGDLNLKPGDKIQVLEKPSS--EWYKGKCNGSVGMFPSNYVK 109
           A++ F+ +Q GDL+   GD + +L+K  +  +W+ G+ N   G+FP+NYV+
Sbjct: 345 ALFRFKGEQAGDLSFNKGDVVTILKKTDTQNDWWTGRVNNQEGIFPANYVE 395

>Kwal_26.7902 s26 (560454..562052) [1599 bp, 532 aa] {ON} YHL002W
           (HSE1) - Hypothetical ORF [contig 55] FULL
          Length = 532

 Score = 49.7 bits (117), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 34/58 (58%)

Query: 54  PSLEYVEAIYAFQAQQDGDLNLKPGDKIQVLEKPSSEWYKGKCNGSVGMFPSNYVKPA 111
           P +  V A++    +   +L+ + GD I+V+E+   +W++G   G +G+FP NYV P 
Sbjct: 224 PVVRKVRALHDLVGRGSDELSFRKGDVIRVMEQVYRDWWRGSLRGKIGIFPLNYVTPV 281

>Kwal_55.21287 s55 complement(768495..769880) [1386 bp, 461 aa] {ON}
           YDR388W (RVS167) - 1:1 [contig 130] FULL
          Length = 461

 Score = 48.9 bits (115), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 24/55 (43%), Positives = 34/55 (61%), Gaps = 2/55 (3%)

Query: 57  EYVEAIYAFQAQQDGDLNLKPGDKIQVLEKPSSE--WYKGKCNGSVGMFPSNYVK 109
           E V A+Y +QAQ +GDL    G  I+V+E+      W+ G+ NG  G+FP NYV+
Sbjct: 404 ETVTALYDYQAQAEGDLTFPAGAIIEVVERTPDVNGWWTGRYNGYQGVFPGNYVQ 458

>Skud_8.175 Chr8 (311857..313758) [1902 bp, 633 aa] {ON} YHR114W
           (REAL)
          Length = 633

 Score = 48.9 bits (115), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 36/52 (69%), Gaps = 1/52 (1%)

Query: 59  VEAIYAFQAQQDGDLNLKPGDKIQVLE-KPSSEWYKGKCNGSVGMFPSNYVK 109
           +EA+YA++AQ D ++++  GD+I V+     S W  G+C+G  G+FP++Y +
Sbjct: 582 MEAVYAYEAQGDDEMSIDVGDEITVIRGDDGSGWTYGECDGLKGLFPTSYCR 633

 Score = 37.4 bits (85), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 34/59 (57%), Gaps = 3/59 (5%)

Query: 60  EAIYAFQAQQDGDLNLKPGDKIQVLEKPS-SEWYK--GKCNGSVGMFPSNYVKPAFSGS 115
           + +YA+  Q D ++++ PGDKI ++ + + S W K      G  G+ P+ Y++ + + S
Sbjct: 499 KVLYAYVKQDDDEIDITPGDKISLVARDTGSGWTKINNGNTGETGLVPTTYIRVSSAAS 557

>CAGL0A02145g Chr1 (224026..224036,225280..226444) [1176 bp, 391 aa]
           {ON} similar to uniprot|P32793 Saccharomyces cerevisiae
           YHR016c YSC84 and similar to uniprot|P43603
           Saccharomyces cerevisiae YFR024C-A LSB3
          Length = 391

 Score = 48.5 bits (114), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 33/56 (58%), Gaps = 2/56 (3%)

Query: 55  SLEYVEAIYAFQAQQDGDLNLKPGDKIQVLEKPSS--EWYKGKCNGSVGMFPSNYV 108
           S   V A+Y F  QQ GDL+ K  D I V +K  S  +W+ G  +G  G+FP+NYV
Sbjct: 333 SFPKVRALYDFNGQQQGDLSFKKDDIIVVQKKTDSHNDWWYGVAHGVEGVFPANYV 388

>Kwal_47.17894 s47 (597826..599691) [1866 bp, 621 aa] {ON} YHR114W
           (BZZ1) - Myo3/5p-Bee1p-Vrp1p actin assembly complex
           component [contig 204] FULL
          Length = 621

 Score = 48.1 bits (113), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 34/52 (65%), Gaps = 1/52 (1%)

Query: 59  VEAIYAFQAQQDGDLNLKPGDKIQVLEKPS-SEWYKGKCNGSVGMFPSNYVK 109
           VEA+Y++QAQ + + +L  GD I VL+    S W  G+ NG  G+FP++Y K
Sbjct: 570 VEAVYSYQAQGEDETSLTEGDVITVLKADDGSGWTYGEVNGEKGLFPTSYCK 621

 Score = 35.0 bits (79), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 29/51 (56%), Gaps = 3/51 (5%)

Query: 61  AIYAFQAQQDGDLNLKPGDKIQVLEKPS-SEWYKGKCN--GSVGMFPSNYV 108
            +Y +Q Q D ++++ PGD I +L   + S W K K +  G  G+ P+ YV
Sbjct: 495 VLYLYQKQDDDEVSISPGDPITLLVADTGSGWTKIKNDRTGQTGLVPTTYV 545

>KLTH0E09790g Chr5 (881284..883152) [1869 bp, 622 aa] {ON} similar
           to uniprot|P38822 Saccharomyces cerevisiae YHR114W BZZ1
           SH3 domain protein implicated in the regulation of actin
           polymerization able to recruit actin polymerization
           machinery through its SH3 domains colocalizes with
           cortical actin patches and Las17p interacts with type I
           myosins
          Length = 622

 Score = 48.1 bits (113), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 43/75 (57%), Gaps = 1/75 (1%)

Query: 36  NSLPQRYDPNANGNRSSSPSLEYVEAIYAFQAQQDGDLNLKPGDKIQVLEKPS-SEWYKG 94
           N  P+   P A   R S  +   V+A++ ++AQ D +++++ GD I VL+    S W  G
Sbjct: 548 NEKPRSSAPRAPPPRKSGNAARTVKALFDYEAQGDDEISIRQGDLISVLKADDGSGWTYG 607

Query: 95  KCNGSVGMFPSNYVK 109
           + NG  G+FP+NY +
Sbjct: 608 ELNGQKGLFPTNYCQ 622

>Skud_8.43 Chr8 (84125..85489) [1365 bp, 454 aa] {ON} YHL002W (REAL)
          Length = 454

 Score = 47.8 bits (112), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 30/52 (57%)

Query: 59  VEAIYAFQAQQDGDLNLKPGDKIQVLEKPSSEWYKGKCNGSVGMFPSNYVKP 110
           V A+Y     +  +L+ +  D I VLE+   +W+KG   G +G+FP NYV P
Sbjct: 225 VRALYDLSTNEPDELSFRKDDVIIVLEQVYRDWWKGALRGKMGIFPLNYVTP 276

>SAKL0E10780g Chr5 (897714..899591) [1878 bp, 625 aa] {ON} similar
           to uniprot|Q75BK5 Ashbya gossypii ACR266W ACR266Wp and
           some similarites with YHR114W uniprot|P38822
           Saccharomyces cerevisiae YHR114W BZZ1 SH3 domain protein
           implicated in the regulation of actin polymerization
           able to recruit actin polymerization machinery through
           its SH3 domains colocalizes with cortical actin patches
           and Las17p interacts with type I myosins
          Length = 625

 Score = 47.8 bits (112), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 42/68 (61%), Gaps = 3/68 (4%)

Query: 44  PNANGNRSSSPSLEYVEAIYAFQAQQDGDLNLKPGDKIQVLEKPS--SEWYKGKCNGSVG 101
           P+A   R    S+  +EA+Y +QAQ D +L++  G  ++VL KP   S W  G+ +G+ G
Sbjct: 559 PHAPPPRKCVSSVRTIEALYDYQAQGDDELSIYAGSVVKVL-KPDDGSGWTYGELDGAKG 617

Query: 102 MFPSNYVK 109
           +FP++Y K
Sbjct: 618 LFPTSYCK 625

>NCAS0A05080 Chr1 (1011572..1012924) [1353 bp, 450 aa] {ON}
           Anc_2.502
          Length = 450

 Score = 47.4 bits (111), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 31/52 (59%)

Query: 59  VEAIYAFQAQQDGDLNLKPGDKIQVLEKPSSEWYKGKCNGSVGMFPSNYVKP 110
           V A+Y   + +  +L+   GD I VLE+   +W++G   G+ G+FP NYV P
Sbjct: 220 VRALYDLSSPEADELSFVKGDVITVLEQVYKDWWRGTLRGNTGIFPLNYVTP 271

>Kpol_1072.56 s1072 complement(127771..129684) [1914 bp, 637 aa]
           {ON} complement(127771..129684) [1914 nt, 638 aa]
          Length = 637

 Score = 47.8 bits (112), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 37/58 (63%), Gaps = 1/58 (1%)

Query: 53  SPSLEYVEAIYAFQAQQDGDLNLKPGDKIQVLE-KPSSEWYKGKCNGSVGMFPSNYVK 109
           + S+  VEAIY ++A  D +L++  G+ I+V+     S W  G+ NG+ G+FPS+Y K
Sbjct: 580 TASIRTVEAIYDYEAAGDDELSISQGETIKVIRGDDGSGWTYGESNGAKGLFPSSYCK 637

>KNAG0I01580 Chr9 (306534..306580,306733..308431) [1746 bp, 581 aa]
           {ON} Anc_1.356 YFR024C-A
          Length = 581

 Score = 46.2 bits (108), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 36/60 (60%), Gaps = 2/60 (3%)

Query: 52  SSPSLEYVEAIYAFQAQQDGDLNLKPGDKIQVLEKPSS--EWYKGKCNGSVGMFPSNYVK 109
           S P++    A++ F   + GDL  K GD I ++++  S  +W+ G+ N   G+FP+NYV+
Sbjct: 520 SEPNIAKAVALFDFGGAEPGDLTFKKGDVITIIKRSQSQNDWWLGRINEREGLFPANYVE 579

>Suva_15.310 Chr15 (540462..542366) [1905 bp, 634 aa] {ON} YHR114W
           (REAL)
          Length = 634

 Score = 46.2 bits (108), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 38/61 (62%), Gaps = 1/61 (1%)

Query: 50  RSSSPSLEYVEAIYAFQAQQDGDLNLKPGDKIQVLE-KPSSEWYKGKCNGSVGMFPSNYV 108
           R ++  +  +EA YA++A+ D ++++  GD I V+     S W  G+C+G  G+FP++Y 
Sbjct: 574 RRTALPVRTLEAAYAYEAKGDDEMSIDVGDVITVIRGDDGSGWTYGECDGLKGLFPTSYC 633

Query: 109 K 109
           K
Sbjct: 634 K 634

 Score = 36.2 bits (82), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 30/53 (56%), Gaps = 3/53 (5%)

Query: 60  EAIYAFQAQQDGDLNLKPGDKIQVLEKPS-SEWYK--GKCNGSVGMFPSNYVK 109
           + +YA+  Q   ++++ PGDKI ++ + S S W K      G  G+ P+ YV+
Sbjct: 499 KVLYAYSKQDTDEISISPGDKISLVARDSGSGWTKINNDSTGETGLVPTTYVR 551

>KLLA0E03059g Chr5 (281543..282829) [1287 bp, 428 aa] {ON} similar
           to uniprot|P39743 Saccharomyces cerevisiae YDR388W
           RVS167 BAR adaptor protein subunit of a complex
           (Rvs161p-Rvs167p) that regulates actin endocytosis and
           viability following starvation or osmotic stress
          Length = 428

 Score = 45.8 bits (107), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 35/59 (59%), Gaps = 1/59 (1%)

Query: 52  SSPSLEYVEAIYAFQAQQDGDLNLKPGDKIQVLEKPSSE-WYKGKCNGSVGMFPSNYVK 109
           +S  +E   A+Y + AQ +GDL    G  IQV+++  +  W+ G  NG  G+FP NYV+
Sbjct: 366 TSAGVETCTALYDYTAQAEGDLTFPAGAIIQVVDRSDAAGWWVGVYNGVQGVFPGNYVE 424

>TPHA0B02890 Chr2 complement(659614..661518) [1905 bp, 634 aa] {ON}
           Anc_2.159 YHR114W
          Length = 634

 Score = 45.8 bits (107), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 40/67 (59%), Gaps = 1/67 (1%)

Query: 44  PNANGNRSSSPSLEYVEAIYAFQAQQDGDLNLKPGDKIQVLE-KPSSEWYKGKCNGSVGM 102
           P A  +R  + +   V+A+Y ++AQ D ++++  GD I V++    S W  G+ NG  G+
Sbjct: 568 PVAPPSRRKTTTTRKVQALYDYEAQGDDEISISVGDTITVIKGDDGSGWTFGELNGIKGL 627

Query: 103 FPSNYVK 109
           FPS+Y K
Sbjct: 628 FPSSYCK 634

>AGR306C Chr7 complement(1305647..1308418) [2772 bp, 923 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL020C
           (BBC1)
          Length = 923

 Score = 45.4 bits (106), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 38/69 (55%), Gaps = 6/69 (8%)

Query: 49  NRSSSPSLEY-VEAIYAFQAQQDGDLNLKPGDKIQVLEKPSSEWY-----KGKCNGSVGM 102
           N +  P + + V A Y +++  DGDLN + G +I+V+    ++WY      G  N   G+
Sbjct: 2   NAAKEPEVPFDVIAKYTYESIHDGDLNFEDGQRIEVISIEDNQWYYGHFVDGAGNEQEGI 61

Query: 103 FPSNYVKPA 111
           FP NYV+ A
Sbjct: 62  FPKNYVEVA 70

>ZYRO0D17358g Chr4 (1429127..1431133) [2007 bp, 668 aa] {ON} similar
           to uniprot|P15891 Saccharomyces cerevisiae YCR088W ABP1
           Actin-binding protein of the cortical actin cytoskeleton
           important for activation of the Arp2/3 complex that
           plays a key role actin in cytoskeleton organization
          Length = 668

 Score = 45.1 bits (105), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 42/76 (55%), Gaps = 7/76 (9%)

Query: 37  SLPQRYDPNAN--GNRSSSPSLEYVEAIYAFQAQQDGDLNLKPGDKIQVLEKPSSEWYKG 94
           +LP R+  N N  GN SS+PS     A Y + A +D +L  +  DKI  +E    +W+ G
Sbjct: 592 TLPARHVENENESGNTSSNPS---AIAEYDYDAAEDNELTFRENDKIVNIEFVDEDWWLG 648

Query: 95  K--CNGSVGMFPSNYV 108
           +    G  G+FPSNYV
Sbjct: 649 ELGSTGEKGLFPSNYV 664

>Ecym_2308 Chr2 complement(597163..599199) [2037 bp, 678 aa] {ON}
           similar to Ashbya gossypii ABR082W
          Length = 678

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 34/56 (60%), Gaps = 4/56 (7%)

Query: 58  YVEAIYAFQAQQDGD-LNLKPGDKIQVLEKPSSEWYKGKC---NGSVGMFPSNYVK 109
           Y +A+Y+F    + D LN + GD + + EK +++WY G+    NG  G+ P NYVK
Sbjct: 620 YAKALYSFTEPNENDILNFQMGDHLLLTEKLNTDWYIGEVHNSNGRQGLIPMNYVK 675

>KNAG0A06710 Chr1 complement(1045213..1046472) [1260 bp, 419 aa]
           {ON} Anc_2.502 YHL002W
          Length = 419

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 38/75 (50%), Gaps = 1/75 (1%)

Query: 37  SLPQRYD-PNANGNRSSSPSLEYVEAIYAFQAQQDGDLNLKPGDKIQVLEKPSSEWYKGK 95
           +L QR + P      + + +++ V A+Y  +     +L  +  D I V+E+   +W+ G 
Sbjct: 196 NLEQRANQPEVTKRETGTNTIKKVRAMYDLETSDPKELAFRKDDIIVVIEQSYKDWWLGS 255

Query: 96  CNGSVGMFPSNYVKP 110
               VG+FP NYV P
Sbjct: 256 LGRRVGIFPLNYVTP 270

>Ecym_2526 Chr2 (1025422..1026996) [1575 bp, 524 aa] {ON} similar to
           Ashbya gossypii AGL237C
          Length = 524

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 31/51 (60%), Gaps = 2/51 (3%)

Query: 61  AIYAFQAQQDGDLNLKPGDKIQVLEKPSSEWYKG--KCNGSVGMFPSNYVK 109
           A Y ++A +D +L  K GD+I  +E    +W+ G  K  G  G+FPSNYVK
Sbjct: 471 AEYDYEAGEDNELTFKEGDRIIDIEFVDDDWWLGVLKNTGEKGLFPSNYVK 521

>Ecym_5426 Chr5 (877285..879303) [2019 bp, 672 aa] {ON} similar to
           Ashbya gossypii ACR266W
          Length = 672

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 35/60 (58%), Gaps = 1/60 (1%)

Query: 50  RSSSPSLEYVEAIYAFQAQQDGDLNLKPGDKIQVLEKPSSE-WYKGKCNGSVGMFPSNYV 108
           R +  SL  V A+Y + A+   +++++ GD I+V+   +   W  G+  GS G+FPSNY 
Sbjct: 612 RRNPTSLRTVIAVYDYAAKDFDEISIRAGDVIKVIRDDTGNGWTYGEVRGSRGLFPSNYC 671

>KNAG0H03500 Chr8 (652236..654140) [1905 bp, 634 aa] {ON} Anc_2.159
           YHR114W
          Length = 634

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 36/56 (64%), Gaps = 1/56 (1%)

Query: 55  SLEYVEAIYAFQAQQDGDLNLKPGDKIQVLE-KPSSEWYKGKCNGSVGMFPSNYVK 109
           S+  V A YA+ AQ D +L+L+ GD ++V++    S W  G+ +G+ G+ P++Y K
Sbjct: 579 SMRTVTAQYAYVAQGDDELSLEAGDVVKVIKGDDGSGWTYGELDGAKGLIPTSYCK 634

 Score = 33.9 bits (76), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 36/66 (54%), Gaps = 3/66 (4%)

Query: 52  SSPSLEYVEAIYAFQAQQDGDLNLKPGDKIQVLEKPS-SEW--YKGKCNGSVGMFPSNYV 108
           +S S E  + +YA+  Q D ++++ PGD I+++   S S W   +    G+ G+ P+ Y+
Sbjct: 499 ASSSDEENKVLYAYTQQDDDEISVTPGDVIELVTPDSGSGWTQIRNVTTGAEGLVPTTYI 558

Query: 109 KPAFSG 114
               SG
Sbjct: 559 SVRESG 564

>ABR082W Chr2 (537500..539551) [2052 bp, 683 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR032W (HOF1)
          Length = 683

 Score = 42.7 bits (99), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%), Gaps = 4/56 (7%)

Query: 58  YVEAIYAFQAQQDGD-LNLKPGDKIQVLEKPSSEWYKGKC---NGSVGMFPSNYVK 109
           Y  AIY+F    D D L  + GD + + EK +++WY G+    NG  G+ P NYV+
Sbjct: 625 YARAIYSFTEPNDNDILYFEMGDHLLLTEKLNTDWYIGEVHNGNGKQGLIPMNYVE 680

>TDEL0B05220 Chr2 complement(918098..919939) [1842 bp, 613 aa] {ON}
           Anc_2.159 YHR114W
          Length = 613

 Score = 42.4 bits (98), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 37/61 (60%), Gaps = 2/61 (3%)

Query: 50  RSSSPSLEYVEAIYAFQAQQDGDLNLKPGDKIQVLE-KPSSEWYKGKCNGSVGMFPSNYV 108
           R++ P+   ++A Y ++AQ D +L+L P D + V+     S W  G+ NG  G+FP++Y 
Sbjct: 554 RTNMPT-RTMQAQYDYEAQGDDELSLTPNDVVNVIRGDDGSGWTYGELNGEKGLFPTSYC 612

Query: 109 K 109
           +
Sbjct: 613 R 613

>KLLA0F23848g Chr6 (2224951..2226900) [1950 bp, 649 aa] {ON} similar
           to uniprot|P38822 Saccharomyces cerevisiae YHR114W BZZ1
           SH3 domain protein implicated in the regulation of actin
           polymerization able to recruit actin polymerization
           machinery through its SH3 domains colocalizes with
           cortical actin patches and Las17p interacts with type I
           myosins
          Length = 649

 Score = 42.0 bits (97), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 32/49 (65%), Gaps = 1/49 (2%)

Query: 61  AIYAFQAQQDGDLNLKPGDKIQVL-EKPSSEWYKGKCNGSVGMFPSNYV 108
           A Y +Q+Q   +L+L+ GDKI+VL E   + W  G+ NG+ G+FP+ Y 
Sbjct: 600 AAYPYQSQGPDELSLQVGDKIKVLKEDEGNGWTFGELNGTQGLFPTTYC 648

>KAFR0L01580 Chr12 complement(286684..287718) [1035 bp, 344 aa] {ON}
           Anc_7.365 YLR191W
          Length = 344

 Score = 41.6 bits (96), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 42/81 (51%), Gaps = 7/81 (8%)

Query: 36  NSLPQRYDPNANGNRSSSPSLEYVEAIYAFQAQQ-DGDLNLKPGDKIQVLEKPSS----- 89
           N   +R   N N  +     LE+  AIY F  +  + ++NL+ GD + +L K  S     
Sbjct: 239 NERNKRLASNNNNIQLDPTKLEFARAIYNFVPENPNIEVNLQKGDLMAILSKKDSFGNDS 298

Query: 90  EWYKGKC-NGSVGMFPSNYVK 109
           +W+K +  NGSVG  P NY++
Sbjct: 299 QWWKVRTKNGSVGFVPFNYIE 319

>TDEL0E05520 Chr5 (1015520..1020289) [4770 bp, 1589 aa] {ON}
           Anc_4.45 Scer_YGOB_SDC25
          Length = 1589

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 35/63 (55%), Gaps = 5/63 (7%)

Query: 56  LEYVEAIYAFQAQQDGDLNLKPGDKIQVLEKPSSEWYKG---KCNGSV--GMFPSNYVKP 110
           ++ V AI+ +  +   +LNL+ GD I V+ K  S W+ G   + NG V  G FP NY + 
Sbjct: 48  VDVVVAIFDYNRKGKNELNLQQGDTIYVIGKNESGWWDGLSIEANGKVHRGWFPQNYCRS 107

Query: 111 AFS 113
           + S
Sbjct: 108 SHS 110

>KAFR0J02650 Chr10 complement(510356..512017) [1662 bp, 553 aa] {ON}
           Anc_6.366 YCR088W
          Length = 553

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 30/50 (60%), Gaps = 2/50 (4%)

Query: 61  AIYAFQAQQDGDLNLKPGDKIQVLEKPSSEWYKGKC--NGSVGMFPSNYV 108
           A Y ++A +D +L  +  DKI  +E    +W+ G+   NG  G+FPSNYV
Sbjct: 499 AEYDYEAGEDNELTFEENDKIINIEFVDDDWWLGELEKNGEKGLFPSNYV 548

>TBLA0C05560 Chr3 complement(1346488..1348509) [2022 bp, 673 aa]
           {ON} Anc_2.159 YHR114W
          Length = 673

 Score = 40.0 bits (92), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 37/62 (59%), Gaps = 3/62 (4%)

Query: 50  RSSSPSLEYVEAIYAFQAQQDGDLNLKPGDKIQVLEKPS--SEWYKGKCNGSVGMFPSNY 107
           R ++  +  + A+Y ++AQ D +++L  GD I+V+ KP   S W  G+ N    +FP++Y
Sbjct: 608 RRTTVLIRTMVALYPYEAQGDDEMSLAVGDTIKVI-KPDDGSGWTFGELNNKQSLFPTSY 666

Query: 108 VK 109
            K
Sbjct: 667 CK 668

 Score = 39.3 bits (90), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 32/53 (60%), Gaps = 3/53 (5%)

Query: 60  EAIYAFQAQQDGDLNLKPGDKIQVLEKPS-SEWYK--GKCNGSVGMFPSNYVK 109
           + +YA+    D ++++ PGD I V+EK + S W K      G +G+ PS+Y++
Sbjct: 538 KVLYAYTKDDDDEVSINPGDSIDVVEKDTGSGWTKINNHSTGEIGLVPSSYLE 590

>Suva_10.287 Chr10 (509884..511062) [1179 bp, 392 aa] {ON} YLR191W
           (REAL)
          Length = 392

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 39/71 (54%), Gaps = 8/71 (11%)

Query: 47  NGNRSSSPS-LEYVEAIYAFQAQQ-DGDLNLKPGDKIQVLEKPS-----SEWYKGKC-NG 98
           NG+    PS LE+  A+Y F  +    ++ LK GD + +L K       S+W+K +  NG
Sbjct: 304 NGDEPIDPSKLEFARALYDFIPENPQMEVALKKGDLMAILSKKDPLGKDSDWWKVRTKNG 363

Query: 99  SVGMFPSNYVK 109
           S+G  P NY++
Sbjct: 364 SIGYIPYNYIE 374

>KLLA0E06953g Chr5 (629777..630850) [1074 bp, 357 aa] {ON}
           uniprot|Q9P863 Kluyveromyces lactis sho1 Putative
           membrane protein
          Length = 357

 Score = 39.7 bits (91), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 30/52 (57%), Gaps = 2/52 (3%)

Query: 60  EAIYAFQAQQDG--DLNLKPGDKIQVLEKPSSEWYKGKCNGSVGMFPSNYVK 109
           EA+Y +QA Q    +++ + G+ ++V +     W   K NG  G+ PSNYVK
Sbjct: 299 EALYTYQADQTDAYEISFEQGEILRVGDIEGRWWKAKKSNGETGIIPSNYVK 350

>TBLA0D00450 Chr4 (109529..112546) [3018 bp, 1005 aa] {ON} Anc_7.413
           YER114C
          Length = 1005

 Score = 39.7 bits (91), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 29/54 (53%), Gaps = 5/54 (9%)

Query: 61  AIYAFQAQQDGDLNLKPGDKIQVLEKPS---SEWYKG--KCNGSVGMFPSNYVK 109
           A+  +Q + D +LN+ PGDKIQVL   S     WY G        G++P N+ +
Sbjct: 26  AVAEYQKRMDDELNMMPGDKIQVLNDDSLYNDGWYLGINLTTNEKGLYPLNFTQ 79

>Kpol_538.25 s538 (50807..52930) [2124 bp, 707 aa] {ON}
           (50807..52930) [2124 nt, 708 aa]
          Length = 707

 Score = 39.7 bits (91), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 33/64 (51%), Gaps = 6/64 (9%)

Query: 59  VEAIYAFQAQQDGDLNLKPGDKIQVLEKPSSEWYKGKCNG-----SVGMFPSNYVKPAFS 113
           V A+ A++ Q   DL +  GDKI VL      WY G+        + G+FPS++VK    
Sbjct: 11  VVAVQAYEPQFTADLKISKGDKITVLYVEDDRWYYGRYVDKDGFTNSGIFPSSHVK-VIE 69

Query: 114 GSNG 117
           G +G
Sbjct: 70  GKDG 73

>YLR191W Chr12 (537272..538432) [1161 bp, 386 aa] {ON}
           PEX13Integral peroxisomal membrane protein required for
           translocation of peroxisomal matrix proteins, interacts
           with the PTS1 signal recognition factor Pex5p and the
           PTS2 signal recognition factor Pex7p, forms a complex
           with Pex14p and Pex17p
          Length = 386

 Score = 39.3 bits (90), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 40/71 (56%), Gaps = 8/71 (11%)

Query: 47  NGNRSSSPS-LEYVEAIYAFQAQQ-DGDLNLKPGDKIQVLEKPS-----SEWYKGKC-NG 98
           NG+    PS LE+  A+Y F  +  + ++ LK GD + +L K       S+W+K +  NG
Sbjct: 298 NGSEPIDPSKLEFARALYDFVPENPEMEVALKKGDLMAILSKKDPLGRDSDWWKVRTKNG 357

Query: 99  SVGMFPSNYVK 109
           ++G  P NY++
Sbjct: 358 NIGYIPYNYIE 368

>Skud_3.160 Chr3 (249584..251344) [1761 bp, 586 aa] {ON} YCR088W
           (REAL)
          Length = 586

 Score = 39.7 bits (91), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 30/53 (56%), Gaps = 2/53 (3%)

Query: 58  YVEAIYAFQAQQDGDLNLKPGDKIQVLEKPSSEWYKGKC--NGSVGMFPSNYV 108
           +  A Y + A +D +L     DKI  +E    +W+ G+   +GS G+FPSNYV
Sbjct: 530 WATAEYDYDAAEDNELTFVENDKIVNIEFVDDDWWLGELEKDGSKGLFPSNYV 582

>Smik_3.186 Chr3 (264667..266442) [1776 bp, 591 aa] {ON} YCR088W
           (REAL)
          Length = 591

 Score = 39.7 bits (91), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 30/53 (56%), Gaps = 2/53 (3%)

Query: 58  YVEAIYAFQAQQDGDLNLKPGDKIQVLEKPSSEWYKGKC--NGSVGMFPSNYV 108
           +  A Y + A +D +L     DKI  +E    +W+ G+   +GS G+FPSNYV
Sbjct: 535 WATAEYDYDAAEDNELTFVENDKIINIEFVDDDWWLGELEKDGSKGLFPSNYV 587

>Kpol_325.12 s325 (19571..21283) [1713 bp, 570 aa] {ON}
           (19571..21283) [1713 nt, 571 aa]
          Length = 570

 Score = 39.3 bits (90), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 28/50 (56%), Gaps = 2/50 (4%)

Query: 61  AIYAFQAQQDGDLNLKPGDKIQVLEKPSSEWYKGKC--NGSVGMFPSNYV 108
           A Y + A +D +L    GDKI  +E    +W+ G+    G  G+FPSNYV
Sbjct: 517 AEYDYDAAEDNELTFVEGDKIVNIEFVDDDWWLGELEKTGEKGLFPSNYV 566

>CAGL0C03597g Chr3 complement(358731..360473) [1743 bp, 580 aa] {ON}
           similar to uniprot|P15891 Saccharomyces cerevisiae
           YCR088w ABP1
          Length = 580

 Score = 39.3 bits (90), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 30/53 (56%), Gaps = 2/53 (3%)

Query: 58  YVEAIYAFQAQQDGDLNLKPGDKIQVLEKPSSEWYKGKCN--GSVGMFPSNYV 108
           +  A Y ++A +D +L  +  DKI  +E    +W+ G+    G  G+FPSNYV
Sbjct: 523 WATAEYDYEAAEDNELTFEENDKIINIEFVDDDWWLGELEKTGEKGLFPSNYV 575

>Suva_3.124 Chr3 (182459..184261) [1803 bp, 600 aa] {ON} YCR088W
           (REAL)
          Length = 600

 Score = 39.3 bits (90), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 30/53 (56%), Gaps = 2/53 (3%)

Query: 58  YVEAIYAFQAQQDGDLNLKPGDKIQVLEKPSSEWYKGKC--NGSVGMFPSNYV 108
           +  A Y + A +D +L     DKI  +E    +W+ G+   +GS G+FPSNYV
Sbjct: 544 WATAEYDYDAAEDNELTFVENDKIINIEFVDDDWWLGELEKDGSKGLFPSNYV 596

>ZYRO0G10098g Chr7 complement(808399..812577) [4179 bp, 1392 aa]
           {ON} similar to uniprot|P32790 Saccharomyces cerevisiae
           YBL007C SLA1 Cytoskeletal protein binding protein
           required for assembly of the cortical actin cytoskeleton
           contains 3 SH3 domains interacts with proteins
           regulating actin dynamics and with proteins required for
           endocytosis
          Length = 1392

 Score = 39.3 bits (90), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 33/61 (54%), Gaps = 8/61 (13%)

Query: 59  VEAIYAFQAQQDGDLNLKPGDKIQVLEKPS-SEWYKGK-------CNGSVGMFPSNYVKP 110
           V+A+Y ++ Q D +L +K  D + +LEK    EW+  K            G+ PSNYV+P
Sbjct: 8   VKALYDYEPQTDEELAIKEDDILYLLEKSDVDEWWTVKKRVIGLDAEEPTGLVPSNYVEP 67

Query: 111 A 111
           A
Sbjct: 68  A 68

>Smik_13.202 Chr13 (329496..331487) [1992 bp, 663 aa] {ON} YMR032W
           (REAL)
          Length = 663

 Score = 38.9 bits (89), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 34/71 (47%), Gaps = 9/71 (12%)

Query: 54  PSLEYVEAIYAFQAQQD-GDLNLKPGDKIQVLEKPSSEWYKGKC--------NGSVGMFP 104
           P +EY +A+Y     +  G  N   GD I + E  + +WYKG+         N  VG+ P
Sbjct: 593 PVIEYAKAMYPLVGNEAPGLANFHKGDYILITEIVNKDWYKGEVYDNDRINRNHRVGLIP 652

Query: 105 SNYVKPAFSGS 115
            N+++    GS
Sbjct: 653 YNFIQLLHQGS 663

>YCR088W Chr3 (265068..266846) [1779 bp, 592 aa] {ON}
           ABP1Actin-binding protein of the cortical actin
           cytoskeleton, important for activation of the Arp2/3
           complex that plays a key role actin in cytoskeleton
           organization; phosphorylation within its PRR
           (Proline-Rich Region), mediated by Cdc28p and Pho85p,
           protects Abp1p from proteolysis mediated by its own PEST
           sequences
          Length = 592

 Score = 38.9 bits (89), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 30/53 (56%), Gaps = 2/53 (3%)

Query: 58  YVEAIYAFQAQQDGDLNLKPGDKIQVLEKPSSEWYKGKC--NGSVGMFPSNYV 108
           +  A Y + A +D +L     DKI  +E    +W+ G+   +GS G+FPSNYV
Sbjct: 536 WATAEYDYDAAEDNELTFVENDKIINIEFVDDDWWLGELEKDGSKGLFPSNYV 588

>TBLA0I01080 Chr9 (218200..222867) [4668 bp, 1555 aa] {ON} Anc_7.413
           YER114C
          Length = 1555

 Score = 38.9 bits (89), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 37/63 (58%), Gaps = 7/63 (11%)

Query: 49  NRSSSPSLEYVE--AIYAFQAQQDGDLNLKPGDKIQVL---EKPSSEWYKGKC--NGSVG 101
           N +S+P+ +Y     I  +  + D +L++KPGDKIQV+   E+ +  WY GK    G  G
Sbjct: 40  NLTSTPTKKYPMYIVINEYTKRMDDELDMKPGDKIQVITDDEEYNDGWYFGKNLRTGEEG 99

Query: 102 MFP 104
           ++P
Sbjct: 100 LYP 102

>NCAS0A14570 Chr1 complement(2869713..2870780) [1068 bp, 355 aa]
           {ON} Anc_7.419 YER118C
          Length = 355

 Score = 38.5 bits (88), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 31/53 (58%), Gaps = 2/53 (3%)

Query: 59  VEAIYAFQAQQDG--DLNLKPGDKIQVLEKPSSEWYKGKCNGSVGMFPSNYVK 109
           V+A+Y+++A      +L+ + GD ++V +     W   K NG  G+ PSNYVK
Sbjct: 300 VKALYSYKADDSDAYELSFEQGDILKVSDIEGRWWKARKENGQTGIIPSNYVK 352

>TBLA0F00280 Chr6 complement(58186..59916) [1731 bp, 576 aa] {ON}
           Anc_6.366 YCR088W
          Length = 576

 Score = 38.5 bits (88), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 30/51 (58%), Gaps = 2/51 (3%)

Query: 61  AIYAFQAQQDGDLNLKPGDKIQVLEKPSSEWYKGKC--NGSVGMFPSNYVK 109
           A Y ++A +D +L     DKI  +E    +W+ G+   +G  G+FPSNYV+
Sbjct: 523 AQYDYEAAEDNELTFNENDKIINIEFVDDDWWLGELESSGEKGLFPSNYVE 573

>KLLA0E23365g Chr5 complement(2077042..2078760,2078979..2078987)
           [1728 bp, 575 aa] {ON} similar to uniprot|P29366
           Saccharomyces cerevisiae YBR200W BEM1 Protein containing
           SH3-domains involved in establishing cell polarity and
           morphogenesis functions as a scaffold protein for
           complexes that include Cdc24p Ste5p Ste20p and Rsr1p
          Length = 575

 Score = 38.5 bits (88), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 34/58 (58%), Gaps = 4/58 (6%)

Query: 52  SSPSLEYVEAIYAFQAQQDGDLNLKPGDKIQVLEKPSSEWYKGK--CNGSVGMFPSNY 107
           SSP  + ++A+Y +QAQ  G+L+   GD   V ++  ++WY+     +G  GM P NY
Sbjct: 62  SSPE-KVIKALYNYQAQSAGELSFNKGDFFHV-QQEENDWYEASNPADGKRGMVPKNY 117

>ZYRO0B16214g Chr2 (1312950..1314929) [1980 bp, 659 aa] {ON} similar
           to uniprot|P38822 Saccharomyces cerevisiae YHR114W BZZ1
           SH3 domain protein implicated in the regulation of actin
           polymerization able to recruit actin polymerization
           machinery through its SH3 domains colocalizes with
           cortical actin patches and Las17p interacts with type I
           myosins
          Length = 659

 Score = 38.5 bits (88), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 33/60 (55%), Gaps = 2/60 (3%)

Query: 51  SSSPSLEYVEAIYAFQAQQDGDLNLKPGDKIQVL-EKPSSEWYKGKCNGSVGMFPSNYVK 109
           S  PSL  +   Y + AQ++ ++ ++ GD + VL E   S W   + +G  G+ P+NY K
Sbjct: 601 SKKPSL-TLTVQYDYDAQEENEMTVEVGDVVNVLKEDDGSGWTLAELDGDSGLIPTNYCK 659

 Score = 34.3 bits (77), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 33/52 (63%), Gaps = 3/52 (5%)

Query: 61  AIYAFQAQQDGDLNLKPGDKIQVLEKPS-SEWYKGKCN--GSVGMFPSNYVK 109
            +YAF+ + + ++++ PGD I+VL   + S W K + N  G  G+ P++Y++
Sbjct: 526 VVYAFRGRDNDEVSVNPGDSIKVLAPDTGSGWTKLRNNTTGDQGLAPTSYLE 577

>KLLA0A04983g Chr1 complement(445032..448787) [3756 bp, 1251 aa]
           {ON} similar to uniprot|P32790 Saccharomyces cerevisiae
           YBL007C SLA1 Cytoskeletal protein binding protein
           required for assembly of the cortical actin cytoskeleton
           contains 3 SH3 domains interacts with proteins
           regulating actin dynamics and with proteins required for
           endocytosis
          Length = 1251

 Score = 38.5 bits (88), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 36/64 (56%), Gaps = 8/64 (12%)

Query: 56  LEYVEAIYAFQAQQDGDLNLKPGDKIQVLEKPS-SEWY--KGKCNGS-----VGMFPSNY 107
           L   +A+Y + AQ D +L +K GD + +LEK S  +W+  K +  GS     VG+ P  Y
Sbjct: 5   LGVYQALYDYSAQTDEELTVKEGDLLYLLEKSSIDDWWTVKKRVIGSDQDEPVGLVPKTY 64

Query: 108 VKPA 111
           ++ A
Sbjct: 65  IEEA 68

 Score = 35.4 bits (80), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 39/70 (55%), Gaps = 5/70 (7%)

Query: 51  SSSPSL--EYVEAIYAFQAQQDGDLNLKPGDKIQVL-EKPSSEWYKGKC--NGSVGMFPS 105
           +S P++  +  +A+Y F A    +L +K GD I +L ++ S +WY  +    G  G+ P+
Sbjct: 405 ASRPAMTKKRAKAVYDFFANSPDELTVKEGDYINILDDRTSKDWYMCESVETGKRGIVPA 464

Query: 106 NYVKPAFSGS 115
            +V+   SGS
Sbjct: 465 QFVETRGSGS 474

 Score = 30.4 bits (67), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 17/61 (27%), Positives = 30/61 (49%), Gaps = 4/61 (6%)

Query: 53  SPSLEYVEAIYAFQAQQDG--DLNLKPGDKIQVLEKPSSEWY--KGKCNGSVGMFPSNYV 108
           +P +  V A+Y ++  Q+   +L     D  Q+ +   ++W+  K   N  VG  P NYV
Sbjct: 68  APVIGSVVALYDYEQVQNANEELVFHENDTFQLYDDRDADWFLVKNTKNSEVGFVPGNYV 127

Query: 109 K 109
           +
Sbjct: 128 E 128

>Kwal_33.14835 s33 (834951..836105) [1155 bp, 384 aa] {ON} YLR191W
           (PEX13) - Peroxisomal membrane protein that contains Src
           homology 3 (SH3) domain [contig 101] FULL
          Length = 384

 Score = 38.1 bits (87), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 36/73 (49%), Gaps = 7/73 (9%)

Query: 44  PNANGNRSSSPSLEYVEAIYAFQAQQ-DGDLNLKPGDKIQVLEKPS-----SEWYKGKCN 97
           P+A        SLE+  AIY F  +    +L LK GD + V+ K       SEW++ +  
Sbjct: 295 PHATNGSLDPRSLEFARAIYDFTPENPQIELTLKKGDLMAVISKQDPMGNPSEWWRVRTK 354

Query: 98  -GSVGMFPSNYVK 109
            G +G  P NY++
Sbjct: 355 KGDIGYVPYNYLE 367

>NCAS0D04740 Chr4 complement(909728..911512) [1785 bp, 594 aa] {ON}
           Anc_6.366 YCR088W
          Length = 594

 Score = 38.1 bits (87), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 40/81 (49%), Gaps = 9/81 (11%)

Query: 37  SLPQRYD---PNANGNRSSSPSLEYVE----AIYAFQAQQDGDLNLKPGDKIQVLEKPSS 89
           SLP R     P     RS+ P  +  E    A Y ++A +D +L     DKI  +E    
Sbjct: 510 SLPSRNTEAVPPPPPRRSAEPEKKKEEPWAIAEYDYEAGEDNELTFSENDKIINIEFVDD 569

Query: 90  EWYKGKC--NGSVGMFPSNYV 108
           +W+ G+   +G  G+FPSNYV
Sbjct: 570 DWWLGELESSGEKGLFPSNYV 590

>SAKL0A00594g Chr1 complement(68426..70336) [1911 bp, 636 aa] {ON}
           some similarities with uniprot|P15891 Saccharomyces
           cerevisiae YCR088W ABP1 Actin-binding protein of the
           cortical actin cytoskeleton important for activation of
           the Arp2/3 complex that plays a key role actin in
           cytoskeleton organization
          Length = 636

 Score = 38.1 bits (87), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 30/51 (58%), Gaps = 2/51 (3%)

Query: 61  AIYAFQAQQDGDLNLKPGDKIQVLEKPSSEWYKGKCN--GSVGMFPSNYVK 109
           A Y ++A ++ +L    GDKI  +E    +W+ G+    G  G+FPSNYV+
Sbjct: 583 AEYDYEAGEENELTFTEGDKIINIEFVDDDWWLGELEKTGEKGLFPSNYVE 633

>Suva_2.118 Chr2
           complement(206707..206754,206785..206832,206899..207209,
           207250..207279,207310..207393,207427..210403) [3498 bp,
           1166 aa] {ON} YBL007C (REAL)
          Length = 1166

 Score = 38.1 bits (87), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 32/52 (61%), Gaps = 3/52 (5%)

Query: 63  YAFQAQQDGDLNLKPGDKIQVL-EKPSSEWYKGKC--NGSVGMFPSNYVKPA 111
           Y F A+   +L +K GDK+ +L +K SS+W+  +   +G  G+ P+ +V+P 
Sbjct: 354 YDFLAESQDELTIKSGDKVYILDDKKSSDWWMCQLIDSGKSGLVPAQFVEPV 405

>CAGL0E03476g Chr5 complement(319193..323887) [4695 bp, 1564 aa]
           {ON} similar to uniprot|P04821 Saccharomyces cerevisiae
           YLR310c CDC25 GDP/GTP exchange factor for RAS1P and
           RAS2P
          Length = 1564

 Score = 38.1 bits (87), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 35/63 (55%), Gaps = 8/63 (12%)

Query: 56  LEYVEAIYAFQA--QQDGDLNLKPGDKIQVLEKPSSEWYKG-----KCNGSV-GMFPSNY 107
           ++ V   + F A  +++  L+++PGD + VL K  S W+ G     K + +V G FP NY
Sbjct: 19  MDVVVVQFEFNAGNKKEKYLSMQPGDTVYVLAKDQSGWWDGLIIDEKSDKAVRGWFPQNY 78

Query: 108 VKP 110
            KP
Sbjct: 79  TKP 81

>NDAI0B04320 Chr2 (1084783..1086681) [1899 bp, 632 aa] {ON}
           Anc_2.159 YHR114W
          Length = 632

 Score = 37.7 bits (86), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 35/61 (57%), Gaps = 2/61 (3%)

Query: 50  RSSSPSLEYVEAIYAFQAQQDGDLNLKPGDKIQVLE-KPSSEWYKGKCNGSVGMFPSNYV 108
           R++ PS   + A Y++ A  D ++++  GD I V+     S W  G+ NGS G+ P++Y 
Sbjct: 573 RTTMPS-RTLTAAYSYSAAGDDEISINVGDVITVIRGDDGSGWTYGELNGSKGLVPTSYC 631

Query: 109 K 109
           K
Sbjct: 632 K 632

 Score = 33.1 bits (74), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 29/53 (54%), Gaps = 3/53 (5%)

Query: 60  EAIYAFQAQQDGDLNLKPGDKIQVLEKPS-SEWYKGK--CNGSVGMFPSNYVK 109
           + +YA+  Q   ++++ PGD I +L   + S W K +    G  G+ P+ YVK
Sbjct: 497 KVLYAYAKQDTDEISISPGDSISLLAADTGSGWTKIRNDTTGESGLVPTTYVK 549

>NCAS0B06980 Chr2 (1328203..1330122) [1920 bp, 639 aa] {ON}
           Anc_2.159 YHR114W
          Length = 639

 Score = 37.7 bits (86), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 34/60 (56%), Gaps = 2/60 (3%)

Query: 50  RSSSPSLEYVEAIYAFQAQQDGDLNLKPGDKIQVLE-KPSSEWYKGKCNGSVGMFPSNYV 108
           RS+ P+   + A Y + AQ D ++++  GD I V+     S W  G+ NG  G+FP++Y 
Sbjct: 580 RSTLPT-RTMTAKYPYVAQGDDEMSINAGDTISVIRGDDGSGWTYGELNGVKGLFPTSYC 638

 Score = 32.0 bits (71), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 29/61 (47%), Gaps = 3/61 (4%)

Query: 60  EAIYAFQAQQDGDLNLKPGDKIQVLEKPS-SEWYKGK--CNGSVGMFPSNYVKPAFSGSN 116
           + +YA+  Q   ++ + P D I +L   S S W K K    G  G+ P+ Y+K   S   
Sbjct: 510 KVLYAYTKQDSDEITISPQDIITLLAADSGSGWTKIKNETTGESGLVPTTYIKIEESSHR 569

Query: 117 G 117
           G
Sbjct: 570 G 570

>CAGL0C01881g Chr3 (196299..199298) [3000 bp, 999 aa] {ON} similar
           to uniprot|P38041 Saccharomyces cerevisiae YBL085w BOB1
           BEM1 protein-binding protein or uniprot|P39969
           Saccharomyces cerevisiae YER114c BOI2
          Length = 999

 Score = 37.7 bits (86), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 34/58 (58%), Gaps = 6/58 (10%)

Query: 58  YVEAIYAFQAQQDGDLNLKPGDKIQVLEKP---SSEWYKGK--CNGSVGMFPSNYVKP 110
           YV  +  ++ + + ++++KPGDKI+VL         WY+GK      VG++P+ + +P
Sbjct: 5   YV-CVNEYRRRMEDEIDMKPGDKIEVLMDDGEYKDGWYQGKNLRTAQVGLYPAVFTQP 61

>SAKL0H10098g Chr8 (865874..865882,865987..867645) [1668 bp, 555 aa]
           {ON} similar to uniprot|P29366 Saccharomyces cerevisiae
           YBR200W BEM1 Protein containing SH3-domains involved in
           establishing cell polarity and morphogenesis functions
           as a scaffold protein for complexes that include Cdc24p
           Ste5p Ste20p and Rsr1p
          Length = 555

 Score = 37.4 bits (85), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 34/65 (52%), Gaps = 3/65 (4%)

Query: 45  NANGNRSSSPSLEYVEAIYAFQAQQDGDLNLKPGDKIQVLEKPSSEWYKGK--CNGSVGM 102
           NA  ++  S   + ++A+Y +QAQ  G+L+   GD   VL +   EWY      +G  GM
Sbjct: 57  NAPKSKDISSPEKVIKAMYNYQAQSPGELSFVKGDFFHVLTE-DREWYDASNPSDGKRGM 115

Query: 103 FPSNY 107
            P +Y
Sbjct: 116 VPKSY 120

>Smik_12.251 Chr12 (484225..485391) [1167 bp, 388 aa] {ON} YLR191W
           (REAL)
          Length = 388

 Score = 37.4 bits (85), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 35/61 (57%), Gaps = 7/61 (11%)

Query: 56  LEYVEAIYAFQAQQ-DGDLNLKPGDKIQVLEKPS-----SEWYKGKC-NGSVGMFPSNYV 108
           LE+  A+Y F  +  + ++ LK GD + +L K       S+W+K +  NG++G  P NY+
Sbjct: 310 LEFARALYDFVPENPEMEVALKKGDLMAILSKKDPVGRDSDWWKVRTKNGNIGYIPYNYI 369

Query: 109 K 109
           +
Sbjct: 370 E 370

>NDAI0I00220 Chr9 (32281..34128) [1848 bp, 615 aa] {ON} Anc_6.366
           YCR088W
          Length = 615

 Score = 37.4 bits (85), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 29/53 (54%), Gaps = 2/53 (3%)

Query: 58  YVEAIYAFQAQQDGDLNLKPGDKIQVLEKPSSEWYKGKC--NGSVGMFPSNYV 108
           +  A Y + A ++ +L     DKI  +E    +W+ G+   NG  G+FPSNYV
Sbjct: 559 WATAEYDYDAGEENELTFVENDKIINIEFVDDDWWLGELEKNGEKGLFPSNYV 611

>KNAG0B05000 Chr2 (955989..958556) [2568 bp, 855 aa] {ON} Anc_5.170
           YJL020C
          Length = 855

 Score = 37.4 bits (85), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 31/53 (58%), Gaps = 5/53 (9%)

Query: 61  AIYAFQAQQDGDLNLKPGDKIQVLEKPSSEWYKGKCN---GSV--GMFPSNYV 108
           A +A++++ + DLN K G KI V      EWY G+     G+V  G+FP ++V
Sbjct: 12  AQFAYESEFEDDLNFKAGQKITVTAIEDDEWYAGEYEADGGTVASGIFPKSFV 64

>KAFR0L01880 Chr12 complement(348028..350820) [2793 bp, 930 aa] {ON}
           Anc_7.413 YER114C
          Length = 930

 Score = 37.4 bits (85), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 30/49 (61%), Gaps = 5/49 (10%)

Query: 61  AIYAFQAQQDGDLNLKPGDKIQVL---EKPSSEWYKGK--CNGSVGMFP 104
           A+ A+  + + ++++KPGDKIQV+   E  +  WY G+    G  G+FP
Sbjct: 33  AVSAYTKRMEDEISIKPGDKIQVITDDEDYNDGWYVGRNLRTGKEGLFP 81

>CAGL0I02750g Chr9 complement(242879..244738) [1860 bp, 619 aa] {ON}
           similar to uniprot|P38822 Saccharomyces cerevisiae
           YHR114w BZZ1
          Length = 619

 Score = 37.0 bits (84), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 33/60 (55%), Gaps = 1/60 (1%)

Query: 50  RSSSPSLEYVEAIYAFQAQQDGDLNLKPGDKIQVLE-KPSSEWYKGKCNGSVGMFPSNYV 108
           R ++  +  + A Y + +Q D +L+L  GD + VL+    S W  G+ NG  G+ P++Y 
Sbjct: 559 RRTTLPVRTITAQYEYTSQGDDELSLAVGDVVTVLKGDDGSGWTYGELNGHKGLVPTSYC 618

>TPHA0H02380 Chr8 (558973..560559) [1587 bp, 528 aa] {ON} Anc_6.366
           YCR088W
          Length = 528

 Score = 37.0 bits (84), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 30/57 (52%), Gaps = 2/57 (3%)

Query: 54  PSLEYVEAIYAFQAQQDGDLNLKPGDKIQVLEKPSSEWYKGK--CNGSVGMFPSNYV 108
           P+L    A Y + A +D +L    G KI  +E    +W+ G+    G  G+FP+NYV
Sbjct: 468 PALATAVAEYDYDAAEDNELTFVEGTKIINIEFVDDDWWLGENGTTGEKGLFPANYV 524

>TDEL0A07810 Chr1 (1355773..1357449) [1677 bp, 558 aa] {ON}
           Anc_6.366 YCR088W
          Length = 558

 Score = 36.6 bits (83), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 31/57 (54%), Gaps = 2/57 (3%)

Query: 54  PSLEYVEAIYAFQAQQDGDLNLKPGDKIQVLEKPSSEWYKGKC--NGSVGMFPSNYV 108
           P+     A Y ++A ++ +L     DKI  ++    +W+ G+   NG  G+FPSNYV
Sbjct: 499 PAAPSATAEYDYEAAEENELTFNENDKIINIDFVDDDWWLGELERNGEKGLFPSNYV 555

>ADL288C Chr4 complement(194687..197464) [2778 bp, 925 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL117W
           (CYK3)
          Length = 925

 Score = 36.6 bits (83), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 31/62 (50%), Gaps = 3/62 (4%)

Query: 59  VEAIYAFQAQQDGDLNLKPGDKIQVLEKPSSEWYKGKC--NGSVGMFPSNYVKPAFSGSN 116
           V+A+Y++  + + DL     D I+V  K    W  G+   N   G FP NYV+  +   N
Sbjct: 12  VKAVYSWSGEHEQDLGFLESDIIEV-TKVKGNWLYGRLLRNKKSGYFPVNYVQVLYEVPN 70

Query: 117 GF 118
           G+
Sbjct: 71  GY 72

>TPHA0F03100 Chr6 complement(680407..681552) [1146 bp, 381 aa] {ON}
           Anc_7.365 YLR191W
          Length = 381

 Score = 36.6 bits (83), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 7/62 (11%)

Query: 55  SLEYVEAIYAFQAQ-QDGDLNLKPGDKIQVLEKP-----SSEWYKGKC-NGSVGMFPSNY 107
           +LE+  A++ F  + +  +L L  GD + +L K      +S+W+K +  NG  G  PSNY
Sbjct: 305 NLEFARALFDFNPENRKIELTLTKGDLMAILTKKDPYGNTSKWWKVRTKNGDTGYVPSNY 364

Query: 108 VK 109
           ++
Sbjct: 365 IE 366

>Smik_2.113 Chr2 complement(205503..206218,206252..209228) [3693 bp,
           1230 aa] {ON} YBL007C (REAL)
          Length = 1230

 Score = 36.6 bits (83), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 31/52 (59%), Gaps = 3/52 (5%)

Query: 63  YAFQAQQDGDLNLKPGDKIQVL-EKPSSEWYKGKC--NGSVGMFPSNYVKPA 111
           Y F A+   +L +K GDK+ +L +K S +W+  +   +G  G+ P+ +++P 
Sbjct: 359 YDFMAESQDELTIKSGDKVYILDDKKSKDWWMCQLIDSGKSGLVPAQFIEPV 410

 Score = 35.0 bits (79), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 29/63 (46%), Gaps = 4/63 (6%)

Query: 53  SPSLEYVEAIYAFQAQQDGD--LNLKPGDKIQVLEKPSSEWY--KGKCNGSVGMFPSNYV 108
           +P L+ V AIY +   Q+ D  L     D   V +   ++W   K   +   G  P NYV
Sbjct: 68  APVLKKVRAIYDYGQVQNADEELTFHENDTFDVFDDNDADWLLVKSTVSNEFGFIPGNYV 127

Query: 109 KPA 111
           +PA
Sbjct: 128 EPA 130

 Score = 31.2 bits (69), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 34/64 (53%), Gaps = 8/64 (12%)

Query: 56  LEYVEAIYAFQAQQDGDLNLKPGDKIQVLEKPS-SEWY--KGKCNGS-----VGMFPSNY 107
           L    AIYA++ Q   +L ++  D + +L+K    +W+  K +  GS     VG+ PS Y
Sbjct: 5   LGIYRAIYAYEPQTPEELAIQEDDLLYLLQKSDIDDWWTVKKRVIGSDSEEPVGLVPSTY 64

Query: 108 VKPA 111
           ++ A
Sbjct: 65  IEEA 68

>YBL007C Chr2 complement(212632..216366) [3735 bp, 1244 aa] {ON}
           SLA1Cytoskeletal protein binding protein required for
           assembly of the cortical actin cytoskeleton; interacts
           with proteins regulating actin dynamics and proteins
           required for endocytosis; found in the nucleus and cell
           cortex; has 3 SH3 domains
          Length = 1244

 Score = 36.6 bits (83), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 31/52 (59%), Gaps = 3/52 (5%)

Query: 63  YAFQAQQDGDLNLKPGDKIQVL-EKPSSEWYKGKC--NGSVGMFPSNYVKPA 111
           Y F A+   +L +K GDK+ +L +K S +W+  +   +G  G+ P+ +++P 
Sbjct: 362 YDFMAESQDELTIKSGDKVYILDDKKSKDWWMCQLVDSGKSGLVPAQFIEPV 413

 Score = 30.4 bits (67), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 34/64 (53%), Gaps = 8/64 (12%)

Query: 56  LEYVEAIYAFQAQQDGDLNLKPGDKIQVLEKPS-SEWY--KGKCNGS-----VGMFPSNY 107
           L    A+YA++ Q   +L ++  D + +L+K    +W+  K +  GS     VG+ PS Y
Sbjct: 5   LGIYRAVYAYEPQTPEELAIQEDDLLYLLQKSDIDDWWTVKKRVIGSDSEEPVGLVPSTY 64

Query: 108 VKPA 111
           ++ A
Sbjct: 65  IEEA 68

>TPHA0K00680 Chr11 (134675..135742) [1068 bp, 355 aa] {ON} Anc_7.419
           YER118C
          Length = 355

 Score = 36.2 bits (82), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 33/52 (63%), Gaps = 2/52 (3%)

Query: 60  EAIYAFQAQQ-DG-DLNLKPGDKIQVLEKPSSEWYKGKCNGSVGMFPSNYVK 109
           +A+Y++QA   DG +++ + G+ ++V +     W   + NG VG+ PSNYV+
Sbjct: 300 KALYSYQADDADGYEISFEQGEILKVSDIEGRWWKSKRENGQVGIIPSNYVQ 351

>AGL237C Chr7 complement(254636..256372) [1737 bp, 578 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCR088W
           (ABP1)
          Length = 578

 Score = 36.2 bits (82), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 30/51 (58%), Gaps = 2/51 (3%)

Query: 61  AIYAFQAQQDGDLNLKPGDKIQVLEKPSSEWYKGKCN--GSVGMFPSNYVK 109
           A Y ++A +D +L  + GD I  ++    +W+ G+    G  G+FPSNYV+
Sbjct: 525 AEYDYEAGEDNELTFEEGDVIVNIDFVDDDWWLGELQKTGQKGLFPSNYVE 575

>Skud_2.104 Chr2 complement(196129..199773) [3645 bp, 1214 aa] {ON}
           YBL007C (REAL)
          Length = 1214

 Score = 36.2 bits (82), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 31/52 (59%), Gaps = 3/52 (5%)

Query: 63  YAFQAQQDGDLNLKPGDKIQVLE-KPSSEWYKGKC--NGSVGMFPSNYVKPA 111
           Y F A+   +L +K GDK+ +L+ K S +W+  +   +G  G+ P+ +++P 
Sbjct: 355 YNFMAESQDELTVKSGDKVYILDAKKSKDWWMCQLVDSGKSGLVPAQFIEPV 406

>SAKL0G17600g Chr7 complement(1523623..1524948) [1326 bp, 441 aa]
           {ON} conserved hypothetical protein
          Length = 441

 Score = 36.2 bits (82), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 51/106 (48%), Gaps = 19/106 (17%)

Query: 18  DFLRESEVISEETFQQ-------ISNSLPQRYDPNANGNRSSSPSLEYVEAIYAF--QAQ 68
           ++L   E+I+   F Q        SN L  R D  ANG   + P++ Y  A+Y +     
Sbjct: 336 EYLENFEIINFNRFYQHSIQNANASNKLQFR-DNAANG---TVPTV-YATALYDYSPDPN 390

Query: 69  QDG---DLNLKPGDKIQVLEKPSSEWYKGKC--NGSVGMFPSNYVK 109
           Q G   DL  K GD I+V++K  + W+ G+       G FP N+V+
Sbjct: 391 QQGTGEDLTFKNGDMIRVIKKTENNWWYGEVLRTKRRGYFPVNFVE 436

>AGR170C Chr7 complement(1066831..1070196) [3366 bp, 1121 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBL007C
           (SLA1)
          Length = 1121

 Score = 36.2 bits (82), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 34/61 (55%), Gaps = 4/61 (6%)

Query: 53  SPSLEYVEAIYAFQAQQ--DGDLNLKPGDKIQVLEKPSSEWY--KGKCNGSVGMFPSNYV 108
           +P +  V ++Y ++  Q  D +L  + GD+  V +   ++W   + + +GSVG  P NYV
Sbjct: 68  APVVGRVRSVYDYEEAQNPDEELVFREGDEFDVYDDRDADWVLVRKRADGSVGFAPGNYV 127

Query: 109 K 109
           +
Sbjct: 128 E 128

>KNAG0B02230 Chr2 (431524..434238) [2715 bp, 904 aa] {ON} Anc_7.413
           YER114C
          Length = 904

 Score = 36.2 bits (82), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 30/55 (54%), Gaps = 6/55 (10%)

Query: 61  AIYAFQAQQDGDLNLKPGDKIQVLEKPS---SEWYKGK--CNGS-VGMFPSNYVK 109
            I  +  + + +L+L PGD+I+VLE        WY GK    GS VG+FP  + K
Sbjct: 24  VINRYAKRMEDELDLVPGDRIEVLEADELYGDGWYTGKNLSRGSQVGLFPEVFTK 78

>Suva_2.564 Chr2 (1002523..1002651) [129 bp, 43 aa] {ON} YDR388W
           (REAL)
          Length = 43

 Score = 32.7 bits (73), Expect = 0.066,   Method: Composition-based stats.
 Identities = 14/39 (35%), Positives = 25/39 (64%), Gaps = 2/39 (5%)

Query: 73  LNLKPGDKIQVLEKP--SSEWYKGKCNGSVGMFPSNYVK 109
           L    G  I+++++   ++EW+ G+ NG  G+FP NYV+
Sbjct: 1   LTFPAGAVIEIVQRTPDANEWWTGRYNGQQGVFPGNYVQ 39

>KNAG0I02700 Chr9 complement(531880..533607) [1728 bp, 575 aa] {ON}
           Anc_6.366 YCR088W
          Length = 575

 Score = 35.8 bits (81), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 29/53 (54%), Gaps = 2/53 (3%)

Query: 58  YVEAIYAFQAQQDGDLNLKPGDKIQVLEKPSSEWYKGKC--NGSVGMFPSNYV 108
           +  A Y + A ++ +L     DKI  +E    +W+ G+   NG  G+FPSNYV
Sbjct: 519 WALAEYDYDAGEENELTFVEKDKIINIEFVDDDWWLGELERNGEKGLFPSNYV 571

>YMR032W Chr13 (335298..337307) [2010 bp, 669 aa] {ON}  HOF1Bud
           neck-localized, SH3 domain-containing protein required
           for cytokinesis; regulates actomyosin ring dynamics and
           septin localization; interacts with the formins, Bni1p
           and Bnr1p, and with Cyk3p, Vrp1p, and Bni5p
          Length = 669

 Score = 35.8 bits (81), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 19/70 (27%), Positives = 33/70 (47%), Gaps = 9/70 (12%)

Query: 54  PSLEYVEAIYAFQAQQD-GDLNLKPGDKIQVLEKPSSEWYKGKC--------NGSVGMFP 104
           P +EY +A+Y     +  G  N   GD + + E  + +WYKG+         N  +G+ P
Sbjct: 599 PVIEYAKAMYPLIGNEAPGLANFHKGDYLLITEIVNKDWYKGEVYDNDRIDRNHRIGLIP 658

Query: 105 SNYVKPAFSG 114
            N+++    G
Sbjct: 659 YNFIQLLHQG 668

>Ecym_4710 Chr4 (1391055..1392254) [1200 bp, 399 aa] {ON} similar to
           Ashbya gossypii ACR230C
          Length = 399

 Score = 35.8 bits (81), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 36/62 (58%), Gaps = 7/62 (11%)

Query: 55  SLEYVEAIYAFQAQQDG-DLNLKPGDKIQVLEK--PS---SEWYKGKCN-GSVGMFPSNY 107
           +LE+  A+Y F  +    + +LK GD + ++ K  P+   S+W+K +   G VG  PSNY
Sbjct: 313 NLEFARAVYDFTPENPRIECSLKKGDLMAIISKLDPTGNESQWWKVRTKKGEVGYIPSNY 372

Query: 108 VK 109
           ++
Sbjct: 373 IE 374

>KLTH0B04818g Chr2 complement(395490..396632) [1143 bp, 380 aa] {ON}
           weakly similar to uniprot|P80667 Saccharomyces
           cerevisiae YLR191W PEX13 Integral peroxisomal membrane
           receptor
          Length = 380

 Score = 35.4 bits (80), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 33/61 (54%), Gaps = 7/61 (11%)

Query: 56  LEYVEAIYAFQAQQ-DGDLNLKPGDKIQVLEKP-----SSEWYKGKCN-GSVGMFPSNYV 108
           LE+  A+Y F  +    +  L+ GD + V+ K      +SEW++ +   G VG  PSNYV
Sbjct: 310 LEFARAVYDFTPENPQVEAALRKGDLMAVISKQDPLGNASEWWQVRTKKGDVGYVPSNYV 369

Query: 109 K 109
           +
Sbjct: 370 E 370

>TBLA0B09620 Chr2 complement(2277581..2280406) [2826 bp, 941 aa]
           {ON} Anc_2.319 YDL117W
          Length = 941

 Score = 35.8 bits (81), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 29/54 (53%), Gaps = 4/54 (7%)

Query: 59  VEAIYAFQAQQDGDLNLKPGDKIQVLEKPSSEWYKGKC---NGSVGMFPSNYVK 109
           V+A Y +  Q  GDL    GD ++V  K + +WY G+        G FP+N+VK
Sbjct: 15  VKAKYGWSGQAKGDLGFLEGDVMEV-TKITGDWYYGRLLRNRKCSGYFPNNFVK 67

>TPHA0F00380 Chr6 (85560..90416) [4857 bp, 1618 aa] {ON} Anc_4.45
           Scer_YGOB_SDC25
          Length = 1618

 Score = 35.8 bits (81), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 28/52 (53%), Gaps = 4/52 (7%)

Query: 70  DGDLNLKPGDKIQVLEKPSSEWYKG-KCNGSV---GMFPSNYVKPAFSGSNG 117
           D  L   PGDKI VL K  + W+ G   +G V   G FP ++VKP  + S G
Sbjct: 50  DTYLRFNPGDKIYVLNKNDNGWWDGIVLHGKVVTRGWFPLHFVKPYRTVSPG 101

>NDAI0A03330 Chr1 complement(756761..760441) [3681 bp, 1226 aa] {ON}
           Anc_4.108 YBL007C
          Length = 1226

 Score = 35.8 bits (81), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 35/64 (54%), Gaps = 8/64 (12%)

Query: 56  LEYVEAIYAFQAQQDGDLNLKPGDKIQVLEKPS-SEWY--KGKCNGS-----VGMFPSNY 107
           L   +AIY ++ Q   +L LK  D + +LEK    +W+  K +  GS     VG+ PSNY
Sbjct: 5   LGVYKAIYDYEPQTPEELELKENDLLYLLEKSEVDDWWTVKKRVIGSDAEEPVGLVPSNY 64

Query: 108 VKPA 111
           ++ A
Sbjct: 65  IEEA 68

 Score = 33.1 bits (74), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 17/71 (23%), Positives = 37/71 (52%), Gaps = 3/71 (4%)

Query: 43  DPNANGNRSSSPSLEYVEAIYAFQAQQDGDLNLKPGDKIQVL-EKPSSEWYKGKC--NGS 99
           DP     + ++ S +    +  F A+ + +L +K GD + +L +K S +W+  +    G 
Sbjct: 358 DPGLREVQMAAKSKKQARVLVDFIAESNDELTVKEGDMVYILNDKKSKDWWMCELVKTGE 417

Query: 100 VGMFPSNYVKP 110
            G+ P+ +++P
Sbjct: 418 KGVVPAQFIEP 428

 Score = 30.0 bits (66), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 17/63 (26%), Positives = 30/63 (47%), Gaps = 4/63 (6%)

Query: 53  SPSLEYVEAIYAFQAQQ--DGDLNLKPGDKIQVLEKPSSEWY--KGKCNGSVGMFPSNYV 108
           +P +  V+A+Y ++  Q  + +L     D   V +    +W   K + +  VG  P NYV
Sbjct: 68  APVIAQVKALYDYEQIQNPEEELIFHENDLFSVYDDKDPDWLLVKSQISNEVGFVPGNYV 127

Query: 109 KPA 111
           +P 
Sbjct: 128 QPV 130

>Kwal_23.6437 s23 (1581839..1583734) [1896 bp, 631 aa] {ON} YCR088W
           (ABP1) - 1:1 [contig 17] FULL
          Length = 631

 Score = 35.4 bits (80), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 29/51 (56%), Gaps = 2/51 (3%)

Query: 61  AIYAFQAQQDGDLNLKPGDKIQVLEKPSSEWYKGKC--NGSVGMFPSNYVK 109
           A Y  +A++  +L  K GDKI  +     +W+ G+    G  G+FPSNYV+
Sbjct: 578 AEYDNEAEEHNELAFKEGDKIVNIVFVDDDWWLGELEKTGEKGLFPSNYVQ 628

>NDAI0A01470 Chr1 (326531..327634) [1104 bp, 367 aa] {ON} Anc_7.419
           YER118C
          Length = 367

 Score = 35.0 bits (79), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 31/54 (57%), Gaps = 4/54 (7%)

Query: 59  VEAIYAFQAQQDGD---LNLKPGDKIQVLEKPSSEWYKGKCNGSVGMFPSNYVK 109
           V+A+Y++QA  D D   ++   G+ ++V +     W   + NG  G+ PSNYV+
Sbjct: 311 VKALYSYQAD-DADAYEISFDQGEILKVSDIEGRWWKAKRENGQTGIIPSNYVE 363

>KAFR0F00750 Chr6 complement(145999..147807) [1809 bp, 602 aa] {ON}
           Anc_2.159 YHR114W
          Length = 602

 Score = 35.0 bits (79), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 31/52 (59%), Gaps = 1/52 (1%)

Query: 59  VEAIYAFQAQQDGDLNLKPGDKIQVLE-KPSSEWYKGKCNGSVGMFPSNYVK 109
           +E ++ + AQ D ++++  GD + V++    S W  G+ NG  G+ P++Y K
Sbjct: 551 LEVVFDYVAQGDDEISINVGDVVTVIKGDDGSGWTYGELNGLKGLVPTSYCK 602

 Score = 29.6 bits (65), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 16/54 (29%), Positives = 31/54 (57%), Gaps = 4/54 (7%)

Query: 60  EAIYAFQAQQDGDLNLKPGDKIQVLEKPS-SEWYKGKC---NGSVGMFPSNYVK 109
           + +YA+  Q   ++++ PGD   V+E  + S W K K      +VG+ P++Y++
Sbjct: 476 KVLYAYAKQDADEIDVTPGDVFDVIEADTGSGWTKIKNLSQGHAVGVVPTSYIE 529

>Ecym_1147 Chr1 (305106..306374) [1269 bp, 422 aa] {ON} similar to
           Ashbya gossypii AER140C
          Length = 422

 Score = 35.0 bits (79), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 41/75 (54%), Gaps = 10/75 (13%)

Query: 45  NANGNRSSSPSLE------YVEAIYAFQAQQDGD--LNLKPGDKIQVLEKPSSEWYKGKC 96
           +AN + S+S SL+      Y   +Y ++ Q +    L++K GD IQ++ +  + W+ G  
Sbjct: 342 DANDDSSNSNSLQKAVPTMYATVLYDYEPQFNDPQYLSIKKGDTIQIITQSKNGWWYGDL 401

Query: 97  --NGSVGMFPSNYVK 109
               + G+FP +YV+
Sbjct: 402 LRTKTKGLFPQSYVQ 416

>ACR230C Chr3 complement(763430..764626) [1197 bp, 398 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR191W
           (PEX13)
          Length = 398

 Score = 35.0 bits (79), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 36/78 (46%), Gaps = 16/78 (20%)

Query: 39  PQRYDPNANGNRSSSPSLEYVEAIYAFQAQQDG-DLNLKPGDKIQVLEK-----PSSEWY 92
           PQ  D N         SLE+  AIY F  +    +  LK GD + ++ +       S+W+
Sbjct: 306 PQSLDLN---------SLEFARAIYDFTPENPRIECALKKGDLMAIISRQDPTGKESQWW 356

Query: 93  KGKCN-GSVGMFPSNYVK 109
           K +   G VG  P NY++
Sbjct: 357 KVRTKKGDVGYVPCNYIE 374

>Ecym_7231 Chr7 complement(480473..483913) [3441 bp, 1146 aa] {ON}
           similar to Ashbya gossypii AGR170C
          Length = 1146

 Score = 35.0 bits (79), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 34/64 (53%), Gaps = 8/64 (12%)

Query: 56  LEYVEAIYAFQAQQDGDLNLKPGDKIQVLEKPS-SEWYKGK-------CNGSVGMFPSNY 107
           L   +AIY+++ Q D +L ++  D + VLEK    +W+  K           VG+ P+NY
Sbjct: 5   LGVYKAIYSYEPQTDEELRIEEDDLLYVLEKSEVDDWWTVKKREIGTDTEELVGLVPNNY 64

Query: 108 VKPA 111
           ++ A
Sbjct: 65  IEEA 68

 Score = 33.5 bits (75), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 32/66 (48%), Gaps = 4/66 (6%)

Query: 56  LEYVEAIYAFQAQQ--DGDLNLKPGDKIQVLEKPSSEWY--KGKCNGSVGMFPSNYVKPA 111
           L  V AIY ++  Q  D +L+ + GD   + +   ++W+  +   +  VG  P NYV+  
Sbjct: 71  LYQVHAIYDYKQVQNPDEELSFQEGDVFDIFDDRDADWFLVRAVKDKKVGFIPGNYVETI 130

Query: 112 FSGSNG 117
             G  G
Sbjct: 131 EEGGRG 136

>AGL286C Chr7 complement(174535..175527) [993 bp, 330 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER118C
           (SHO1)
          Length = 330

 Score = 34.7 bits (78), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 30/52 (57%), Gaps = 2/52 (3%)

Query: 60  EAIYAFQAQQDG--DLNLKPGDKIQVLEKPSSEWYKGKCNGSVGMFPSNYVK 109
           +A+YA++A      +++ + G+ ++V +     W   K NG  G+ PSNYV+
Sbjct: 271 KALYAYEADASDAYEISFQQGEILRVGDIEGRWWKAKKANGETGIIPSNYVE 322

>Skud_13.188 Chr13 (322010..324019) [2010 bp, 669 aa] {ON} YMR032W
           (REAL)
          Length = 669

 Score = 35.0 bits (79), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 19/70 (27%), Positives = 33/70 (47%), Gaps = 9/70 (12%)

Query: 54  PSLEYVEAIYAFQAQQD-GDLNLKPGDKIQVLEKPSSEWYKGKC--------NGSVGMFP 104
           P +EY +A+Y     +  G  N   GD + + E  + +WYKG+         +  VG+ P
Sbjct: 599 PVIEYAKAMYPLVGNEAPGLANFHKGDYMLITEIVNKDWYKGEVYDNDRIDRDHRVGLIP 658

Query: 105 SNYVKPAFSG 114
            N+++    G
Sbjct: 659 YNFIQLLHQG 668

>Kpol_1045.21 s1045 (44318..45394) [1077 bp, 358 aa] {ON}
           (44320..45396) [1077 nt, 359 aa]
          Length = 358

 Score = 34.7 bits (78), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 31/52 (59%), Gaps = 2/52 (3%)

Query: 60  EAIYAFQAQQ-DG-DLNLKPGDKIQVLEKPSSEWYKGKCNGSVGMFPSNYVK 109
            A+Y++QA   DG +++ + G+ ++V +     W   K  G VG+ PSNYV+
Sbjct: 299 RALYSYQADDADGYEVSFEQGEILKVSDIEGRWWKSKKETGEVGIIPSNYVQ 350

>ZYRO0B04004g Chr2 complement(337594..338709) [1116 bp, 371 aa] {ON}
           similar to uniprot|P40073 Saccharomyces cerevisiae
           YER118C SHO1 Transmembrane osmosensor participates in
           activation of both the Cdc42p- and MAP kinase-dependent
           filamentous growth pathway and the high-osmolarity
           glycerol response pathway
          Length = 371

 Score = 34.7 bits (78), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 15/52 (28%), Positives = 29/52 (55%), Gaps = 2/52 (3%)

Query: 60  EAIYAFQAQQDG--DLNLKPGDKIQVLEKPSSEWYKGKCNGSVGMFPSNYVK 109
           + +Y +QA +D   +++ + G+ ++V +     W   +  G  G+ PSNYVK
Sbjct: 312 QTLYRYQADEDDAYEISFEQGEILKVSDIEGRWWKAKRSTGETGIIPSNYVK 363

>NCAS0D01950 Chr4 (358938..361757) [2820 bp, 939 aa] {ON} Anc_5.170
          Length = 939

 Score = 34.7 bits (78), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 27/51 (52%)

Query: 59  VEAIYAFQAQQDGDLNLKPGDKIQVLEKPSSEWYKGKCNGSVGMFPSNYVK 109
           V+A + ++++ + DLN      I V      EWY G+     G+FP ++VK
Sbjct: 10  VQAQFPYKSEYEDDLNFGKDQIITVTNVEDDEWYYGEYADKEGIFPKSFVK 60

>KAFR0K02000 Chr11 complement(410316..411314) [999 bp, 332 aa] {ON}
           Anc_7.419 YER118C
          Length = 332

 Score = 34.3 bits (77), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 34/59 (57%), Gaps = 2/59 (3%)

Query: 60  EAIYAFQAQQDG--DLNLKPGDKIQVLEKPSSEWYKGKCNGSVGMFPSNYVKPAFSGSN 116
           +A+Y++QA +    +++ + G+ ++V +     W   + NG  G+ PSNYV+   S +N
Sbjct: 273 KALYSYQADESDQYEISFEQGEILRVSDIEGRWWKAKRENGETGIIPSNYVQLINSETN 331

>Kwal_27.10733 s27 (473078..476122) [3045 bp, 1014 aa] {ON} YER114C
           (BOI2) - involved in bud formation, has SH3 domain
           [contig 33] FULL
          Length = 1014

 Score = 34.7 bits (78), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 38/73 (52%), Gaps = 11/73 (15%)

Query: 48  GNRSSSPSLEYVEA------IYAFQAQQDGDLNLKPGDKIQVL---EKPSSEWYKGK--C 96
           G+  S+P LE +        I  +  + + +L++KPGDKIQV+   E+ +  WY G+   
Sbjct: 22  GSDDSTPELESLGTGPLFITITEYSKRMEDELDMKPGDKIQVITDDEEYNDGWYYGRNLR 81

Query: 97  NGSVGMFPSNYVK 109
               G++P  + +
Sbjct: 82  TNEEGLYPKVFTQ 94

>Ecym_7134 Chr7 (266402..267400) [999 bp, 332 aa] {ON} similar to
           Ashbya gossypii AGL286C
          Length = 332

 Score = 34.3 bits (77), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 15/52 (28%), Positives = 30/52 (57%), Gaps = 2/52 (3%)

Query: 60  EAIYAFQAQQDG--DLNLKPGDKIQVLEKPSSEWYKGKCNGSVGMFPSNYVK 109
            A+YA++A +    +++ + G+ ++V +     W   + NG  G+ PSNYV+
Sbjct: 273 RALYAYEADESDAYEISFQQGEILRVGDIEGRWWKAKRSNGETGIIPSNYVE 324

>SAKL0H24222g Chr8 complement(2089734..2094314) [4581 bp, 1526 aa]
           {ON} similar to uniprot|P04821 Saccharomyces cerevisiae
           YLR310C CDC25 Membrane bound guanine nucleotide exchange
           factor (GEF or GDP-release factor) indirectly regulates
           adenylate cyclase through activation of Ras1p and Ras2p
           by stimulating the exchange of GDP for GTP required for
           progression through G1
          Length = 1526

 Score = 34.7 bits (78), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 26/59 (44%), Gaps = 5/59 (8%)

Query: 56  LEYVEAIYAFQAQQDGDLNLKPGDKIQVLEKPSSEWYKGKC-----NGSVGMFPSNYVK 109
           ++ V A Y +   +   L L  GD + VL K  S W+ G         S G FP NY K
Sbjct: 23  VDVVVATYDYVPSRKSQLRLIQGDTVYVLSKQDSGWWDGIILDSNNKASRGWFPCNYSK 81

>Suva_13.201 Chr13 (325718..327724) [2007 bp, 668 aa] {ON} YMR032W
           (REAL)
          Length = 668

 Score = 34.3 bits (77), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 19/70 (27%), Positives = 33/70 (47%), Gaps = 9/70 (12%)

Query: 54  PSLEYVEAIYAFQAQQD-GDLNLKPGDKIQVLEKPSSEWYKGKC--------NGSVGMFP 104
           P +EY +A+Y     +  G  N   GD I + E  + +W+KG+         +  VG+ P
Sbjct: 598 PVIEYAKAMYPLVGNEAPGLANFHKGDYILITEIVNKDWFKGEVYNNDRIERDHRVGLIP 657

Query: 105 SNYVKPAFSG 114
            N+++    G
Sbjct: 658 YNFIQLLHQG 667

>Skud_12.256 Chr12 (483859..485070) [1212 bp, 403 aa] {ON} YLR191W
           (REAL)
          Length = 403

 Score = 34.3 bits (77), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 33/61 (54%), Gaps = 7/61 (11%)

Query: 56  LEYVEAIYAFQAQQ-DGDLNLKPGDKIQVLEKP-----SSEWYKGKC-NGSVGMFPSNYV 108
           LE+  A+Y F  +    ++ L  GD + +L K      +S+W+K +  NG +G  P NY+
Sbjct: 325 LEFARALYDFVPENPQIEVALTKGDLMAILSKKDPIGKNSDWWKVRTKNGKIGYIPYNYI 384

Query: 109 K 109
           +
Sbjct: 385 E 385

>KAFR0J00580 Chr10 (99508..102216) [2709 bp, 902 aa] {ON} Anc_5.170
           YJL020C
          Length = 902

 Score = 34.3 bits (77), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 35/63 (55%), Gaps = 6/63 (9%)

Query: 52  SSPSLEY-VEAIYAFQAQQDGDLNLKPGDKIQVLEKPSSEWYKGKC---NGSV--GMFPS 105
           S PS+ + V A YA+Q++ + DLN      I+V      EWY G+    +G +  G+FP 
Sbjct: 2   SEPSVPFEVIAQYAYQSEYEDDLNFDKNQIIKVTSVEDDEWYLGEFTDDDGQLLSGIFPK 61

Query: 106 NYV 108
           ++V
Sbjct: 62  SFV 64

>Kpol_1045.27 s1045 (60696..63338) [2643 bp, 880 aa] {ON}
           (60698..63340) [2643 nt, 881 aa]
          Length = 880

 Score = 34.3 bits (77), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 31/54 (57%), Gaps = 5/54 (9%)

Query: 61  AIYAFQAQQDGDLNLKPGDKIQVL---EKPSSEWYKGK--CNGSVGMFPSNYVK 109
           AI  +  + + +L+ KPGDKIQV+   E+ +  WY GK       G++P+ + +
Sbjct: 38  AINEYSRRMEDELDFKPGDKIQVITDDEEYNDGWYYGKNLRTQQEGLYPAVFTQ 91

>KLLA0F10175g Chr6 complement(944501..946231) [1731 bp, 576 aa] {ON}
           similar to uniprot|P15891 Saccharomyces cerevisiae
           YCR088W ABP1 Actin-binding protein of the cortical actin
           cytoskeleton important for activation of the Arp2/3
           complex that plays a key role actin in cytoskeleton
           organization
          Length = 576

 Score = 33.9 bits (76), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 35/63 (55%), Gaps = 5/63 (7%)

Query: 48  GNRSSSPSLEYVEAIYAFQAQQDGDLNLKPGDKIQVLEKPSSEWYKGKC--NGSVGMFPS 105
           G + S PS     A Y ++A +D +L  +  ++I  ++    +W+ G+   +G  G+FPS
Sbjct: 513 GKKESGPS---AIAEYDYEAGEDNELTFEENERIINIQFVDDDWWLGELESSGEKGLFPS 569

Query: 106 NYV 108
           NYV
Sbjct: 570 NYV 572

>CAGL0E02783g Chr5 (261665..265276) [3612 bp, 1203 aa] {ON} similar
           to uniprot|P32790 Saccharomyces cerevisiae YBL007c SLA1
          Length = 1203

 Score = 34.3 bits (77), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 15/52 (28%), Positives = 32/52 (61%), Gaps = 3/52 (5%)

Query: 61  AIYAFQAQQDGDLNLKPGDKIQVL-EKPSSEWYKGKC--NGSVGMFPSNYVK 109
           A+Y F+A+   +L ++ GD + V+ +K S +W+  +   NG  G+ P+ +++
Sbjct: 377 ALYDFEAESPDELTIRQGDAVYVINDKKSKDWWMVELISNGKKGLVPAQFIE 428

 Score = 29.6 bits (65), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 35/64 (54%), Gaps = 8/64 (12%)

Query: 56  LEYVEAIYAFQAQQDGDLNLKPGDKIQVLEKPS-SEWY--KGKCNGS-----VGMFPSNY 107
           L   +A+Y+++ Q   +L ++  D + +LEK    +W+  K +  GS      G+ PSNY
Sbjct: 5   LGVYKAVYSYEPQTPEELAIQEDDLLYLLEKSEVDDWWTVKKRIIGSDAEEPQGLVPSNY 64

Query: 108 VKPA 111
           ++ A
Sbjct: 65  IEAA 68

>TPHA0G00930 Chr7 (179525..181999) [2475 bp, 824 aa] {ON} Anc_2.319
           YDL117W
          Length = 824

 Score = 33.9 bits (76), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 27/53 (50%), Gaps = 4/53 (7%)

Query: 59  VEAIYAFQAQQDGDLNLKPGDKIQVLEKPSSEWYKG---KCNGSVGMFPSNYV 108
           V+A Y +  Q  GDL    GD + V  K + +WY G   +   S G FP N+V
Sbjct: 7   VKARYGWSGQAKGDLGFLEGDIMNV-TKTTGDWYYGFLLRNKKSKGYFPKNFV 58

>KNAG0C02910 Chr3 complement(577437..581171) [3735 bp, 1244 aa] {ON}
           Anc_4.108 YBL007C
          Length = 1244

 Score = 33.9 bits (76), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 30/62 (48%), Gaps = 4/62 (6%)

Query: 53  SPSLEYVEAIYAFQAQQ--DGDLNLKPGDKIQVLEKPSSEWY--KGKCNGSVGMFPSNYV 108
           SP +    A+Y +   Q  D +L  K  D   + +    +W   + + +GSVG  P NYV
Sbjct: 68  SPVIGQWRALYDYDQPQNPDEELAFKENDTFDLFDAQDPDWLLVRSQRDGSVGFVPGNYV 127

Query: 109 KP 110
           +P
Sbjct: 128 EP 129

>KLTH0A07348g Chr1 (610049..611929) [1881 bp, 626 aa] {ON} similar
           to uniprot|P15891 Saccharomyces cerevisiae YCR088W ABP1
           Actin-binding protein of the cortical actin cytoskeleton
           important for activation of the Arp2/3 complex that
           plays a key role actin in cytoskeleton organization
          Length = 626

 Score = 33.9 bits (76), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 29/51 (56%), Gaps = 2/51 (3%)

Query: 61  AIYAFQAQQDGDLNLKPGDKIQVLEKPSSEWYKGKC--NGSVGMFPSNYVK 109
           A Y  +A++  +L  + GDKI  +     +W+ G+    G  G+FPSNYV+
Sbjct: 573 AEYDNEAEEHNELAFEEGDKIINISFVDDDWWLGELEKTGEKGLFPSNYVQ 623

>NCAS0A03490 Chr1 complement(689871..693578) [3708 bp, 1235 aa] {ON}
           Anc_4.108 YBL007C
          Length = 1235

 Score = 33.9 bits (76), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 34/64 (53%), Gaps = 8/64 (12%)

Query: 56  LEYVEAIYAFQAQQDGDLNLKPGDKIQVLEKPS-SEWY--KGKCNGS-----VGMFPSNY 107
           L   +AIY ++ Q   +L +   D + +LEK    EW+  K +  GS     VG+ PSNY
Sbjct: 5   LGVYKAIYDYEPQTPEELEIHEDDLLYLLEKSEVDEWWTVKKRVIGSDVVEPVGLVPSNY 64

Query: 108 VKPA 111
           ++ A
Sbjct: 65  IEEA 68

 Score = 32.7 bits (73), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 33/63 (52%), Gaps = 4/63 (6%)

Query: 53  SPSLEYVEAIYAF-QAQ-QDGDLNLKPGDKIQVLEKPSSEWY--KGKCNGSVGMFPSNYV 108
           +P++  ++A+Y + +AQ Q+ +L     D   V +    +W   K + +  VG  P NYV
Sbjct: 68  APAISQMKALYDYTEAQNQEEELTFHENDIFDVYDDKDPDWLLVKSRTSNEVGFIPGNYV 127

Query: 109 KPA 111
           +P 
Sbjct: 128 EPV 130

 Score = 29.6 bits (65), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 17/72 (23%), Positives = 36/72 (50%), Gaps = 3/72 (4%)

Query: 43  DPNANGNRSSSPSLEYVEAIYAFQAQQDGDLNLKPGDKIQVL-EKPSSEWYKGKCNGS-- 99
           DP     + ++ S +    ++ F  +   +L +K GD + +L +K S +W+  +   S  
Sbjct: 355 DPGLREVQMATKSKKQARIMFDFIGEAQDELTVKEGDMVYILNDKSSKDWWTCELVDSHK 414

Query: 100 VGMFPSNYVKPA 111
            G+ P+ +V+P 
Sbjct: 415 RGVVPAQFVEPV 426

>NDAI0E04390 Chr5 (993398..994735) [1338 bp, 445 aa] {ON} Anc_7.365
           YLR191W
          Length = 445

 Score = 33.5 bits (75), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 33/62 (53%), Gaps = 7/62 (11%)

Query: 55  SLEYVEAIYAFQAQQ-DGDLNLKPGDKIQVLEKPS-----SEWYKGKC-NGSVGMFPSNY 107
           +LE+  A Y F  +  + +L L  GD + ++ K       SEW+K +  NG +G  P NY
Sbjct: 369 NLEFARAKYKFVPENPEMELQLSKGDLMAIISKQDPLGRDSEWWKVRTKNGDMGYVPYNY 428

Query: 108 VK 109
           ++
Sbjct: 429 LE 430

>NCAS0B06020 Chr2 (1138359..1140953) [2595 bp, 864 aa] {ON}
           Anc_2.319 YDL117W
          Length = 864

 Score = 33.5 bits (75), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 28/55 (50%), Gaps = 4/55 (7%)

Query: 59  VEAIYAFQAQQDGDLNLKPGDKIQVLEKPSSEWYKGKC---NGSVGMFPSNYVKP 110
           V A Y +  Q  GDL    GD ++V  + + +W+ G+        G FP+N+V P
Sbjct: 13  VRARYGWSGQTKGDLGFLEGDIMEV-TRVAGDWFYGRLLRNKKCAGYFPNNFVIP 66

>KNAG0C03420 Chr3 (670941..673997) [3057 bp, 1018 aa] {ON} Anc_7.413
           YER114C
          Length = 1018

 Score = 33.5 bits (75), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 28/49 (57%), Gaps = 5/49 (10%)

Query: 61  AIYAFQAQQDGDLNLKPGDKIQVL---EKPSSEWYKGK--CNGSVGMFP 104
            I  +  + + +LN+KPGDKIQV+   E+ +  WY GK       G++P
Sbjct: 44  CINEYLKRMEDELNMKPGDKIQVITDDEEYNDGWYFGKNLRTKEEGLYP 92

>NDAI0A01500 Chr1 (331951..335094) [3144 bp, 1047 aa] {ON} Anc_7.413
           YBL085W
          Length = 1047

 Score = 33.5 bits (75), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 29/49 (59%), Gaps = 5/49 (10%)

Query: 61  AIYAFQAQQDGDLNLKPGDKIQVL---EKPSSEWYKGKC--NGSVGMFP 104
            I  +  + + +L+++PGDKI+VL   E+ +  WY G+    G  G++P
Sbjct: 46  CINEYSKRMEDELDMRPGDKIEVLTDDEEYNDGWYFGRNLRTGEEGLYP 94

>Skud_2.23 Chr2 (47507..50455) [2949 bp, 982 aa] {ON} YBL085W (REAL)
          Length = 982

 Score = 33.5 bits (75), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 16/54 (29%), Positives = 30/54 (55%), Gaps = 5/54 (9%)

Query: 61  AIYAFQAQQDGDLNLKPGDKIQVLEKP---SSEWYKGK--CNGSVGMFPSNYVK 109
           A+  +  + + +LN+KPGDKI+V+      +  WY G+       G++P+ + K
Sbjct: 20  AVNEYSKRMEDELNMKPGDKIKVITDDGEYNDGWYYGRNLRTEEEGLYPAVFTK 73

>YBL085W Chr2 (63876..66818) [2943 bp, 980 aa] {ON}  BOI1Protein
           implicated in polar growth, functionally redundant with
           Boi2p; interacts with bud-emergence protein Bem1p;
           contains an SH3 (src homology 3) domain and a PH
           (pleckstrin homology) domain
          Length = 980

 Score = 33.5 bits (75), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 16/54 (29%), Positives = 30/54 (55%), Gaps = 5/54 (9%)

Query: 61  AIYAFQAQQDGDLNLKPGDKIQVLEKP---SSEWYKGK--CNGSVGMFPSNYVK 109
           A+  +  + + +LN+KPGDKI+V+      +  WY G+       G++P+ + K
Sbjct: 20  AVNQYSKRMEDELNMKPGDKIKVITDDGEYNDGWYYGRNLRTKEEGLYPAVFTK 73

>Ecym_1167 Chr1 (341453..341461,341739..343382) [1653 bp, 550 aa]
           {ON} similar to Ashbya gossypii AEL241W  1-intron
          Length = 550

 Score = 33.5 bits (75), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 31/55 (56%), Gaps = 3/55 (5%)

Query: 59  VEAIYAFQAQQDGDLNLKPGDKIQVLEKPSSEWYKGKC--NGSVGMFPSNYVKPA 111
           ++A+Y + AQ  G+L+   G+ + V+ +   EW++     +G  GM P +Y +P 
Sbjct: 69  LKALYTYHAQSPGELSFTKGELVHVIGE-DGEWFEVSSPDSGRKGMVPKSYFEPV 122

>KLTH0C06182g Chr3 (535274..538351) [3078 bp, 1025 aa] {ON} similar
           to uniprot|P39969 Saccharomyces cerevisiae YER114C BOI2
           Protein implicated in polar growth functionally
           redundant with Boi1p interacts with bud- emergence
           protein Bem1p contains an SH3 (src homology 3) domain
           and a PH (pleckstrin homology) domain
          Length = 1025

 Score = 33.5 bits (75), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 30/53 (56%), Gaps = 5/53 (9%)

Query: 62  IYAFQAQQDGDLNLKPGDKIQVL---EKPSSEWYKGK--CNGSVGMFPSNYVK 109
           I  +  + + +L++KPGDKIQV+   E+ +  WY G+       G++P  + +
Sbjct: 39  ITEYSKRMEDELDMKPGDKIQVITDDEEYNDGWYYGRNLRTNEEGLYPKVFTQ 91

>AGL293C Chr7 complement(156902..159856) [2955 bp, 984 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER114C
           (BOI2) and YBL085W (BOI1)
          Length = 984

 Score = 33.5 bits (75), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 16/54 (29%), Positives = 32/54 (59%), Gaps = 5/54 (9%)

Query: 61  AIYAFQAQQDGDLNLKPGDKIQVL---EKPSSEWYKGK--CNGSVGMFPSNYVK 109
           AI  +  + + +L++KPGDKI+V+   ++ +  WY G+    G  G++P  + +
Sbjct: 34  AINEYSKRMEDELDMKPGDKIEVITDDQEYNDGWYFGRNLRTGEEGLYPKLFTQ 87

>Suva_2.33 Chr2 (60529..63477) [2949 bp, 982 aa] {ON} YBL085W (REAL)
          Length = 982

 Score = 33.5 bits (75), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 39/69 (56%), Gaps = 7/69 (10%)

Query: 46  ANGNRSSSPSLEYVEAIYAFQAQQDGDLNLKPGDKIQVLEKP---SSEWYKGK--CNGSV 100
           A GNRS+   L Y+ A+  +  + + +L++KPGDKI+V+      +  WY G+       
Sbjct: 7   ALGNRSNFHPL-YI-AVNEYSKRMEDELSMKPGDKIEVITDDGEYNDGWYYGRNLRTKEE 64

Query: 101 GMFPSNYVK 109
           G++P+ + K
Sbjct: 65  GLYPAVFTK 73

>SAKL0F12958g Chr6 complement(1019015..1022098) [3084 bp, 1027 aa]
           {ON} similar to uniprot|P39969 Saccharomyces cerevisiae
           YER114C BOI2 Protein implicated in polar growth
           functionally redundant with Boi1p interacts with bud-
           emergence protein Bem1p contains an SH3 (src homology 3)
           domain and a PH (pleckstrin homology) domain
          Length = 1027

 Score = 33.5 bits (75), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 16/54 (29%), Positives = 31/54 (57%), Gaps = 5/54 (9%)

Query: 61  AIYAFQAQQDGDLNLKPGDKIQVL---EKPSSEWYKGK--CNGSVGMFPSNYVK 109
           AI  +  + + +L++KPGDKIQV+   ++ +  WY G+       G++P  + +
Sbjct: 43  AINEYTKRMEDELDMKPGDKIQVITDDQEYNDGWYYGRNLRTNEEGLYPKVFTQ 96

>KLTH0E07744g Chr5 complement(710793..714542) [3750 bp, 1249 aa]
           {ON} similar to uniprot|P32790 Saccharomyces cerevisiae
           YBL007C SLA1 Cytoskeletal protein binding protein
           required for assembly of the cortical actin cytoskeleton
           contains 3 SH3 domains interacts with proteins
           regulating actin dynamics and with proteins required for
           endocytosis
          Length = 1249

 Score = 33.5 bits (75), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 36/64 (56%), Gaps = 8/64 (12%)

Query: 56  LEYVEAIYAFQAQQDGDLNLKPGDKIQVLEKPS-SEWY--KGKCNGS-----VGMFPSNY 107
           L   +A++ ++ Q D +L +  GD + +L+K    +W+  K +  GS     VG+ P+NY
Sbjct: 5   LGIYKAVFQYEPQSDEELAIDEGDMLYLLQKSDVDDWWTVKKRVIGSDAEEPVGLVPNNY 64

Query: 108 VKPA 111
           ++ A
Sbjct: 65  IEEA 68

>Kwal_26.8323 s26 (739043..740926) [1884 bp, 627 aa] {ON} YMR032W
           (HOF1) - SH3 domain containing-protein [contig 59] FULL
          Length = 627

 Score = 33.1 bits (74), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 17/63 (26%), Positives = 33/63 (52%), Gaps = 9/63 (14%)

Query: 56  LEYVEAIYAF-QAQQDGDLNLKPGDKIQVLEKPSSEWYKGKCNGS--------VGMFPSN 106
           L+Y +A+Y F +A +   +N + GD + + E+   +W+ G+   S         G+ P N
Sbjct: 562 LKYAKALYTFMEANEQQIVNFRAGDYLLLTEQLDQDWFIGEVLDSHDVEPEYRYGIIPRN 621

Query: 107 YVK 109
           Y++
Sbjct: 622 YIE 624

>KLLA0E20879g Chr5 complement(1862894..1865941) [3048 bp, 1015 aa]
           {ON} similar to uniprot|P39969 Saccharomyces cerevisiae
           YER114C BOI2 Protein implicated in polar growth
           functionally redundant with Boi1p interacts with bud-
           emergence protein Bem1p contains an SH3 (src homology 3)
           domain and a PH (pleckstrin homology) domain
          Length = 1015

 Score = 33.1 bits (74), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 28/54 (51%), Gaps = 5/54 (9%)

Query: 61  AIYAFQAQQDGDLNLKPGDKIQVLEKPSSE---WYKGK--CNGSVGMFPSNYVK 109
            I  +  + D +L+++PGDKIQV+    S    WY GK       G++P  + +
Sbjct: 47  CITEYSKRMDDELDMRPGDKIQVVTDDGSYNDGWYFGKNLRTQEEGLYPKVFTQ 100

>TBLA0A07610 Chr1 complement(1888564..1889805) [1242 bp, 413 aa]
           {ON} Anc_7.365 YLR191W
          Length = 413

 Score = 33.1 bits (74), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 33/61 (54%), Gaps = 7/61 (11%)

Query: 56  LEYVEAIYAFQAQQDG-DLNLKPGDKIQVLEKPS-----SEWYKGKC-NGSVGMFPSNYV 108
           LE+  A+Y F  +    +  +K G+ + +L++       SEW+K +  NGS G  P NY+
Sbjct: 331 LEFGRALYDFIPENPRIEATMKKGELLAILDRRDVFGNESEWWKVRTKNGSTGYVPYNYI 390

Query: 109 K 109
           +
Sbjct: 391 E 391

>Kwal_27.10707 s27 (457482..458513) [1032 bp, 343 aa] {ON} YER118C
           (SHO1) - Transmembrane osmosensor [contig 33] FULL
          Length = 343

 Score = 32.7 bits (73), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 35/67 (52%), Gaps = 4/67 (5%)

Query: 45  NANGNRSSSPSLEYVEAIYAFQAQQDG--DLNLKPGDKIQVLEKPSSEWYKGKCNGSVGM 102
           +A    SS P L   +A+Y + A  +   +++ + G+ ++V +     W   + NG  G+
Sbjct: 272 DAGDELSSFPYL--AKALYTYTADSNDAYEVSFEQGETLRVGDIEGRWWKAKRANGETGI 329

Query: 103 FPSNYVK 109
            PSNYV+
Sbjct: 330 IPSNYVE 336

>AER140C Chr5 complement(901101..902345) [1245 bp, 414 aa] {ON}
           NOHBY516; No homolog in Saccharomyces cerevisiae'
          Length = 414

 Score = 32.7 bits (73), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 42/74 (56%), Gaps = 10/74 (13%)

Query: 45  NANGNRSSS-----PSLEYVEAIYAFQAQQDGD--LNLKPGDKIQVLEKPSSEWYKGKC- 96
           N +G+R+++     P++ Y  A+Y +  Q +    L++K GD IQV+ +  + W+ G   
Sbjct: 336 NDDGSRANAFSGIIPTV-YATALYDYDPQFNDPQYLSIKKGDIIQVITQSKNGWWYGDLL 394

Query: 97  -NGSVGMFPSNYVK 109
              + G+FP +YV+
Sbjct: 395 RTKTKGLFPQSYVQ 408

>KAFR0A06870 Chr1 complement(1387865..1390429) [2565 bp, 854 aa]
           {ON} Anc_2.319 YDL117W
          Length = 854

 Score = 33.1 bits (74), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 28/53 (52%), Gaps = 4/53 (7%)

Query: 59  VEAIYAFQAQQDGDLNLKPGDKIQVLEKPSSEWYKGKC---NGSVGMFPSNYV 108
           V+A YA+  +   DL    GD ++V  + + +WY GK        G FP+N+V
Sbjct: 13  VKAKYAWSGESKSDLGFLEGDIMEV-TRVTGDWYFGKLLRNRKCTGYFPNNFV 64

>TPHA0K00720 Chr11 (147285..150320) [3036 bp, 1011 aa] {ON}
           Anc_7.413 YER114C
          Length = 1011

 Score = 33.1 bits (74), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 35/66 (53%), Gaps = 5/66 (7%)

Query: 49  NRSSSPSLEYVEAIYAFQAQQDGDLNLKPGDKIQVL---EKPSSEWYKGKC--NGSVGMF 103
           N   + SL    AI  +  + + +L+ +PGDKIQVL   E+ +  WY G+       G++
Sbjct: 68  NNKGARSLPIYIAINEYSKRMEDELDFRPGDKIQVLLDDEEYNDGWYFGRNLRTQEEGLY 127

Query: 104 PSNYVK 109
           P+ + +
Sbjct: 128 PAVFTQ 133

>Kwal_47.16943 s47 (182308..183690) [1383 bp, 460 aa] {ON} YDR388W
           (RVS167) - (putative) cytoskeletal protein [contig 219]
           FULL
          Length = 460

 Score = 32.7 bits (73), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 30/57 (52%), Gaps = 5/57 (8%)

Query: 58  YVEAIYAFQA---QQDGDLNLKPGDKIQVLEKPSSEWYKGKC--NGSVGMFPSNYVK 109
           Y  A++ ++     Q  DLN +  + I+V++K    W+ G+       G FP+NYV+
Sbjct: 399 YATALFDYEPAEPDQSTDLNFRRNEVIKVIKKNEDGWWYGEAMRTRKRGYFPANYVE 455

>Smik_2.35 Chr2 (57476..60433) [2958 bp, 985 aa] {ON} YBL085W (REAL)
          Length = 985

 Score = 33.1 bits (74), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 15/54 (27%), Positives = 30/54 (55%), Gaps = 5/54 (9%)

Query: 61  AIYAFQAQQDGDLNLKPGDKIQVLEKP---SSEWYKGKC--NGSVGMFPSNYVK 109
           A+  +  + + +LN++PGDKI+V+      +  WY G+       G++P+ + K
Sbjct: 20  AVNEYSKRMEDELNMRPGDKIEVITDDGEYNDGWYYGRNLRTKEEGLYPAVFTK 73

>TDEL0F02380 Chr6 (438262..442029) [3768 bp, 1255 aa] {ON} Anc_4.108
           YBL007C
          Length = 1255

 Score = 33.1 bits (74), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 32/66 (48%), Gaps = 4/66 (6%)

Query: 53  SPSLEYVEAIYAF-QAQQ-DGDLNLKPGDKIQVLEKPSSEWY--KGKCNGSVGMFPSNYV 108
           +P +  V A+Y + QAQ  D +L     ++  V +    +W   + K  G+ G  P NYV
Sbjct: 68  APVINSVRALYDYDQAQNPDEELTFHENEEFDVYDDQDPDWLLVQQKSTGACGFVPGNYV 127

Query: 109 KPAFSG 114
           +P   G
Sbjct: 128 EPCGQG 133

 Score = 32.0 bits (71), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 35/64 (54%), Gaps = 8/64 (12%)

Query: 56  LEYVEAIYAFQAQQDGDLNLKPGDKIQVLEKPS-SEWY--KGKCNGS-----VGMFPSNY 107
           L   +A+Y ++ Q   +L ++  + + +LEK    EW+  K +  GS     VG+ PSNY
Sbjct: 5   LGVYKALYDYEPQTTEELAIREDELLYLLEKSDVDEWWTVKKRVIGSDADEPVGLVPSNY 64

Query: 108 VKPA 111
           V+ A
Sbjct: 65  VEQA 68

>KLTH0C06028g Chr3 (520445..521473) [1029 bp, 342 aa] {ON} similar
           to uniprot|P40073 Saccharomyces cerevisiae YER118C SHO1
           Transmembrane osmosensor participates in activation of
           both the Cdc42p- and MAP kinase-dependent filamentous
           growth pathway and the high- osmolarity glycerol
           response pathway
          Length = 342

 Score = 32.7 bits (73), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 32/58 (55%), Gaps = 3/58 (5%)

Query: 55  SLEYV-EAIYAFQAQQDG--DLNLKPGDKIQVLEKPSSEWYKGKCNGSVGMFPSNYVK 109
           S  YV +A+Y + A  +   +++ + G+ ++V +     W   + NG  G+ PSNYV+
Sbjct: 278 SFPYVAKALYTYTADSNDAYEVSFEQGEMLRVGDIEGRWWKAKRANGETGIIPSNYVE 335

>Suva_5.239 Chr5 complement(373672..374778) [1107 bp, 368 aa] {ON}
           YER118C (REAL)
          Length = 368

 Score = 32.7 bits (73), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 15/52 (28%), Positives = 28/52 (53%), Gaps = 2/52 (3%)

Query: 60  EAIYAFQAQQDG--DLNLKPGDKIQVLEKPSSEWYKGKCNGSVGMFPSNYVK 109
           +A+Y + A  D   +++ +  + +QV +     W   + NG  G+ PSNYV+
Sbjct: 307 KALYPYDADGDDAYEISFEQNEILQVSDIEGRWWKARRANGETGIIPSNYVQ 358

>KNAG0C03390 Chr3 (667055..668083) [1029 bp, 342 aa] {ON} Anc_7.419
           YER118C
          Length = 342

 Score = 32.3 bits (72), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 14/52 (26%), Positives = 30/52 (57%), Gaps = 2/52 (3%)

Query: 60  EAIYAFQAQQDG--DLNLKPGDKIQVLEKPSSEWYKGKCNGSVGMFPSNYVK 109
           +A+Y++ A  +   +++ + G+ ++V +     W   + NG  G+ PSNYV+
Sbjct: 287 KALYSYDADSNDQYEVSFEQGEILKVSDIEGRWWKARRANGETGIIPSNYVE 338

>TDEL0G02490 Chr7 (478524..481076) [2553 bp, 850 aa] {ON} Anc_2.319
           YDL117W
          Length = 850

 Score = 32.7 bits (73), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 28/53 (52%), Gaps = 4/53 (7%)

Query: 59  VEAIYAFQAQQDGDLNLKPGDKIQVLEKPSSEWYKGKC---NGSVGMFPSNYV 108
           V+A Y +  Q  GDL    GD ++V  + + +W+ GK        G FP+N+V
Sbjct: 13  VKARYGWSGQTKGDLGFLEGDVMEV-TRITGDWFYGKLLRNKKCSGYFPNNFV 64

>ZYRO0B03850g Chr2 complement(320570..323839) [3270 bp, 1089 aa]
           {ON} some similarities with uniprot|P39969 Saccharomyces
           cerevisiae YER114C BOI2 Protein implicated in polar
           growth functionally redundant with Boi1p interacts with
           bud- emergence protein Bem1p contains an SH3 (src
           homology 3) domain and a PH (pleckstrin homology) domain
          Length = 1089

 Score = 32.7 bits (73), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 27/48 (56%), Gaps = 5/48 (10%)

Query: 62  IYAFQAQQDGDLNLKPGDKIQVL---EKPSSEWYKGK--CNGSVGMFP 104
           I  +  +   +L++KPGDKIQV+   E+ +  WY G+       G+FP
Sbjct: 43  INEYTKRMQDELDMKPGDKIQVITDDEEYNDGWYYGRNLRTNEEGLFP 90

>SAKL0H21912g Chr8 complement(1913307..1917068) [3762 bp, 1253 aa]
           {ON} similar to uniprot|P32790 Saccharomyces cerevisiae
           YBL007C SLA1 Cytoskeletal protein binding protein
           required for assembly of the cortical actin cytoskeleton
           contains 3 SH3 domains interacts with proteins
           regulating actin dynamics and with proteins required for
           endocytosis
          Length = 1253

 Score = 32.7 bits (73), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 36/73 (49%), Gaps = 7/73 (9%)

Query: 53  SPSLEYVEAIYAFQAQQ--DGDLNLKPGDKIQVLEKPSSEWY--KGKCNGSVGMFPSNYV 108
           +P + + +A+Y +   Q  D +L    GD+  V +    +W     K +G +G  P NYV
Sbjct: 68  APVISHAKALYDYDQVQNPDEELLFHEGDEFDVYDNRDPDWILCSSKTSGEIGFVPGNYV 127

Query: 109 KPAFS---GSNGF 118
           + + +   GSN F
Sbjct: 128 EISEATPVGSNSF 140

 Score = 31.2 bits (69), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 35/64 (54%), Gaps = 8/64 (12%)

Query: 56  LEYVEAIYAFQAQQDGDLNLKPGDKIQVLEKPS-SEWY--KGKCNGS-----VGMFPSNY 107
           L   +AIYA+Q Q   +L +   D + +L+K    +W+  K +  G+     VG+ P+NY
Sbjct: 5   LGVYKAIYAYQPQNPEELAIDEEDLLYLLQKSDVDDWWTVKKRVIGTDQEEPVGLVPNNY 64

Query: 108 VKPA 111
           ++ A
Sbjct: 65  IEQA 68

 Score = 30.8 bits (68), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 40/81 (49%), Gaps = 15/81 (18%)

Query: 45  NANGNR------------SSSPSLEYVEAIYAFQAQQDGDLNLKPGDKIQVL-EKPSSEW 91
           NANG R            SSS S +  + IY F  +   +L++K G  + +L +K S +W
Sbjct: 325 NANGLREVEAASKHVNRPSSSGSRKQGKIIYDFIGESADELSVKEGQLVYILNDKKSKDW 384

Query: 92  YKGKC--NGSVGMFPSNYVKP 110
           +  +    G  G+ P+ +V+P
Sbjct: 385 WMCESVDTGKQGVVPAQFVEP 405

>NCAS0A14530 Chr1 complement(2863100..2866171) [3072 bp, 1023 aa]
           {ON} Anc_7.413 YBL085W
          Length = 1023

 Score = 32.7 bits (73), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 16/54 (29%), Positives = 29/54 (53%), Gaps = 5/54 (9%)

Query: 61  AIYAFQAQQDGDLNLKPGDKIQVL---EKPSSEWYKGK--CNGSVGMFPSNYVK 109
            I  +  + + +L+++PGDKIQVL   E+    WY G+       G++P  + +
Sbjct: 47  CINEYTKRMEDELDMRPGDKIQVLIDDEEYDDGWYFGRNLRTQEEGLYPVTFTQ 100

>Kpol_534.6 s534 (20451..23111) [2661 bp, 886 aa] {ON}
           (20451..23111) [2661 nt, 887 aa]
          Length = 886

 Score = 32.7 bits (73), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 29/56 (51%), Gaps = 10/56 (17%)

Query: 59  VEAIYAFQAQQDGDLNLKPGDKIQVLEKPSSEWYKG------KCNGSVGMFPSNYV 108
           V A Y +  Q  GDL    GD ++V +K + +W+ G      KC+   G FP N+V
Sbjct: 10  VRARYGWSGQTKGDLGFLEGDVMEV-KKITGDWFYGTLLRNKKCS---GYFPKNFV 61

>NDAI0B03330 Chr2 (848506..851265) [2760 bp, 919 aa] {ON} Anc_2.319
           YDL117W
          Length = 919

 Score = 32.7 bits (73), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 27/53 (50%), Gaps = 4/53 (7%)

Query: 59  VEAIYAFQAQQDGDLNLKPGDKIQVLEKPSSEWYKGKC---NGSVGMFPSNYV 108
           V A Y +  Q  GDL    GD ++V  + + +W+ GK        G FP+N+V
Sbjct: 15  VRAKYGWSGQAKGDLGFLEGDIMEV-TRVAGDWFYGKLLRNRKCAGYFPNNFV 66

>Suva_5.235 Chr5 complement(366285..369416) [3132 bp, 1043 aa] {ON}
           YER114C (REAL)
          Length = 1043

 Score = 32.3 bits (72), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 28/49 (57%), Gaps = 5/49 (10%)

Query: 61  AIYAFQAQQDGDLNLKPGDKIQVL---EKPSSEWYKGK--CNGSVGMFP 104
           AI  +  + + +L++KPGDKI+V+   EK    WY G+       G++P
Sbjct: 50  AINEYFKRMEDELDMKPGDKIKVITDDEKYKDGWYFGRNLRTNEEGLYP 98

>TBLA0C04100 Chr3 (990555..994463) [3909 bp, 1302 aa] {ON} Anc_4.108
           YBL007C
          Length = 1302

 Score = 32.3 bits (72), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 33/64 (51%), Gaps = 8/64 (12%)

Query: 56  LEYVEAIYAFQAQQDGDLNLKPGDKIQVLEKPS-SEWYKGK-------CNGSVGMFPSNY 107
           L   +A+YA++ Q   +L ++  D + +LEK    +W+  K        +   G+ PSNY
Sbjct: 5   LGIYKAVYAYEPQTPEELAIEEDDLLYLLEKSDVDDWWTVKKRVLGTDADEPTGLVPSNY 64

Query: 108 VKPA 111
           V+ A
Sbjct: 65  VEEA 68

 Score = 32.0 bits (71), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 34/60 (56%), Gaps = 4/60 (6%)

Query: 63  YAFQAQQDGDLNLKPGDKIQVL-EKPSSEWYKGKC--NGSVGMFPSNYVKPAFSGSNGFT 119
           Y F A+   +L +  GD + V+ ++ SSEW+  +    G  G+ P+++V+P F   +G T
Sbjct: 403 YDFLAESHDELTVHAGDAVYVIDDQKSSEWWMVELISTGKKGVVPADFVEP-FREKSGHT 461

 Score = 30.8 bits (68), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 29/66 (43%), Gaps = 4/66 (6%)

Query: 53  SPSLEYVEAIYAFQAQQ--DGDLNLKPGDKIQVLEKPSSEWY--KGKCNGSVGMFPSNYV 108
           +P +  V+AIY +   Q  D +L     +   V +    +W   K +    VG  P NYV
Sbjct: 68  APIISQVKAIYNYDEAQNPDEELLFNENEIFDVFDDRDQDWLLVKSRSANQVGFVPGNYV 127

Query: 109 KPAFSG 114
           +P   G
Sbjct: 128 EPISGG 133

>Ecym_7141 Chr7 (283803..286892) [3090 bp, 1029 aa] {ON} similar to
           Ashbya gossypii AGL293C
          Length = 1029

 Score = 32.3 bits (72), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 29/49 (59%), Gaps = 5/49 (10%)

Query: 61  AIYAFQAQQDGDLNLKPGDKIQVL---EKPSSEWYKGK--CNGSVGMFP 104
           AI  +  + + +L++KPGDKI+ +   ++ +  WY G+    G  G++P
Sbjct: 56  AINEYSKRMEDELDMKPGDKIEAITDDQEYNDGWYYGRNLRTGEEGLYP 104

>TDEL0C02730 Chr3 complement(479746..482796) [3051 bp, 1016 aa]
          {ON} Anc_7.413 YER114C
          Length = 1016

 Score = 32.0 bits (71), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 28/45 (62%), Gaps = 4/45 (8%)

Query: 54 PSLEYVEAIYAFQAQQDGDLNLKPGDKIQVL---EKPSSEWYKGK 95
          P   Y+ AI  +  + + +L++KPGDKIQV+   E+ +  W+ G+
Sbjct: 39 PCPMYI-AINEYTKRMEDELDMKPGDKIQVITTDEEYNDGWFYGR 82

>TBLA0I01050 Chr9 (210595..211710) [1116 bp, 371 aa] {ON} Anc_7.419
           YER118C
          Length = 371

 Score = 31.6 bits (70), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 13/52 (25%), Positives = 31/52 (59%), Gaps = 2/52 (3%)

Query: 60  EAIYAFQAQQDG--DLNLKPGDKIQVLEKPSSEWYKGKCNGSVGMFPSNYVK 109
            A+Y+++A ++   +++ +  + ++V +     W   + NG+ G+ PSNYV+
Sbjct: 317 RALYSYKANENDAYEISFEQNELLEVSDIEGRWWKARRENGTTGIIPSNYVE 368

>KLLA0D16874g Chr4 complement(1430953..1431636) [684 bp, 227 aa]
           {ON} similar to uniprot|Q12163 Saccharomyces cerevisiae
           YDR162C NBP2 Protein involved in the HOG (high
           osmolarity glycerol) pathway negatively regulates Hog1p
           by recruitment of phosphatase Ptc1p the Pbs2p-Hog1p
           complex found in the nucleus and cytoplasm contains an
           SH3 domain that binds Pbs2p
          Length = 227

 Score = 31.2 bits (69), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 24/51 (47%), Gaps = 2/51 (3%)

Query: 61  AIYAFQAQQDGDLNLKPGDKIQVLEKPSSEWY--KGKCNGSVGMFPSNYVK 109
           A+YAF  + D +L LK GD + +  K    W   +       G+ P  YV+
Sbjct: 67  AMYAFVPENDNELELKEGDVVYISYKHGQGWLVAENHDRSKTGLVPEEYVQ 117

>TPHA0E00730 Chr5 (139190..142126) [2937 bp, 978 aa] {ON} Anc_7.413
           YER114C
          Length = 978

 Score = 32.0 bits (71), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 27/49 (55%), Gaps = 5/49 (10%)

Query: 61  AIYAFQAQQDGDLNLKPGDKIQVLEKPSSE---WYKGKC--NGSVGMFP 104
           AI  ++ + + +LN++ GDKIQV+   S     WY GK       G++P
Sbjct: 38  AINQYEKRMEDELNMQLGDKIQVITDDSEYNDGWYYGKNLRTQEEGLYP 86

>ZYRO0A02662g Chr1 (213322..215982) [2661 bp, 886 aa] {ON} similar
           to uniprot|Q07533 Saccharomyces cerevisiae YDL117W CYK3
           SH3-domain protein located in the mother-bud neck and
           the cytokinetic actin ring mutant phenotype and genetic
           interactions suggest a role in cytokinesis
          Length = 886

 Score = 32.0 bits (71), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 28/53 (52%), Gaps = 4/53 (7%)

Query: 59  VEAIYAFQAQQDGDLNLKPGDKIQVLEKPSSEWYKGKC---NGSVGMFPSNYV 108
           V+A Y +  Q  GDL    GD ++V  + + +W+ G+        G FP+N+V
Sbjct: 14  VKARYGWSGQTKGDLGFLEGDVMEV-TRITGDWFYGRLLRNKKCSGYFPNNFV 65

>TDEL0C02810 Chr3 complement(498625..499638) [1014 bp, 337 aa] {ON}
           Anc_7.419 YER118C
          Length = 337

 Score = 31.6 bits (70), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 29/53 (54%), Gaps = 4/53 (7%)

Query: 60  EAIYAFQAQQDGD---LNLKPGDKIQVLEKPSSEWYKGKCNGSVGMFPSNYVK 109
           + +Y++QA   GD   ++   G+ ++V +     W   + NG  G+ PSNYV+
Sbjct: 279 KTLYSYQADA-GDAYEISFDQGEILKVSDIEGRWWKAKRANGETGIIPSNYVQ 330

>Kpol_1025.40 s1025 (104879..108487) [3609 bp, 1202 aa] {ON}
           (104879..108487) [3609 nt, 1203 aa]
          Length = 1202

 Score = 32.0 bits (71), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 34/60 (56%), Gaps = 8/60 (13%)

Query: 60  EAIYAFQAQQDGDLNLKPGDKIQVLEKPS-SEWY--KGKCNGS-----VGMFPSNYVKPA 111
           +AIY ++ Q   +L ++  D + +LEK +  +W+  K +  GS      G+ PSNYV+ A
Sbjct: 9   KAIYNYEPQTPDELTIQEDDLLYLLEKSNVDDWWTVKKRVIGSDIDEPAGLVPSNYVEVA 68

 Score = 30.0 bits (66), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 17/71 (23%), Positives = 38/71 (53%), Gaps = 3/71 (4%)

Query: 43  DPNANGNRSSSPSLEYVEAIYAFQAQQDGDLNLKPGDKIQVL-EKPSSEWYKGKC--NGS 99
           DP       +S S +    +Y F A+ + +L +K G  + ++ ++ S +W+  +   +G 
Sbjct: 369 DPGFKEVEMASKSKKKGNVLYDFTAESNDELTIKQGQVVYIINDQKSKDWWLCELIDSGK 428

Query: 100 VGMFPSNYVKP 110
            G+ PS++++P
Sbjct: 429 RGVVPSHFIEP 439

>KLTH0B02354g Chr2 (186128..189772) [3645 bp, 1214 aa] {ON} weakly
           similar to uniprot|P47068 Saccharomyces cerevisiae
           YJL020C BBC1 Protein possibly involved in assembly of
           actin patches interacts with an actin assembly factor
           Las17p and with the SH3 domains of Type I myosins Myo3p
           and Myo5p localized predominantly to cortical actin
           patches
          Length = 1214

 Score = 31.6 bits (70), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 27/56 (48%), Gaps = 5/56 (8%)

Query: 59  VEAIYAFQAQQDGDLNLKPGDKIQVLEKPSSEWYKGKCNGSV-----GMFPSNYVK 109
           V A + + ++ D DLN + G  I V      EWY G+          G+FP ++VK
Sbjct: 10  VIAQFPYTSEHDDDLNFEKGSLITVQSIEDDEWYFGEYQDESGTYKEGIFPRSFVK 65

>Smik_5.263 Chr5 complement(407025..408131) [1107 bp, 368 aa] {ON}
           YER118C (REAL)
          Length = 368

 Score = 31.6 bits (70), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 14/52 (26%), Positives = 28/52 (53%), Gaps = 2/52 (3%)

Query: 60  EAIYAFQAQQDG--DLNLKPGDKIQVLEKPSSEWYKGKCNGSVGMFPSNYVK 109
           +A+Y + A  +   +++ +  + +QV +     W   + NG  G+ PSNYV+
Sbjct: 307 KALYPYDADDEDAYEISFEQNEILQVSDIEGRWWKARRANGETGIIPSNYVQ 358

>Smik_10.251 Chr10 complement(395243..398611) [3369 bp, 1122 aa]
           {ON} YJL020C (REAL)
          Length = 1122

 Score = 31.6 bits (70), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 32/62 (51%), Gaps = 5/62 (8%)

Query: 59  VEAIYAFQAQQDGDLNLKPGDKIQVLEKPSSEWYKGK---CNGSV--GMFPSNYVKPAFS 113
           V A + +++  + DLN +   +I V     +EWY G+    NG V  G+FP ++V    S
Sbjct: 10  VVAQFPYKSDYEDDLNFEKDQEITVTSVEDAEWYFGEYQDSNGEVIEGIFPKSFVAAQVS 69

Query: 114 GS 115
            S
Sbjct: 70  ES 71

>Ecym_8219 Chr8 (447011..450085) [3075 bp, 1024 aa] {ON} similar to
           Ashbya gossypii AGR306C
          Length = 1024

 Score = 31.6 bits (70), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 35/66 (53%), Gaps = 6/66 (9%)

Query: 49  NRSSSPSLEY-VEAIYAFQAQQDGDLNLKPGDKIQVLEKPSSEWYKGKCNGS-----VGM 102
           N++  P + + V A ++++++   DL+   G KI V+    ++WY G    S      G+
Sbjct: 2   NKAKEPEIPFQVVAQFSYKSEYKHDLHFDKGQKILVISIEDNQWYYGHFVDSEGKQREGI 61

Query: 103 FPSNYV 108
           FP ++V
Sbjct: 62  FPKSFV 67

>TBLA0A00610 Chr1 complement(119166..120959) [1794 bp, 597 aa] {ON}
           Anc_8.539 YBR200W
          Length = 597

 Score = 31.6 bits (70), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 19/79 (24%), Positives = 38/79 (48%), Gaps = 4/79 (5%)

Query: 33  QISNSLPQRYDPNANGNRSSSPSLEYVEAIYAFQAQQDGDLNLKPGDKIQVLEKPSSEWY 92
            I N LP   + + +  +    SL Y   +Y F+A ++ +L +  G+ + +      EW+
Sbjct: 141 DIENLLPDSKEISGDKKKKIFKSL-YALCLYDFEAAKEDELTVYAGETLFIYAHYEEEWF 199

Query: 93  KGKCNGSV---GMFPSNYV 108
            G+  G +   G+ P ++V
Sbjct: 200 IGRPLGRIGGPGLVPISFV 218

>CAGL0G06842g Chr7 complement(651033..654152) [3120 bp, 1039 aa]
           {ON} weakly similar to uniprot|P47068 Saccharomyces
           cerevisiae YJL020c
          Length = 1039

 Score = 31.6 bits (70), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 30/55 (54%), Gaps = 5/55 (9%)

Query: 59  VEAIYAFQAQQDGDLNLKPGDKIQVLEKPSSEWYKGK-CNGS----VGMFPSNYV 108
           V A + +Q++ + DLN + G  I V      EWY G+  +G+     G+FP ++V
Sbjct: 8   VVASFPYQSEYEDDLNFEKGQVITVTNIEDDEWYYGEYVDGTGASHEGIFPKSFV 62

>Smik_5.259 Chr5 complement(399447..402572) [3126 bp, 1041 aa] {ON}
           YER114C (REAL)
          Length = 1041

 Score = 31.2 bits (69), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 20/78 (25%), Positives = 39/78 (50%), Gaps = 5/78 (6%)

Query: 32  QQISNSLPQRYDPNANGNRSSSPSLEYVEAIYAFQAQQDGDLNLKPGDKIQVL---EKPS 88
           + +S++L   YD   + +     +     AI  +  + + +L++KPGDKI+V+   E+  
Sbjct: 21  KDVSDTLSPDYDSKGSSSGCEGGNFPMYIAINEYFKRMEDELDMKPGDKIKVITDDEEYK 80

Query: 89  SEWYKGK--CNGSVGMFP 104
             WY G+       G++P
Sbjct: 81  DGWYFGRNLRTNEEGLYP 98

>ZYRO0F01166g Chr6 complement(90553..92799) [2247 bp, 748 aa] {ON}
           similar to uniprot|Q05080 Saccharomyces cerevisiae
           YMR032W HOF1 Bud neck-localized SH3 domain-containing
           protein required for cytokinesis
          Length = 748

 Score = 31.2 bits (69), Expect = 2.3,   Method: Composition-based stats.
 Identities = 16/64 (25%), Positives = 32/64 (50%), Gaps = 9/64 (14%)

Query: 56  LEYVEAIYAFQAQQDGDL-NLKPGDKIQVLEKPSSEWYKGKC--------NGSVGMFPSN 106
           ++Y +A+Y    +   +L   + GD + +  + + EWY+G+           S G+ P N
Sbjct: 683 IKYAKAVYPLYEENVPELAQFQRGDYLLITGEVNDEWYRGEVYSNDYVSQGSSSGLIPHN 742

Query: 107 YVKP 110
           ++KP
Sbjct: 743 FIKP 746

>Kwal_33.15339 s33 complement(1065599..1069153) [3555 bp, 1184 aa]
           {ON} YJL020C (BBC1) - 1:1 [contig 290] FULL
          Length = 1184

 Score = 31.2 bits (69), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 28/56 (50%), Gaps = 5/56 (8%)

Query: 59  VEAIYAFQAQQDGDLNLKPGDKIQVLEKPSSEWYKGKCNGS-----VGMFPSNYVK 109
           V A + + ++ + DLN + G +I V      EWY G+          G+FP ++VK
Sbjct: 10  VIAQFPYSSEHEDDLNFEKGRRITVQSIEDEEWYFGEYRTEDGEFREGIFPRSFVK 65

>YJL020C Chr10 complement(398937..402410) [3474 bp, 1157 aa] {ON}
           BBC1Protein possibly involved in assembly of actin
           patches; interacts with an actin assembly factor Las17p
           and with the SH3 domains of Type I myosins Myo3p and
           Myo5p; localized predominantly to cortical actin patches
          Length = 1157

 Score = 31.2 bits (69), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 33/62 (53%), Gaps = 7/62 (11%)

Query: 59  VEAIYAFQAQQDGDLNLKPGDKIQVLEKPSSEWYKGK---CNGSV--GMFPSNYVKPAFS 113
           V A + +++  + DLN +   +I V     +EWY G+    NG V  G+FP ++V  A  
Sbjct: 10  VVAQFPYKSDYEDDLNFEKDQEIIVTSVEDAEWYFGEYQDSNGDVIEGIFPKSFV--AVQ 67

Query: 114 GS 115
           GS
Sbjct: 68  GS 69

>Suva_10.406 Chr10 complement(713226..717989) [4764 bp, 1587 aa]
           {ON} YLR310C (REAL)
          Length = 1587

 Score = 31.2 bits (69), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 33/63 (52%), Gaps = 11/63 (17%)

Query: 59  VEAIYAFQ--AQQDGD---LNLKPGDKIQVLEKPSSEWYKG----KCNGSV--GMFPSNY 107
           V A Y F    ++DG    L+++ GD I +L K SS W+ G      +G V  G FP N+
Sbjct: 66  VVAAYDFNHPTKKDGSSQLLSVQQGDTIYILNKNSSGWWDGLVIDDSSGKVDRGWFPQNF 125

Query: 108 VKP 110
            +P
Sbjct: 126 GRP 128

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.130    0.376 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 18,757,433
Number of extensions: 678009
Number of successful extensions: 2129
Number of sequences better than 10.0: 299
Number of HSP's gapped: 2057
Number of HSP's successfully gapped: 358
Length of query: 230
Length of database: 53,481,399
Length adjustment: 106
Effective length of query: 124
Effective length of database: 41,326,803
Effective search space: 5124523572
Effective search space used: 5124523572
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 64 (29.3 bits)