Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0F00748g3.569ON70770737280.0
NCAS0E002503.569ON70870831920.0
NDAI0I032503.569ON70970931880.0
KAFR0J028903.569ON70670731830.0
Kpol_507.83.569ON70770731560.0
KLLA0A00682g3.569ON70870831300.0
Kwal_47.192723.569ON70470530850.0
TDEL0D063703.569ON70670630780.0
KNAG0I002203.569ON70770730590.0
Suva_7.163.569ON70870830560.0
YGL245W (GUS1)3.569ON70870830540.0
KLTH0G00682g3.569ON70470530530.0
Skud_7.223.569ON70870830480.0
Smik_7.163.569ON70870830480.0
CAGL0C01947g3.569ON70570830410.0
TPHA0A060203.569ON70770730020.0
AFR264W3.569ON70770729940.0
ZYRO0E09570g3.569ON70670629330.0
TBLA0E001903.569ON70770828500.0
ZYRO0C07018g6.51ON8034466189e-69
TDEL0G041906.51ON8093876021e-66
YOR168W (GLN4)6.51ON8093756022e-66
SAKL0E02134g6.51ON8015465906e-65
KNAG0M011006.51ON7994405906e-65
Smik_15.3486.51ON8103755881e-64
NCAS0F002406.51ON8114495828e-64
Skud_15.3326.51ON8093395801e-63
Kwal_56.225596.51ON8003775757e-63
Kpol_1037.386.51ON8083745731e-62
AGR259C6.51ON7983775712e-62
KAFR0G026106.51ON7943815703e-62
TBLA0G004506.51ON8083855695e-62
NDAI0K028606.51ON8143855696e-62
Suva_8.2236.51ON8213755679e-62
KLTH0C10340g6.51ON8003845661e-61
CAGL0L04532g6.51ON7953845651e-61
KLLA0F20449g6.51ON8043245633e-61
TPHA0J005506.51ON8083375545e-60
Ecym_31356.51ON8043775466e-59
KNAG0L006207.100ON5172322092e-16
NDAI0A084607.100ON5293521894e-14
NCAS0I005607.100ON5272211832e-13
TBLA0E021807.100ON5312751681e-11
TPHA0L005907.100ON5582661653e-11
Kpol_1044.127.100ON5362421627e-11
CAGL0F01133g7.100ON5322321619e-11
Suva_15.1347.100ON5353801573e-10
Ecym_26267.100ON5733461539e-10
KAFR0D013207.100ON5142311539e-10
YOL033W (MSE1)7.100ON5362341531e-09
TDEL0H035007.100ON5342251493e-09
Skud_15.1227.100ON5323251467e-09
SAKL0B09548g7.100ON5542511422e-08
KLLA0F07975g7.100ON5422751412e-08
KLTH0D02794g7.100ON5462301413e-08
Smik_15.1327.100ON5353771403e-08
AEL338C7.100ON5332381386e-08
Kwal_26.72027.100ON5672371315e-07
ZYRO0D05808g7.100ON5332331172e-05
KNAG0C032305.527ON561144733.7
TPHA0E024503.554ON90194717.3
ZYRO0C05368g7.130ON210131688.9
Smik_13.2322.616ON850139709.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0F00748g
         (707 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0F00748g Chr6 (64800..66923) [2124 bp, 707 aa] {ON} highly s...  1440   0.0  
NCAS0E00250 Chr5 (36306..38432) [2127 bp, 708 aa] {ON} Anc_3.569     1234   0.0  
NDAI0I03250 Chr9 complement(762687..764816) [2130 bp, 709 aa] {O...  1232   0.0  
KAFR0J02890 Chr10 complement(549654..551774) [2121 bp, 706 aa] {...  1230   0.0  
Kpol_507.8 s507 (51597..53720) [2124 bp, 707 aa] {ON} (51597..53...  1220   0.0  
KLLA0A00682g Chr1 (67685..69811) [2127 bp, 708 aa] {ON} highly s...  1210   0.0  
Kwal_47.19272 s47 complement(1165848..1167962) [2115 bp, 704 aa]...  1192   0.0  
TDEL0D06370 Chr4 complement(1143917..1146037) [2121 bp, 706 aa] ...  1190   0.0  
KNAG0I00220 Chr9 (26235..28358) [2124 bp, 707 aa] {ON} Anc_3.569...  1182   0.0  
Suva_7.16 Chr7 (33556..35682) [2127 bp, 708 aa] {ON} YGL245W (REAL)  1181   0.0  
YGL245W Chr7 (39023..41149) [2127 bp, 708 aa] {ON}  GUS1Glutamyl...  1181   0.0  
KLTH0G00682g Chr7 (45680..47794) [2115 bp, 704 aa] {ON} highly s...  1180   0.0  
Skud_7.22 Chr7 (43191..45317) [2127 bp, 708 aa] {ON} YGL245W (REAL)  1178   0.0  
Smik_7.16 Chr7 (33804..35930) [2127 bp, 708 aa] {ON} YGL245W (REAL)  1178   0.0  
CAGL0C01947g Chr3 (204411..206528) [2118 bp, 705 aa] {ON} highly...  1176   0.0  
TPHA0A06020 Chr1 complement(1361027..1363150) [2124 bp, 707 aa] ...  1160   0.0  
AFR264W Chr6 (908580..910703) [2124 bp, 707 aa] {ON} Syntenic ho...  1157   0.0  
ZYRO0E09570g Chr5 complement(762205..764325) [2121 bp, 706 aa] {...  1134   0.0  
TBLA0E00190 Chr5 (24885..27008) [2124 bp, 707 aa] {ON} Anc_3.569...  1102   0.0  
ZYRO0C07018g Chr3 (528834..531245) [2412 bp, 803 aa] {ON} highly...   242   9e-69
TDEL0G04190 Chr7 (761363..763792) [2430 bp, 809 aa] {ON} Anc_6.5...   236   1e-66
YOR168W Chr15 (649303..651732) [2430 bp, 809 aa] {ON}  GLN4Gluta...   236   2e-66
SAKL0E02134g Chr5 complement(162366..164771) [2406 bp, 801 aa] {...   231   6e-65
KNAG0M01100 Chr13 (194806..197205) [2400 bp, 799 aa] {ON} Anc_6....   231   6e-65
Smik_15.348 Chr15 (605412..607844) [2433 bp, 810 aa] {ON} YOR168...   231   1e-64
NCAS0F00240 Chr6 complement(37406..39841) [2436 bp, 811 aa] {ON}...   228   8e-64
Skud_15.332 Chr15 (598097..600526) [2430 bp, 809 aa] {ON} YOR168...   228   1e-63
Kwal_56.22559 s56 complement(179568..181970) [2403 bp, 800 aa] {...   226   7e-63
Kpol_1037.38 s1037 complement(93063..95489) [2427 bp, 808 aa] {O...   225   1e-62
AGR259C Chr7 complement(1227063..1229459) [2397 bp, 798 aa] {ON}...   224   2e-62
KAFR0G02610 Chr7 (538902..541286) [2385 bp, 794 aa] {ON} Anc_6.5...   224   3e-62
TBLA0G00450 Chr7 complement(90053..92479) [2427 bp, 808 aa] {ON}...   223   5e-62
NDAI0K02860 Chr11 (646106..648550) [2445 bp, 814 aa] {ON} Anc_6....   223   6e-62
Suva_8.223 Chr8 (399431..401896) [2466 bp, 821 aa] {ON} YOR168W ...   223   9e-62
KLTH0C10340g Chr3 (857898..860300) [2403 bp, 800 aa] {ON} highly...   222   1e-61
CAGL0L04532g Chr12 (524088..526475) [2388 bp, 795 aa] {ON} highl...   222   1e-61
KLLA0F20449g Chr6 (1898253..1900667) [2415 bp, 804 aa] {ON} high...   221   3e-61
TPHA0J00550 Chr10 complement(123101..125527) [2427 bp, 808 aa] {...   218   5e-60
Ecym_3135 Chr3 (250906..253320) [2415 bp, 804 aa] {ON} similar t...   214   6e-59
KNAG0L00620 Chr12 complement(92148..93701) [1554 bp, 517 aa] {ON...    85   2e-16
NDAI0A08460 Chr1 (1951121..1952710) [1590 bp, 529 aa] {ON} Anc_7...    77   4e-14
NCAS0I00560 Chr9 complement(89020..90603) [1584 bp, 527 aa] {ON}...    75   2e-13
TBLA0E02180 Chr5 complement(532174..533769) [1596 bp, 531 aa] {O...    69   1e-11
TPHA0L00590 Chr12 complement(100345..102021) [1677 bp, 558 aa] {...    68   3e-11
Kpol_1044.12 s1044 complement(21668..23278) [1611 bp, 536 aa] {O...    67   7e-11
CAGL0F01133g Chr6 complement(114888..116486) [1599 bp, 532 aa] {...    67   9e-11
Suva_15.134 Chr15 (235964..237571) [1608 bp, 535 aa] {ON} YOL033...    65   3e-10
Ecym_2626 Chr2 (1212098..1213819) [1722 bp, 573 aa] {ON} similar...    64   9e-10
KAFR0D01320 Chr4 complement(262226..263770) [1545 bp, 514 aa] {O...    64   9e-10
YOL033W Chr15 (263475..265085) [1611 bp, 536 aa] {ON}  MSE1Mitoc...    64   1e-09
TDEL0H03500 Chr8 (582143..583747) [1605 bp, 534 aa] {ON} Anc_7.1...    62   3e-09
Skud_15.122 Chr15 (222353..223951) [1599 bp, 532 aa] {ON} YOL033...    61   7e-09
SAKL0B09548g Chr2 (809247..810911) [1665 bp, 554 aa] {ON} simila...    59   2e-08
KLLA0F07975g Chr6 complement(746708..748336) [1629 bp, 542 aa] {...    59   2e-08
KLTH0D02794g Chr4 complement(270516..272156) [1641 bp, 546 aa] {...    59   3e-08
Smik_15.132 Chr15 (229667..231274) [1608 bp, 535 aa] {ON} YOL033...    59   3e-08
AEL338C Chr5 complement(12870..14471) [1602 bp, 533 aa] {ON} Syn...    58   6e-08
Kwal_26.7202 s26 complement(261450..263153) [1704 bp, 567 aa] {O...    55   5e-07
ZYRO0D05808g Chr4 complement(493474..495075) [1602 bp, 533 aa] {...    50   2e-05
KNAG0C03230 Chr3 (632659..634344) [1686 bp, 561 aa] {ON} Anc_5.5...    33   3.7  
TPHA0E02450 Chr5 (520692..523397) [2706 bp, 901 aa] {ON} Anc_3.5...    32   7.3  
ZYRO0C05368g Chr3 complement(414760..415392) [633 bp, 210 aa] {O...    31   8.9  
Smik_13.232 Chr13 complement(364426..366978) [2553 bp, 850 aa] {...    32   9.3  

>SAKL0F00748g Chr6 (64800..66923) [2124 bp, 707 aa] {ON} highly
           similar to uniprot|P46655 Saccharomyces cerevisiae
           YGL245W GUS1 Glutamyl-tRNA synthetase (GluRS) forms a
           complex with methionyl-tRNA synthetase (Mes1p) and Arc1p
           complex formation increases the catalytic efficiency of
           both tRNA synthetases and ensures their correct
           localization to the cytoplasm
          Length = 707

 Score = 1440 bits (3728), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 699/707 (98%), Positives = 699/707 (98%)

Query: 1   MSANLVINGKAPVVAYAELIAARIVNASKADAIKIEFVDDKKAAPATFNGEADSAFSKII 60
           MSANLVINGKAPVVAYAELIAARIVNASKADAIKIEFVDDKKAAPATFNGEADSAFSKII
Sbjct: 1   MSANLVINGKAPVVAYAELIAARIVNASKADAIKIEFVDDKKAAPATFNGEADSAFSKII 60

Query: 61  NAYQDVFSEGVQGSSEWSKLASEEFIIKNFQKLSGSLAKLDSRLNLRTYILDSFTATPAD 120
           NAYQDVFSEGVQGSSEWSKLASEEFIIKNFQKLSGSLAKLDSRLNLRTYILDSFTATPAD
Sbjct: 61  NAYQDVFSEGVQGSSEWSKLASEEFIIKNFQKLSGSLAKLDSRLNLRTYILDSFTATPAD 120

Query: 121 IACWGALRSNGMVGSIIKNKVYVNVSRWYTMLELDPLFSGAHEFLTKSLQELKKASNSNK 180
           IACWGALRSNGMVGSIIKNKVYVNVSRWYTMLELDPLFSGAHEFLTKSLQELKKASNSNK
Sbjct: 121 IACWGALRSNGMVGSIIKNKVYVNVSRWYTMLELDPLFSGAHEFLTKSLQELKKASNSNK 180

Query: 181 KKETHKANFEIGLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFD 240
           KKETHKANFEIGLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFD
Sbjct: 181 KKETHKANFEIGLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFD 240

Query: 241 DTNPSKEKVEFQDSILEDLDLLGIKGDKITYSSDYFEEMYQLCVQLIKEGKAYCDDTPTE 300
           DTNPSKEKVEFQDSILEDLDLLGIKGDKITYSSDYFEEMYQLCVQLIKEGKAYCDDTPTE
Sbjct: 241 DTNPSKEKVEFQDSILEDLDLLGIKGDKITYSSDYFEEMYQLCVQLIKEGKAYCDDTPTE 300

Query: 301 KMREERMDGIASARRDRSVEENLRIFNEEMKNGTEEGLKNCVRAKIDYKALNKALRDPVI 360
           KMREERMDGIASARRDRSVEENLRIFNEEMKNGTEEGLKNCVRAKIDYKALNKALRDPVI
Sbjct: 301 KMREERMDGIASARRDRSVEENLRIFNEEMKNGTEEGLKNCVRAKIDYKALNKALRDPVI 360

Query: 361 FRCNLTPHHRTGTTWKMYPTYDFCVPIVDAIEGVTHALRTIEYRDRNPQYEWMLDALHLR 420
           FRCNLTPHHRTGTTWKMYPTYDFCVPIVDAIEGVTHALRTIEYRDRNPQYEWMLDALHLR
Sbjct: 361 FRCNLTPHHRTGTTWKMYPTYDFCVPIVDAIEGVTHALRTIEYRDRNPQYEWMLDALHLR 420

Query: 421 KVHIWDFARVNFVRTLLSKRKLQWMVDKGCVSNWDDPRFPTXXXXXXXXMTVEGLRNFVL 480
           KVHIWDFARVNFVRTLLSKRKLQWMVDKGCVSNWDDPRFPT        MTVEGLRNFVL
Sbjct: 421 KVHIWDFARVNFVRTLLSKRKLQWMVDKGCVSNWDDPRFPTVRGVRRRGMTVEGLRNFVL 480

Query: 481 SQGPSRNVINLEWNLIWAFNKKVIDPVAPRHTAVVKPVKLHLEGDDVPQNPKIEMKLKHK 540
           SQGPSRNVINLEWNLIWAFNKKVIDPVAPRHTAVVKPVKLHLEGDDVPQNPKIEMKLKHK
Sbjct: 481 SQGPSRNVINLEWNLIWAFNKKVIDPVAPRHTAVVKPVKLHLEGDDVPQNPKIEMKLKHK 540

Query: 541 KNPDVGEKKVIYYKDVLIDQEDADVVSEGEELTLMDWGNVIITKKNSDGSLVGKLHLEGD 600
           KNPDVGEKKVIYYKDVLIDQEDADVVSEGEELTLMDWGNVIITKKNSDGSLVGKLHLEGD
Sbjct: 541 KNPDVGEKKVIYYKDVLIDQEDADVVSEGEELTLMDWGNVIITKKNSDGSLVGKLHLEGD 600

Query: 601 FKKTKLKLTWLADTEDKVDVDLVDFDHLISKDKLEEGDNFEDFLTPETEFHTPAIADLNV 660
           FKKTKLKLTWLADTEDKVDVDLVDFDHLISKDKLEEGDNFEDFLTPETEFHTPAIADLNV
Sbjct: 601 FKKTKLKLTWLADTEDKVDVDLVDFDHLISKDKLEEGDNFEDFLTPETEFHTPAIADLNV 660

Query: 661 KDMKVGDVIQFERKGYYRLDSLAKDGKPYVFFTIPDGKAVNKYGAKK 707
           KDMKVGDVIQFERKGYYRLDSLAKDGKPYVFFTIPDGKAVNKYGAKK
Sbjct: 661 KDMKVGDVIQFERKGYYRLDSLAKDGKPYVFFTIPDGKAVNKYGAKK 707

>NCAS0E00250 Chr5 (36306..38432) [2127 bp, 708 aa] {ON} Anc_3.569
          Length = 708

 Score = 1234 bits (3192), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 590/708 (83%), Positives = 641/708 (90%), Gaps = 1/708 (0%)

Query: 1   MSANLVINGKAPVVAYAELIAARIVNASKADAIKIEFVDDKKAAPATFNGEADSAFSKII 60
           MSA LVINGKAPVVAYAELIAARIVN +K ++I IEFVDDKKAAPATFNG+   AF KI+
Sbjct: 1   MSATLVINGKAPVVAYAELIAARIVNETKPNSISIEFVDDKKAAPATFNGDNKDAFLKIV 60

Query: 61  NAYQDVFSEGVQGS-SEWSKLASEEFIIKNFQKLSGSLAKLDSRLNLRTYILDSFTATPA 119
             + DVFS   +   ++W K+ASEE +IKNFQKLS SL KLD+ LNLRT+IL     + A
Sbjct: 61  AQFSDVFSNSKEEDITQWVKMASEELVIKNFQKLSESLGKLDAHLNLRTFILGGLKYSAA 120

Query: 120 DIACWGALRSNGMVGSIIKNKVYVNVSRWYTMLELDPLFSGAHEFLTKSLQELKKASNSN 179
           DIACWGALRSNGM GSIIKNKV VNVSRWYT+LE+DP+F   HEFLTKSLQELKK +N+ 
Sbjct: 121 DIACWGALRSNGMCGSIIKNKVEVNVSRWYTLLEMDPIFGSVHEFLTKSLQELKKTANAG 180

Query: 180 KKKETHKANFEIGLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRF 239
           KKKETHKANFEI LPDAK+GEVVTRFPPEPSGYLHIGHAKAA+LNQYFAQAYKGKLIIRF
Sbjct: 181 KKKETHKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAAILNQYFAQAYKGKLIIRF 240

Query: 240 DDTNPSKEKVEFQDSILEDLDLLGIKGDKITYSSDYFEEMYQLCVQLIKEGKAYCDDTPT 299
           DDTNPSKEK EFQDSILEDL+LLGIKGD+IT+SSDYF+EMY  C+Q+IKEGKAYCDDTPT
Sbjct: 241 DDTNPSKEKEEFQDSILEDLELLGIKGDRITHSSDYFQEMYDYCIQMIKEGKAYCDDTPT 300

Query: 300 EKMREERMDGIASARRDRSVEENLRIFNEEMKNGTEEGLKNCVRAKIDYKALNKALRDPV 359
           EKMREERMDGIASARRDRSVEENL+IF EEMKNGTEEGLKNCVRAKIDYKALNK LRDPV
Sbjct: 301 EKMREERMDGIASARRDRSVEENLKIFTEEMKNGTEEGLKNCVRAKIDYKALNKTLRDPV 360

Query: 360 IFRCNLTPHHRTGTTWKMYPTYDFCVPIVDAIEGVTHALRTIEYRDRNPQYEWMLDALHL 419
           I+RCNLTPHHRTGTTWK+YPTYDFCVPIVDA+EGVTHALRTIEYRDRN QYEWML AL+L
Sbjct: 361 IYRCNLTPHHRTGTTWKVYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLQALNL 420

Query: 420 RKVHIWDFARVNFVRTLLSKRKLQWMVDKGCVSNWDDPRFPTXXXXXXXXMTVEGLRNFV 479
           RKVHIWDFARVNFVRTLLSKRKLQWMVDKG VSNWDDPRFPT        MTVEGLRNFV
Sbjct: 421 RKVHIWDFARVNFVRTLLSKRKLQWMVDKGLVSNWDDPRFPTVRGVRRRGMTVEGLRNFV 480

Query: 480 LSQGPSRNVINLEWNLIWAFNKKVIDPVAPRHTAVVKPVKLHLEGDDVPQNPKIEMKLKH 539
           LSQGPSRNVINLEWNLIWAFNKKVIDPVAPRHTA+V PVK+HLEGDDVPQ PKIEMK KH
Sbjct: 481 LSQGPSRNVINLEWNLIWAFNKKVIDPVAPRHTAIVNPVKIHLEGDDVPQTPKIEMKPKH 540

Query: 540 KKNPDVGEKKVIYYKDVLIDQEDADVVSEGEELTLMDWGNVIITKKNSDGSLVGKLHLEG 599
           KKNP VGEKKVIY+KD++ID++DAD++   EE+T+MDWGNVIIT+KN+DGSLVGKLHLEG
Sbjct: 541 KKNPAVGEKKVIYFKDIVIDKDDADLLEANEEVTMMDWGNVIITQKNADGSLVGKLHLEG 600

Query: 600 DFKKTKLKLTWLADTEDKVDVDLVDFDHLISKDKLEEGDNFEDFLTPETEFHTPAIADLN 659
           DFKKTK KLTWLADT D V VDLVDFDHLI+KDKLEE ++FEDFLTP TEFHT AIADLN
Sbjct: 601 DFKKTKHKLTWLADTPDVVPVDLVDFDHLITKDKLEEDESFEDFLTPVTEFHTDAIADLN 660

Query: 660 VKDMKVGDVIQFERKGYYRLDSLAKDGKPYVFFTIPDGKAVNKYGAKK 707
           VKDMKVGD+IQFERKGYYRLD+L KDGKPYVFFTIPDGK+VNKYGAKK
Sbjct: 661 VKDMKVGDIIQFERKGYYRLDALPKDGKPYVFFTIPDGKSVNKYGAKK 708

>NDAI0I03250 Chr9 complement(762687..764816) [2130 bp, 709 aa] {ON}
           Anc_3.569 YGL245W
          Length = 709

 Score = 1232 bits (3188), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 585/709 (82%), Positives = 646/709 (91%), Gaps = 2/709 (0%)

Query: 1   MSAN-LVINGKAPVVAYAELIAARIVNASKADAIKIEFVDDKKAAPATFNGEADSAFSKI 59
           MSAN LVINGKAPVVAY +LIAARI+N +K  +I I+FVDDKK+AP+ FNG +DS F KI
Sbjct: 1   MSANTLVINGKAPVVAYGDLIAARIINDAKPTSIDIQFVDDKKSAPSVFNGSSDSTFLKI 60

Query: 60  INAYQDVFSEGVQGS-SEWSKLASEEFIIKNFQKLSGSLAKLDSRLNLRTYILDSFTATP 118
           I  + ++F+E  + + +EW+K+A+EE ++KNFQKLS SL KLD++LNLRT+IL     + 
Sbjct: 61  IEGFPEIFTESNKDAVAEWTKIANEELVVKNFQKLSESLGKLDAQLNLRTFILGGLKYSA 120

Query: 119 ADIACWGALRSNGMVGSIIKNKVYVNVSRWYTMLELDPLFSGAHEFLTKSLQELKKASNS 178
           ADIACWGALRSNGM GSI+KNKV VNVSRWY++LE+DP F   HE LTKSLQELKK SNS
Sbjct: 121 ADIACWGALRSNGMCGSILKNKVDVNVSRWYSLLEMDPTFGSVHESLTKSLQELKKVSNS 180

Query: 179 NKKKETHKANFEIGLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIR 238
            KKKETHKANFEI LPDAK+GEVVTRFPPEPSGYLHIGHAKAA+LNQYFAQAYKGKLIIR
Sbjct: 181 GKKKETHKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAAILNQYFAQAYKGKLIIR 240

Query: 239 FDDTNPSKEKVEFQDSILEDLDLLGIKGDKITYSSDYFEEMYQLCVQLIKEGKAYCDDTP 298
           FDDTNPSKEK EFQDSILEDL+LLGIKGD+ITYSSDYF++MY+LCV++IKEGKAYCDDTP
Sbjct: 241 FDDTNPSKEKEEFQDSILEDLELLGIKGDRITYSSDYFQQMYELCVKMIKEGKAYCDDTP 300

Query: 299 TEKMREERMDGIASARRDRSVEENLRIFNEEMKNGTEEGLKNCVRAKIDYKALNKALRDP 358
           TEKMREERMDGIASARRDRSVEENLRIFNEEMKNGTEEGLKNCVRAKIDYKALNK LRDP
Sbjct: 301 TEKMREERMDGIASARRDRSVEENLRIFNEEMKNGTEEGLKNCVRAKIDYKALNKTLRDP 360

Query: 359 VIFRCNLTPHHRTGTTWKMYPTYDFCVPIVDAIEGVTHALRTIEYRDRNPQYEWMLDALH 418
           VI+RCNLTPHHRTGTTWKMYPTYDFCVPIVD++EGVTHALRTIEYRDRN QY+WMLDA++
Sbjct: 361 VIYRCNLTPHHRTGTTWKMYPTYDFCVPIVDSLEGVTHALRTIEYRDRNAQYDWMLDAMN 420

Query: 419 LRKVHIWDFARVNFVRTLLSKRKLQWMVDKGCVSNWDDPRFPTXXXXXXXXMTVEGLRNF 478
           LRKVHIWDFARVNFVRTLLSKRKLQWMVDKG VSNWDDPRFPT        MTVEGLRNF
Sbjct: 421 LRKVHIWDFARVNFVRTLLSKRKLQWMVDKGLVSNWDDPRFPTVRGVRRRGMTVEGLRNF 480

Query: 479 VLSQGPSRNVINLEWNLIWAFNKKVIDPVAPRHTAVVKPVKLHLEGDDVPQNPKIEMKLK 538
           VLSQGPSRNVINLEWNLIWAFNKKVIDPVA RHTA+V PVK+HLEGDDVPQ PK EMK K
Sbjct: 481 VLSQGPSRNVINLEWNLIWAFNKKVIDPVAARHTAIVDPVKIHLEGDDVPQTPKTEMKPK 540

Query: 539 HKKNPDVGEKKVIYYKDVLIDQEDADVVSEGEELTLMDWGNVIITKKNSDGSLVGKLHLE 598
           HKKNP VGEKKVIYYKD++ID+ DAD++ E EE+T+MDWGNVIITKKN+DGS+VGKLHL+
Sbjct: 541 HKKNPAVGEKKVIYYKDIVIDKADADLIEENEEVTMMDWGNVIITKKNADGSMVGKLHLD 600

Query: 599 GDFKKTKLKLTWLADTEDKVDVDLVDFDHLISKDKLEEGDNFEDFLTPETEFHTPAIADL 658
           GDFKKTK KLTWLADTED V VDLVDFDHLISKDKLEE ++FEDFLTP TEFHT AIADL
Sbjct: 601 GDFKKTKHKLTWLADTEDVVPVDLVDFDHLISKDKLEEDESFEDFLTPTTEFHTSAIADL 660

Query: 659 NVKDMKVGDVIQFERKGYYRLDSLAKDGKPYVFFTIPDGKAVNKYGAKK 707
           NVKDMKVGD+IQFERKGYYRLD++AKDGKPYVFFTIPDGK+VNKYGAKK
Sbjct: 661 NVKDMKVGDIIQFERKGYYRLDAVAKDGKPYVFFTIPDGKSVNKYGAKK 709

>KAFR0J02890 Chr10 complement(549654..551774) [2121 bp, 706 aa] {ON}
           Anc_3.569 YGL245W
          Length = 706

 Score = 1230 bits (3183), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 587/707 (83%), Positives = 637/707 (90%), Gaps = 1/707 (0%)

Query: 1   MSANLVINGKAPVVAYAELIAARIVNASKADAIKIEFVDDKKAAPATFNGEADSAFSKII 60
           MSA LVINGKAPVVAY  LIAAR+VNA++ DAIKIEFVDDKK+APATFNG ++ +F+KI+
Sbjct: 1   MSATLVINGKAPVVAYDSLIAARLVNAARPDAIKIEFVDDKKSAPATFNGSSEGSFNKIV 60

Query: 61  NAYQDVFSEGVQGSSEWSKLASEEFIIKNFQKLSGSLAKLDSRLNLRTYILDSFTATPAD 120
            A+ D F      +SEW  +ASEEFI+KNFQKL+ SL KLD+ LNLRT+I      + AD
Sbjct: 61  AAFPDAF-RNANVASEWINVASEEFIVKNFQKLAQSLEKLDAYLNLRTFISGGLEYSAAD 119

Query: 121 IACWGALRSNGMVGSIIKNKVYVNVSRWYTMLELDPLFSGAHEFLTKSLQELKKASNSNK 180
           IA WGALRSNGMVGSIIKNKVYVNVSRWY++LE+DPLF   HEFLTKSLQELKK +++ K
Sbjct: 120 IAAWGALRSNGMVGSIIKNKVYVNVSRWYSLLEMDPLFGTVHEFLTKSLQELKKNASAGK 179

Query: 181 KKETHKANFEIGLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFD 240
           KKETHKANFEI LPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFD
Sbjct: 180 KKETHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFD 239

Query: 241 DTNPSKEKVEFQDSILEDLDLLGIKGDKITYSSDYFEEMYQLCVQLIKEGKAYCDDTPTE 300
           DTNPSKEK EFQDSILEDL+LLGIKGD++TYSSDYF+EMY LCVQLIKEG AYCDDTPTE
Sbjct: 240 DTNPSKEKTEFQDSILEDLELLGIKGDRVTYSSDYFQEMYDLCVQLIKEGGAYCDDTPTE 299

Query: 301 KMREERMDGIASARRDRSVEENLRIFNEEMKNGTEEGLKNCVRAKIDYKALNKALRDPVI 360
           KMREERMDGIASARRDR+VEENLRIF EEMKNGTEEGLKNCVRAKIDY ALNK LRDPVI
Sbjct: 300 KMREERMDGIASARRDRTVEENLRIFTEEMKNGTEEGLKNCVRAKIDYAALNKTLRDPVI 359

Query: 361 FRCNLTPHHRTGTTWKMYPTYDFCVPIVDAIEGVTHALRTIEYRDRNPQYEWMLDALHLR 420
           +RCNLTPHHRTG TWKMYPTYDFCVPIVDA+EGVTHALRTIEYRDRN QYEWML+ALHLR
Sbjct: 360 YRCNLTPHHRTGATWKMYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNALHLR 419

Query: 421 KVHIWDFARVNFVRTLLSKRKLQWMVDKGCVSNWDDPRFPTXXXXXXXXMTVEGLRNFVL 480
           KVHIWDFARVNFVRTLLSKRKLQWMVDK  VSNWDDPRFPT        MTVEGLRNFVL
Sbjct: 420 KVHIWDFARVNFVRTLLSKRKLQWMVDKHLVSNWDDPRFPTVRGVRRRGMTVEGLRNFVL 479

Query: 481 SQGPSRNVINLEWNLIWAFNKKVIDPVAPRHTAVVKPVKLHLEGDDVPQNPKIEMKLKHK 540
           SQGPSRNVINLEWN+IWAFNKKVIDPVAPRHTAVV PVK+HL G+D P+ PKIEMK KHK
Sbjct: 480 SQGPSRNVINLEWNIIWAFNKKVIDPVAPRHTAVVNPVKIHLTGEDAPETPKIEMKPKHK 539

Query: 541 KNPDVGEKKVIYYKDVLIDQEDADVVSEGEELTLMDWGNVIITKKNSDGSLVGKLHLEGD 600
           KNP VGEKKVIYYKD+++D+EDADV+   EE+TLMDWGN+IITKKN+DGS+  K+HLEGD
Sbjct: 540 KNPAVGEKKVIYYKDIVVDKEDADVIEVNEEVTLMDWGNIIITKKNADGSMEAKVHLEGD 599

Query: 601 FKKTKLKLTWLADTEDKVDVDLVDFDHLISKDKLEEGDNFEDFLTPETEFHTPAIADLNV 660
           FKKT  KLTWLADTED V VDLVDFDHLISKDKLEE ++FEDFLTPETEFHT AIADLNV
Sbjct: 600 FKKTAHKLTWLADTEDVVPVDLVDFDHLISKDKLEEDESFEDFLTPETEFHTSAIADLNV 659

Query: 661 KDMKVGDVIQFERKGYYRLDSLAKDGKPYVFFTIPDGKAVNKYGAKK 707
           K+MKVGDVIQFERKGY+RLDSL KDGKPYVFFTIPDGK+VNKYGAKK
Sbjct: 660 KEMKVGDVIQFERKGYFRLDSLPKDGKPYVFFTIPDGKSVNKYGAKK 706

>Kpol_507.8 s507 (51597..53720) [2124 bp, 707 aa] {ON}
           (51597..53720) [2124 nt, 708 aa]
          Length = 707

 Score = 1220 bits (3156), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 583/707 (82%), Positives = 634/707 (89%)

Query: 1   MSANLVINGKAPVVAYAELIAARIVNASKADAIKIEFVDDKKAAPATFNGEADSAFSKII 60
           MSA LVI GKAPVVAYAELIAARIVN+SK D+IKIEFV+DKKA+PAT NG++    SKI+
Sbjct: 1   MSATLVIGGKAPVVAYAELIAARIVNSSKPDSIKIEFVEDKKASPATLNGDSVDVLSKIV 60

Query: 61  NAYQDVFSEGVQGSSEWSKLASEEFIIKNFQKLSGSLAKLDSRLNLRTYILDSFTATPAD 120
            A  DVF EG   S+EW K+ASEE ++KNFQ+L+ SL KLD+ LNLRTYI      T AD
Sbjct: 61  TANSDVFPEGAANSTEWIKIASEELVVKNFQQLNKSLEKLDAHLNLRTYINGGLNFTVAD 120

Query: 121 IACWGALRSNGMVGSIIKNKVYVNVSRWYTMLELDPLFSGAHEFLTKSLQELKKASNSNK 180
           IACWGALRSNGMVGSIIKNKV VNVSRWYT+LE + LF G HEFLTKSLQELKKAS + K
Sbjct: 121 IACWGALRSNGMVGSIIKNKVNVNVSRWYTLLEENTLFGGVHEFLTKSLQELKKASTAGK 180

Query: 181 KKETHKANFEIGLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFD 240
           KKETHKANFEI LPDAK+GEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFD
Sbjct: 181 KKETHKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFD 240

Query: 241 DTNPSKEKVEFQDSILEDLDLLGIKGDKITYSSDYFEEMYQLCVQLIKEGKAYCDDTPTE 300
           DTNPSKE VEFQDSILEDL+LLGIKGD+IT+SSDYF+EMY  CVQLIK+GKAYCDDTPTE
Sbjct: 241 DTNPSKENVEFQDSILEDLELLGIKGDRITHSSDYFQEMYDYCVQLIKDGKAYCDDTPTE 300

Query: 301 KMREERMDGIASARRDRSVEENLRIFNEEMKNGTEEGLKNCVRAKIDYKALNKALRDPVI 360
           KMR+ERM+GIAS RRDRSVEENL+IF EEMKNGTEEGLKNCVRAKIDY+ALNK LRDPVI
Sbjct: 301 KMRDERMNGIASVRRDRSVEENLKIFTEEMKNGTEEGLKNCVRAKIDYEALNKTLRDPVI 360

Query: 361 FRCNLTPHHRTGTTWKMYPTYDFCVPIVDAIEGVTHALRTIEYRDRNPQYEWMLDALHLR 420
           FRCNLTPHHRTG+ WKMYPTYDFCVPIVDA+EGVTHALRTIEYRDRN QYEWML+AL LR
Sbjct: 361 FRCNLTPHHRTGSQWKMYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNALKLR 420

Query: 421 KVHIWDFARVNFVRTLLSKRKLQWMVDKGCVSNWDDPRFPTXXXXXXXXMTVEGLRNFVL 480
           KVHIWDFARVNFVRTLLSKRKLQWMVDK  VSNW+DPRFPT        MTVEGLRNFVL
Sbjct: 421 KVHIWDFARVNFVRTLLSKRKLQWMVDKNLVSNWEDPRFPTVRGVRRRGMTVEGLRNFVL 480

Query: 481 SQGPSRNVINLEWNLIWAFNKKVIDPVAPRHTAVVKPVKLHLEGDDVPQNPKIEMKLKHK 540
           SQGPSRNVINLEWNLIW+FNKKVIDPV PR TAVV PVK+HLEG+D PQ+ K+EMK KH 
Sbjct: 481 SQGPSRNVINLEWNLIWSFNKKVIDPVCPRLTAVVDPVKIHLEGEDAPQSAKVEMKPKHP 540

Query: 541 KNPDVGEKKVIYYKDVLIDQEDADVVSEGEELTLMDWGNVIITKKNSDGSLVGKLHLEGD 600
           KNP VGEKKV++YKD++ID+EDAD + +GEE+TLM+WGN IITKKN+DGSL  KLHLEGD
Sbjct: 541 KNPVVGEKKVVFYKDIVIDREDADSIEDGEEITLMNWGNAIITKKNADGSLNAKLHLEGD 600

Query: 601 FKKTKLKLTWLADTEDKVDVDLVDFDHLISKDKLEEGDNFEDFLTPETEFHTPAIADLNV 660
           FKKTK K+TWLADTED V VDLVDFDHLISKDKLEE ++FEDFLTPETEFHT AIADLNV
Sbjct: 601 FKKTKHKVTWLADTEDVVKVDLVDFDHLISKDKLEEDESFEDFLTPETEFHTSAIADLNV 660

Query: 661 KDMKVGDVIQFERKGYYRLDSLAKDGKPYVFFTIPDGKAVNKYGAKK 707
           KDMKVGD+IQFERKGYYRLDSLA DGKPYVFFTIPDGK+VNKYGAKK
Sbjct: 661 KDMKVGDIIQFERKGYYRLDSLAADGKPYVFFTIPDGKSVNKYGAKK 707

>KLLA0A00682g Chr1 (67685..69811) [2127 bp, 708 aa] {ON} highly
           similar to uniprot|P46655 Saccharomyces cerevisiae
           YGL245W GUS1 Glutamyl-tRNA synthetase (GluRS) forms a
           complex with methionyl-tRNA synthetase (Mes1p) and Arc1p
           complex formation increases the catalytic efficiency of
           both tRNA synthetases and ensures their correct
           localization to the cytoplasm
          Length = 708

 Score = 1210 bits (3130), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 569/708 (80%), Positives = 635/708 (89%), Gaps = 1/708 (0%)

Query: 1   MSANLVINGKAPVVAYAELIAARIVNASKAD-AIKIEFVDDKKAAPATFNGEADSAFSKI 59
           MSA+L+I  KAPV+AY ELIAAR VNASK D  I+I FV+DKKAA A+FNGE +   +K+
Sbjct: 1   MSASLIIGAKAPVIAYPELIAARKVNASKGDNTIEISFVEDKKAAAASFNGETEDVLTKL 60

Query: 60  INAYQDVFSEGVQGSSEWSKLASEEFIIKNFQKLSGSLAKLDSRLNLRTYILDSFTATPA 119
             AY D+ ++    S+EW +  +++ +IKNFQ+L+ SLAKL++ LNLRTYIL++   + A
Sbjct: 61  SAAYPDILNDNSDSSAEWIEFGAKQLVIKNFQQLAESLAKLNAHLNLRTYILNTLEPSLA 120

Query: 120 DIACWGALRSNGMVGSIIKNKVYVNVSRWYTMLELDPLFSGAHEFLTKSLQELKKASNSN 179
           DIA WG LRSNGMVGSIIKNKVY+NVSRWY+  EL P F  AHEFLTKSLQELKKASN N
Sbjct: 121 DIAVWGYLRSNGMVGSIIKNKVYINVSRWYSTFELIPEFGQAHEFLTKSLQELKKASNVN 180

Query: 180 KKKETHKANFEIGLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRF 239
           KKKETHKANFEIGLPDAK+GEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRF
Sbjct: 181 KKKETHKANFEIGLPDAKVGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRF 240

Query: 240 DDTNPSKEKVEFQDSILEDLDLLGIKGDKITYSSDYFEEMYQLCVQLIKEGKAYCDDTPT 299
           DDTNPSKEK EFQDSILEDL+LLGIKGD+ITYSSDYF+EMY  CVQ+IKEGKAYCDDTPT
Sbjct: 241 DDTNPSKEKEEFQDSILEDLELLGIKGDRITYSSDYFQEMYDYCVQMIKEGKAYCDDTPT 300

Query: 300 EKMREERMDGIASARRDRSVEENLRIFNEEMKNGTEEGLKNCVRAKIDYKALNKALRDPV 359
           E+MREER +GI S+RR+R+VEENL+IF EEMKNGTEEGLKNCVRAKIDY+ALNKA+RDPV
Sbjct: 301 ERMREERTEGIPSSRRERTVEENLKIFTEEMKNGTEEGLKNCVRAKIDYEALNKAMRDPV 360

Query: 360 IFRCNLTPHHRTGTTWKMYPTYDFCVPIVDAIEGVTHALRTIEYRDRNPQYEWMLDALHL 419
           I+RCNLTPHHRTGT WK+YPTYDFCVPIVD++EGVTHALRTIEYRDRNPQY+WML+ALHL
Sbjct: 361 IYRCNLTPHHRTGTAWKIYPTYDFCVPIVDSLEGVTHALRTIEYRDRNPQYDWMLNALHL 420

Query: 420 RKVHIWDFARVNFVRTLLSKRKLQWMVDKGCVSNWDDPRFPTXXXXXXXXMTVEGLRNFV 479
           RKVHIWDFARVNFVRTLLSKRKLQW+VDK  VSNWDDPRFPT        MT+EGLRNFV
Sbjct: 421 RKVHIWDFARVNFVRTLLSKRKLQWLVDKDIVSNWDDPRFPTVRGVRRRGMTIEGLRNFV 480

Query: 480 LSQGPSRNVINLEWNLIWAFNKKVIDPVAPRHTAVVKPVKLHLEGDDVPQNPKIEMKLKH 539
           LSQGPSRNVINLEWNLIW+FNKKVIDPVAPRHTA+V PVK+HLEGDDVPQ P +EMKLKH
Sbjct: 481 LSQGPSRNVINLEWNLIWSFNKKVIDPVAPRHTAIVSPVKVHLEGDDVPQTPNVEMKLKH 540

Query: 540 KKNPDVGEKKVIYYKDVLIDQEDADVVSEGEELTLMDWGNVIITKKNSDGSLVGKLHLEG 599
           KKNP +GEKKVIYYKD++ID+EDA ++SEGEE+TLMDWGN IITKKN DGS   KLHLEG
Sbjct: 541 KKNPAIGEKKVIYYKDIVIDEEDAKLLSEGEEVTLMDWGNAIITKKNDDGSFNAKLHLEG 600

Query: 600 DFKKTKLKLTWLADTEDKVDVDLVDFDHLISKDKLEEGDNFEDFLTPETEFHTPAIADLN 659
           DFK TK KLTWLADT+DKV+ DLVDFDHLISKDKLEEG+NFEDFLTP+TEFHT A ADLN
Sbjct: 601 DFKTTKFKLTWLADTDDKVEADLVDFDHLISKDKLEEGENFEDFLTPKTEFHTTAYADLN 660

Query: 660 VKDMKVGDVIQFERKGYYRLDSLAKDGKPYVFFTIPDGKAVNKYGAKK 707
           VKDMKVGD+IQFERKGY+RLDSL KDGKPYVFFTIPDGK+VNKYGAKK
Sbjct: 661 VKDMKVGDIIQFERKGYFRLDSLPKDGKPYVFFTIPDGKSVNKYGAKK 708

>Kwal_47.19272 s47 complement(1165848..1167962) [2115 bp, 704 aa]
           {ON} YGL245W - Protein required for cell viability
           [contig 344] FULL
          Length = 704

 Score = 1192 bits (3085), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 562/705 (79%), Positives = 627/705 (88%), Gaps = 2/705 (0%)

Query: 3   ANLVINGKAPVVAYAELIAARIVNASKADAIKIEFVDDKKAAPATFNGEADSAFSKIINA 62
           A L +  KAPVVAY+ELIAAR+ NA K   I+I+FV+DKKA+PATF G ++     I+ +
Sbjct: 2   AKLTLASKAPVVAYSELIAARLTNAVKPGTIEIDFVEDKKASPATFEGNSNDVLKTIVES 61

Query: 63  YQDVFSEGVQGSSEWSKLASEEFIIKNFQKLSGSLAKLDSRLNLRTYILDSFTATPADIA 122
           + + F  G  G  +WS+ ASEE ++KNFQKLS SL KLD++LNLRT++L   + +PADIA
Sbjct: 62  FPEAFKGGFDGCEKWSQFASEELVVKNFQKLSVSLDKLDAQLNLRTFLLGGTSYSPADIA 121

Query: 123 CWGALRSNGMVGSIIKNKVYVNVSRWYTMLELDPLFSGAHEFLTKSLQELKKASNSNKKK 182
           CWG+LRSNGMVGSIIKN+VYVNVSRWYT+LE  P F  AHEFLTK++QELKKAS  NKKK
Sbjct: 122 CWGSLRSNGMVGSIIKNRVYVNVSRWYTLLEQVPEFGSAHEFLTKAVQELKKASTGNKKK 181

Query: 183 ETHKANFEIGLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDT 242
           ETHKANFEI LPDAKIGEVVTRFPPEPSGYLHIGHAKAA+LNQYFAQ YKGKLIIRFDDT
Sbjct: 182 ETHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAAILNQYFAQEYKGKLIIRFDDT 241

Query: 243 NPSKEKVEFQDSILEDLDLLGIKGDKITYSSDYFEEMYQLCVQLIKEGKAYCDDTPTEKM 302
           NPSKEK EFQDSILEDL+LLGIKGD++TYSSDYF+EMY+LCV++I+EGKAYCDDT TE+M
Sbjct: 242 NPSKEKEEFQDSILEDLELLGIKGDRVTYSSDYFQEMYELCVKMIEEGKAYCDDTATERM 301

Query: 303 REERMDGIASARRDRSVEENLRIFNEEMKNGTEEGLKNCVRAKIDYKALNKALRDPVIFR 362
           REERMDGIASARRDRSVEENLRIF  EMKNGTEEGLKNCVRAKIDY+A NK LRDPVI+R
Sbjct: 302 REERMDGIASARRDRSVEENLRIFTHEMKNGTEEGLKNCVRAKIDYEAPNKTLRDPVIYR 361

Query: 363 CNLTPHHRTGTTWKMYPTYDFCVPIVDAIEGVTHALRTIEYRDRNPQYEWMLDALHLRKV 422
           CNLTPHHRTG+TWK+YPTYDFCVPIVDA+EGVTHALRTIEYRDRN QY+WML+ALHLRKV
Sbjct: 362 CNLTPHHRTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYDWMLNALHLRKV 421

Query: 423 HIWDFARVNFVRTLLSKRKLQWMVDKGCVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQ 482
           HIWDFARVNFVRTLLSKRKLQWMVDK  VSNWDDPRFPT        MTVEGLRNFVLSQ
Sbjct: 422 HIWDFARVNFVRTLLSKRKLQWMVDKDLVSNWDDPRFPTVRGVRRRGMTVEGLRNFVLSQ 481

Query: 483 GPSRNVINLEWNLIWAFNKKVIDPVAPRHTAVVKPVKLHLEGDDVPQNPKIEMKLKHKKN 542
           GPSRNVINLEWNLIWAFNKKVIDPVAPRHTAVV PVK H++G   PQ P ++MKLKHKKN
Sbjct: 482 GPSRNVINLEWNLIWAFNKKVIDPVAPRHTAVVNPVKFHIDG--APQTPDVQMKLKHKKN 539

Query: 543 PDVGEKKVIYYKDVLIDQEDADVVSEGEELTLMDWGNVIITKKNSDGSLVGKLHLEGDFK 602
           P VGEKKVIYY DVLID++DA ++ EGEELTLMDWGNVI+TKKN+DGSL GKLHLEGDFK
Sbjct: 540 PAVGEKKVIYYTDVLIDEDDAKLIEEGEELTLMDWGNVIVTKKNADGSLTGKLHLEGDFK 599

Query: 603 KTKLKLTWLADTEDKVDVDLVDFDHLISKDKLEEGDNFEDFLTPETEFHTPAIADLNVKD 662
           KTKLK+TWLADT DKV+VDLVDFDHLISKDKLEEG++F DFLTP+TEFH PAIADLNVKD
Sbjct: 600 KTKLKVTWLADTSDKVNVDLVDFDHLISKDKLEEGEDFADFLTPKTEFHVPAIADLNVKD 659

Query: 663 MKVGDVIQFERKGYYRLDSLAKDGKPYVFFTIPDGKAVNKYGAKK 707
           MK GD+IQFERKGYYRLD++A   KPYVFF+IPDGK+VNKYGAKK
Sbjct: 660 MKKGDIIQFERKGYYRLDAVADGDKPYVFFSIPDGKSVNKYGAKK 704

>TDEL0D06370 Chr4 complement(1143917..1146037) [2121 bp, 706 aa]
           {ON} Anc_3.569 YGL245W
          Length = 706

 Score = 1190 bits (3078), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 573/706 (81%), Positives = 630/706 (89%), Gaps = 2/706 (0%)

Query: 3   ANLVINGKAPVVAYAELIAARIVNASKADAIKIEFVDDKKAAPATFNGEADSAFSKIINA 62
           A L+INGKAPVVAYAELIAAR+VN    ++I +EFVDDKKAAPA  +GE++  F KII A
Sbjct: 2   AKLIINGKAPVVAYAELIAARVVNTVNPESINVEFVDDKKAAPAVLDGESEGVFMKIIEA 61

Query: 63  YQDVFSEGVQGS-SEWSKLASEEFIIKNFQKLSGSLAKLDSRLNLRTYILDSFTATPADI 121
           +  +F+EG     + W K AS +++IKNFQKLSGSL KLD+ LNLRTYIL     + ADI
Sbjct: 62  FPKIFTEGTSEEIAAWVKTASSDYVIKNFQKLSGSLEKLDAVLNLRTYILGGLKYSAADI 121

Query: 122 ACWGALRSNGMVGSIIKNKVYVNVSRWYTMLELDPLFSGAHEFLTKSLQELKKASNSNKK 181
           ACWGALRSNGMVGSIIKNKV VNVSRWYT+LE D  F GAHEFLTKS+Q+LKKASN  KK
Sbjct: 122 ACWGALRSNGMVGSIIKNKVDVNVSRWYTLLETDLAFGGAHEFLTKSMQDLKKASNVGKK 181

Query: 182 KETHKANFEIGLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDD 241
           KE HKANFEI LPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFA+ YKGKLIIRFDD
Sbjct: 182 KEGHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAKEYKGKLIIRFDD 241

Query: 242 TNPSKEKVEFQDSILEDLDLLGIKGDKITYSSDYFEEMYQLCVQLIKEGKAYCDDTPTEK 301
           TNPSKEK EFQDSI+EDL LLGI+GD++T+SSDYF+EMY LCV++IKEGKAYCDDT TEK
Sbjct: 242 TNPSKEKEEFQDSIIEDLKLLGIEGDRLTFSSDYFQEMYDLCVKMIKEGKAYCDDTVTEK 301

Query: 302 MREERMDGIASARRDRSVEENLRIFNEEMKNGTEEGLKNCVRAKIDYKALNKALRDPVIF 361
           MREERMDGIASARRDR VEENLRIF +EMKNGTEEGLKNCVRAKIDY+A NK LRDPVI+
Sbjct: 302 MREERMDGIASARRDRPVEENLRIFTKEMKNGTEEGLKNCVRAKIDYQAANKTLRDPVIY 361

Query: 362 RCNLTPHHRTGTTWKMYPTYDFCVPIVDAIEGVTHALRTIEYRDRNPQYEWMLDALHLRK 421
           RCNLTPHHRTGTT K YPTYDFCVP+VDAIEGVTHALRTIEYRDRN QY+WML+A++LRK
Sbjct: 362 RCNLTPHHRTGTT-KTYPTYDFCVPVVDAIEGVTHALRTIEYRDRNAQYDWMLNAMNLRK 420

Query: 422 VHIWDFARVNFVRTLLSKRKLQWMVDKGCVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLS 481
           VHIWDFARVNFVRTLLSKRKLQWMVDK  VSNWDDPRFPT        MTVEGLRNFVLS
Sbjct: 421 VHIWDFARVNFVRTLLSKRKLQWMVDKNLVSNWDDPRFPTVRGVRRRGMTVEGLRNFVLS 480

Query: 482 QGPSRNVINLEWNLIWAFNKKVIDPVAPRHTAVVKPVKLHLEGDDVPQNPKIEMKLKHKK 541
           QGPSRNVINLEWNLIWAFNKKVIDPVAPR TAVV PVKLHL+G+D PQ+PK EMK KHKK
Sbjct: 481 QGPSRNVINLEWNLIWAFNKKVIDPVAPRLTAVVNPVKLHLDGEDAPQSPKTEMKPKHKK 540

Query: 542 NPDVGEKKVIYYKDVLIDQEDADVVSEGEELTLMDWGNVIITKKNSDGSLVGKLHLEGDF 601
           NPDVGEKKVI+YKDV+ID++DADV+ + EE+TLMDWGNVIITKKN+DGSL GKL+L+GDF
Sbjct: 541 NPDVGEKKVIFYKDVVIDKDDADVLEDNEEVTLMDWGNVIITKKNADGSLEGKLNLDGDF 600

Query: 602 KKTKLKLTWLADTEDKVDVDLVDFDHLISKDKLEEGDNFEDFLTPETEFHTPAIADLNVK 661
           KKTK KLTWLADTED   VDLVDFDHLISKDKLEE ++FEDFLTPETEFHT AIADLNVK
Sbjct: 601 KKTKHKLTWLADTEDVAPVDLVDFDHLISKDKLEEDESFEDFLTPETEFHTSAIADLNVK 660

Query: 662 DMKVGDVIQFERKGYYRLDSLAKDGKPYVFFTIPDGKAVNKYGAKK 707
           D+KVGD+IQFERKGYYRLD+LAKDGKPYVFFTIPDGK+VN+YGAKK
Sbjct: 661 DLKVGDIIQFERKGYYRLDALAKDGKPYVFFTIPDGKSVNRYGAKK 706

>KNAG0I00220 Chr9 (26235..28358) [2124 bp, 707 aa] {ON} Anc_3.569
           YGL245W
          Length = 707

 Score = 1182 bits (3059), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 563/707 (79%), Positives = 625/707 (88%), Gaps = 3/707 (0%)

Query: 2   SANLVINGKAPVVAYAELIAARIVNASKADAIKIEFVDDKKAAPATFNGEADSAFSKIIN 61
           +A LVINGKAP+VAY  LIAARI N++K+ ++ IEFVDDK AAPA FNG+++   SKI  
Sbjct: 3   AATLVINGKAPIVAYGPLIAARIANSAKSSSVAIEFVDDKNAAPAVFNGDSEDVLSKIAA 62

Query: 62  AYQDVFS-EGVQGSSEWSKLASEEFIIKNFQKLSGSLAKLDSRLNLRTYILDSFTATPAD 120
            + ++F+ E     + W K A++EF++KNF KL+ SLAKLD+ LNLRT++L     + AD
Sbjct: 63  QFPELFAQEEAADVATWVKTANDEFVVKNFAKLAESLAKLDAHLNLRTFVLGGLKYSVAD 122

Query: 121 IACWGALRSNGMVGSIIKNKVYVNVSRWYTMLELDPLFSGAHEFLTKSLQELKKASNSNK 180
           IACWGALRSNGMVGSIIKNKVYVNVSRWYT+ E+ P FS AHEFLTKS+QELKKAS + K
Sbjct: 123 IACWGALRSNGMVGSIIKNKVYVNVSRWYTLFEMFPQFSNAHEFLTKSMQELKKASTAGK 182

Query: 181 KKETHKANFEIGLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFD 240
           KKE+HKANFEI LPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFD
Sbjct: 183 KKESHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFD 242

Query: 241 DTNPSKEKVEFQDSILEDLDLLGIKGDKITYSSDYFEEMYQLCVQLIKEGKAYCDDTPTE 300
           DTNPSKEK EFQDSILEDL LLGIKGD++TYSSDYF++MY +C+QLIKEG AYCDDTPTE
Sbjct: 243 DTNPSKEKEEFQDSILEDLSLLGIKGDRVTYSSDYFQQMYDMCIQLIKEGGAYCDDTPTE 302

Query: 301 KMREERMDGIASARRDRSVEENLRIFNEEMKNGTEEGLKNCVRAKIDYKALNKALRDPVI 360
           KMREERMDGIASARRDRSVEENL+IF EEMKNGTEEGLKNCVRAKIDY A NK LRDPVI
Sbjct: 303 KMREERMDGIASARRDRSVEENLKIFTEEMKNGTEEGLKNCVRAKIDYAAPNKTLRDPVI 362

Query: 361 FRCNLTPHHRTGTTWKMYPTYDFCVPIVDAIEGVTHALRTIEYRDRNPQYEWMLDALHLR 420
           +RCNLTPHHRTG TWK+YPTYDFCVPIVD++EGVTHALRTIEYRDRN QY+WML+ALHLR
Sbjct: 363 YRCNLTPHHRTGDTWKVYPTYDFCVPIVDSVEGVTHALRTIEYRDRNVQYDWMLNALHLR 422

Query: 421 KVHIWDFARVNFVRTLLSKRKLQWMVDKGCVSNWDDPRFPTXXXXXXXXMTVEGLRNFVL 480
           KVHIWDFARVNFVRTLLSKRKLQWMVDKG V NWDDPRFPT        MTVEGLRNFVL
Sbjct: 423 KVHIWDFARVNFVRTLLSKRKLQWMVDKGLVENWDDPRFPTVRGVRRRGMTVEGLRNFVL 482

Query: 481 SQGPSRNVINLEWNLIWAFNKKVIDPVAPRHTAVVKPVKLHLEGDDVPQNPKIEMKLKHK 540
           SQGPSRNVINLEWNLIWAFNKKVIDPVAPRHTAVV PVKLH+EG   P+ PK EMK KHK
Sbjct: 483 SQGPSRNVINLEWNLIWAFNKKVIDPVAPRHTAVVDPVKLHIEG--APETPKTEMKPKHK 540

Query: 541 KNPDVGEKKVIYYKDVLIDQEDADVVSEGEELTLMDWGNVIITKKNSDGSLVGKLHLEGD 600
           KNP VGEKKVI+Y++V+ID+EDA  +   EE+TLMDWGNVIITK++ DGSL GKLHLEGD
Sbjct: 541 KNPAVGEKKVIFYQNVVIDKEDAASLETDEEVTLMDWGNVIITKRHPDGSLEGKLHLEGD 600

Query: 601 FKKTKLKLTWLADTEDKVDVDLVDFDHLISKDKLEEGDNFEDFLTPETEFHTPAIADLNV 660
           FKKTK KLTWLADTED V VDLVDFDHLI+KD+LEEG++FEDFLTP+TEF T AIADLNV
Sbjct: 601 FKKTKHKLTWLADTEDVVPVDLVDFDHLINKDRLEEGESFEDFLTPQTEFETKAIADLNV 660

Query: 661 KDMKVGDVIQFERKGYYRLDSLAKDGKPYVFFTIPDGKAVNKYGAKK 707
           K MKVGD+IQFERKGYYRLDSL KDGKPY+FFTIPDGK+VN+YGAKK
Sbjct: 661 KHMKVGDIIQFERKGYYRLDSLPKDGKPYIFFTIPDGKSVNRYGAKK 707

>Suva_7.16 Chr7 (33556..35682) [2127 bp, 708 aa] {ON} YGL245W (REAL)
          Length = 708

 Score = 1181 bits (3056), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 561/708 (79%), Positives = 623/708 (87%), Gaps = 1/708 (0%)

Query: 1   MSANLVINGKAPVVAYAELIAARIVNASKADAIKIEFVDDKKAAPATFNGEADSAFSKII 60
           M + L INGKAP VAYAELIAARIVNA   ++I +EFVDDKKA  A  +   +  F+KI 
Sbjct: 1   MPSTLTINGKAPAVAYAELIAARIVNALAPNSIAVEFVDDKKAPAAKLDDATEDVFNKIT 60

Query: 61  NAYQDVFSEGVQGS-SEWSKLASEEFIIKNFQKLSGSLAKLDSRLNLRTYILDSFTATPA 119
             +  +F  G +   ++W KLA EE ++KNF KLS SL  LD++LNLRT+IL     + A
Sbjct: 61  GKFAAIFDNGKKEEVAKWVKLAQEELVVKNFGKLSQSLETLDTQLNLRTFILGGLKYSAA 120

Query: 120 DIACWGALRSNGMVGSIIKNKVYVNVSRWYTMLELDPLFSGAHEFLTKSLQELKKASNSN 179
           D+ACWGALRSNGM GSIIKNKV VNVSRWYT+LE+DP+F  AHEFLTKSLQE+KK +N  
Sbjct: 121 DVACWGALRSNGMCGSIIKNKVDVNVSRWYTLLEMDPIFGEAHEFLTKSLQEVKKNANVG 180

Query: 180 KKKETHKANFEIGLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRF 239
           KKKETHKANFEI LPDAK+G+VVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGK+IIRF
Sbjct: 181 KKKETHKANFEIDLPDAKVGQVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKMIIRF 240

Query: 240 DDTNPSKEKVEFQDSILEDLDLLGIKGDKITYSSDYFEEMYQLCVQLIKEGKAYCDDTPT 299
           DDTNPSKEK EFQDSILEDL+LLGIKGD+ITYSSDYF+EMY  CVQ+IK+GKAYCDDTPT
Sbjct: 241 DDTNPSKEKEEFQDSILEDLELLGIKGDRITYSSDYFQEMYDYCVQMIKDGKAYCDDTPT 300

Query: 300 EKMREERMDGIASARRDRSVEENLRIFNEEMKNGTEEGLKNCVRAKIDYKALNKALRDPV 359
           EKMREERMDGIASARRDRSVEENLRIF EEMKNGTE GLKNCVRAKIDY+ALNK LRDPV
Sbjct: 301 EKMREERMDGIASARRDRSVEENLRIFTEEMKNGTEVGLKNCVRAKIDYEALNKTLRDPV 360

Query: 360 IFRCNLTPHHRTGTTWKMYPTYDFCVPIVDAIEGVTHALRTIEYRDRNPQYEWMLDALHL 419
           I+RCNLTPHHRTG+TWK+YPTYDFCVPIVDA+EGVTHALRTIEYRDRN QY+WML AL L
Sbjct: 361 IYRCNLTPHHRTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYDWMLQALRL 420

Query: 420 RKVHIWDFARVNFVRTLLSKRKLQWMVDKGCVSNWDDPRFPTXXXXXXXXMTVEGLRNFV 479
           RKVHIWDFAR+NFVRTLLSKRKLQWMVDK  V NWDDPRFPT        MTVEGLRNFV
Sbjct: 421 RKVHIWDFARINFVRTLLSKRKLQWMVDKELVGNWDDPRFPTVRGVRRRGMTVEGLRNFV 480

Query: 480 LSQGPSRNVINLEWNLIWAFNKKVIDPVAPRHTAVVKPVKLHLEGDDVPQNPKIEMKLKH 539
           LSQGPSRNVINLEWNLIWAFNKKVIDP+APRHTAVV PVK+HLEG + PQ PKIEMK KH
Sbjct: 481 LSQGPSRNVINLEWNLIWAFNKKVIDPIAPRHTAVVNPVKIHLEGAEAPQEPKIEMKPKH 540

Query: 540 KKNPDVGEKKVIYYKDVLIDQEDADVVSEGEELTLMDWGNVIITKKNSDGSLVGKLHLEG 599
           KKNP VGEKKVIYYKD+++D++DADV+   EE+TLMDWGNV+ITKKN+DGS+V KLHLEG
Sbjct: 541 KKNPAVGEKKVIYYKDIVVDKDDADVIDVDEEVTLMDWGNVVITKKNADGSMVAKLHLEG 600

Query: 600 DFKKTKLKLTWLADTEDKVDVDLVDFDHLISKDKLEEGDNFEDFLTPETEFHTPAIADLN 659
           DFKKTK KLTWLADT+D V VDLVDFDHL++KDKLEE ++FEDFLTPETEFHT AIADLN
Sbjct: 601 DFKKTKHKLTWLADTKDIVPVDLVDFDHLLTKDKLEEDESFEDFLTPETEFHTDAIADLN 660

Query: 660 VKDMKVGDVIQFERKGYYRLDSLAKDGKPYVFFTIPDGKAVNKYGAKK 707
           VKDMKVGD++QFERKGY+RLD+L KDGKPYVFFTIPDGK+VNKYGAKK
Sbjct: 661 VKDMKVGDIVQFERKGYFRLDALPKDGKPYVFFTIPDGKSVNKYGAKK 708

>YGL245W Chr7 (39023..41149) [2127 bp, 708 aa] {ON}
           GUS1Glutamyl-tRNA synthetase (GluRS), forms a complex
           with methionyl-tRNA synthetase (Mes1p) and Arc1p;
           complex formation increases the catalytic efficiency of
           both tRNA synthetases and ensures their correct
           localization to the cytoplasm
          Length = 708

 Score = 1181 bits (3054), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 562/708 (79%), Positives = 624/708 (88%), Gaps = 1/708 (0%)

Query: 1   MSANLVINGKAPVVAYAELIAARIVNASKADAIKIEFVDDKKAAPATFNGEADSAFSKII 60
           M + L INGKAP+VAYAELIAARIVNA   ++I I+ VDDKKA  A  +   +  F+KI 
Sbjct: 1   MPSTLTINGKAPIVAYAELIAARIVNALAPNSIAIKLVDDKKAPAAKLDDATEDVFNKIT 60

Query: 61  NAYQDVFSEG-VQGSSEWSKLASEEFIIKNFQKLSGSLAKLDSRLNLRTYILDSFTATPA 119
           + +  +F  G  +  ++W  LA +E +IKNF KLS SL  LDS+LNLRT+IL     + A
Sbjct: 61  SKFAAIFDNGDKEQVAKWVNLAQKELVIKNFAKLSQSLETLDSQLNLRTFILGGLKYSAA 120

Query: 120 DIACWGALRSNGMVGSIIKNKVYVNVSRWYTMLELDPLFSGAHEFLTKSLQELKKASNSN 179
           D+ACWGALRSNGM GSIIKNKV VNVSRWYT+LE+DP+F  AH+FL+KSL ELKK++N  
Sbjct: 121 DVACWGALRSNGMCGSIIKNKVDVNVSRWYTLLEMDPIFGEAHDFLSKSLLELKKSANVG 180

Query: 180 KKKETHKANFEIGLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRF 239
           KKKETHKANFEI LPDAK+GEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRF
Sbjct: 181 KKKETHKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRF 240

Query: 240 DDTNPSKEKVEFQDSILEDLDLLGIKGDKITYSSDYFEEMYQLCVQLIKEGKAYCDDTPT 299
           DDTNPSKEK EFQDSILEDLDLLGIKGD+ITYSSDYF+EMY  CVQ+IK+GKAYCDDTPT
Sbjct: 241 DDTNPSKEKEEFQDSILEDLDLLGIKGDRITYSSDYFQEMYDYCVQMIKDGKAYCDDTPT 300

Query: 300 EKMREERMDGIASARRDRSVEENLRIFNEEMKNGTEEGLKNCVRAKIDYKALNKALRDPV 359
           EKMREERMDG+ASARRDRSVEENLRIF EEMKNGTEEGLKNCVRAKIDYKALNK LRDPV
Sbjct: 301 EKMREERMDGVASARRDRSVEENLRIFTEEMKNGTEEGLKNCVRAKIDYKALNKTLRDPV 360

Query: 360 IFRCNLTPHHRTGTTWKMYPTYDFCVPIVDAIEGVTHALRTIEYRDRNPQYEWMLDALHL 419
           I+RCNLTPHHRTG+TWK+YPTYDFCVPIVDAIEGVTHALRTIEYRDRN QY+WML AL L
Sbjct: 361 IYRCNLTPHHRTGSTWKIYPTYDFCVPIVDAIEGVTHALRTIEYRDRNAQYDWMLQALRL 420

Query: 420 RKVHIWDFARVNFVRTLLSKRKLQWMVDKGCVSNWDDPRFPTXXXXXXXXMTVEGLRNFV 479
           RKVHIWDFAR+NFVRTLLSKRKLQWMVDK  V NWDDPRFPT        MTVEGLRNFV
Sbjct: 421 RKVHIWDFARINFVRTLLSKRKLQWMVDKDLVGNWDDPRFPTVRGVRRRGMTVEGLRNFV 480

Query: 480 LSQGPSRNVINLEWNLIWAFNKKVIDPVAPRHTAVVKPVKLHLEGDDVPQNPKIEMKLKH 539
           LSQGPSRNVINLEWNLIWAFNKKVIDP+APRHTA+V PVK+HLEG + PQ PKIEMK KH
Sbjct: 481 LSQGPSRNVINLEWNLIWAFNKKVIDPIAPRHTAIVNPVKIHLEGSEAPQEPKIEMKPKH 540

Query: 540 KKNPDVGEKKVIYYKDVLIDQEDADVVSEGEELTLMDWGNVIITKKNSDGSLVGKLHLEG 599
           KKNP VGEKKVIYYKD+++D++DADV++  EE+TLMDWGNVIITKKN DGS+V KL+LEG
Sbjct: 541 KKNPAVGEKKVIYYKDIVVDKDDADVINVDEEVTLMDWGNVIITKKNDDGSMVAKLNLEG 600

Query: 600 DFKKTKLKLTWLADTEDKVDVDLVDFDHLISKDKLEEGDNFEDFLTPETEFHTPAIADLN 659
           DFKKTK KLTWLADT+D V VDLVDFDHLI+KD+LEE ++FEDFLTP+TEFHT AIADLN
Sbjct: 601 DFKKTKHKLTWLADTKDVVPVDLVDFDHLITKDRLEEDESFEDFLTPQTEFHTDAIADLN 660

Query: 660 VKDMKVGDVIQFERKGYYRLDSLAKDGKPYVFFTIPDGKAVNKYGAKK 707
           VKDMK+GD+IQFERKGYYRLD+L KDGKPYVFFTIPDGK+VNKYGAKK
Sbjct: 661 VKDMKIGDIIQFERKGYYRLDALPKDGKPYVFFTIPDGKSVNKYGAKK 708

>KLTH0G00682g Chr7 (45680..47794) [2115 bp, 704 aa] {ON} highly
           similar to uniprot|P46655 Saccharomyces cerevisiae
           YGL245W GUS1 Glutamyl-tRNA synthetase (GluRS) forms a
           complex with methionyl-tRNA synthetase (Mes1p) and Arc1p
           complex formation increases the catalytic efficiency of
           both tRNA synthetases and ensures their correct
           localization to the cytoplasm
          Length = 704

 Score = 1180 bits (3053), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 571/705 (80%), Positives = 628/705 (89%), Gaps = 2/705 (0%)

Query: 3   ANLVINGKAPVVAYAELIAARIVNASKADAIKIEFVDDKKAAPATFNGEADSAFSKIINA 62
           A L+I  KAPVVAY+ELIAAR+VN++K DAI+IEFV+DKK++PATF    D    +I+  
Sbjct: 2   AKLIIASKAPVVAYSELIAARLVNSAKTDAIEIEFVEDKKSSPATFEDSCDDVLKRIVQT 61

Query: 63  YQDVFSEGVQGSSEWSKLASEEFIIKNFQKLSGSLAKLDSRLNLRTYILDSFTATPADIA 122
           Y +VF  G +   EW+KLASEE  +KNFQKLS SLAKLD+ LN RT+IL   T + ADIA
Sbjct: 62  YPEVFKHGFENCDEWAKLASEELTVKNFQKLSVSLAKLDACLNFRTFILGGTTFSAADIA 121

Query: 123 CWGALRSNGMVGSIIKNKVYVNVSRWYTMLELDPLFSGAHEFLTKSLQELKKASNSNKKK 182
           CWG+LRSNGMVGSIIKNKVYVNVSRWYT+LE  P F  AHEFL K+LQELKKAS SNKKK
Sbjct: 122 CWGSLRSNGMVGSIIKNKVYVNVSRWYTLLEQIPEFGSAHEFLVKTLQELKKASTSNKKK 181

Query: 183 ETHKANFEIGLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDT 242
           ETHKANFEI L DAK+GEVVTRFPPEPSGYLHIGHAKAA+LNQYFAQ YKGKLIIRFDDT
Sbjct: 182 ETHKANFEIDLQDAKVGEVVTRFPPEPSGYLHIGHAKAAILNQYFAQEYKGKLIIRFDDT 241

Query: 243 NPSKEKVEFQDSILEDLDLLGIKGDKITYSSDYFEEMYQLCVQLIKEGKAYCDDTPTEKM 302
           NPSKEK EFQDSILEDL+LLGIKGD++TYSSDYF+EMY LCV++I+EG AYCDDTPT+KM
Sbjct: 242 NPSKEKEEFQDSILEDLELLGIKGDRVTYSSDYFQEMYDLCVKMIEEGNAYCDDTPTDKM 301

Query: 303 REERMDGIASARRDRSVEENLRIFNEEMKNGTEEGLKNCVRAKIDYKALNKALRDPVIFR 362
           REERMDG+ASARRDRSVEENLRIF +EMKNGTEEGLKNCVRAKIDYKALNK LRDPVI+R
Sbjct: 302 REERMDGLASARRDRSVEENLRIFTQEMKNGTEEGLKNCVRAKIDYKALNKTLRDPVIYR 361

Query: 363 CNLTPHHRTGTTWKMYPTYDFCVPIVDAIEGVTHALRTIEYRDRNPQYEWMLDALHLRKV 422
           CNLTPHHRTG+TWK+YPTYDFCVPIVDA+EGVTHALRTIEYRDRN QY+WMLDALHLRKV
Sbjct: 362 CNLTPHHRTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYQWMLDALHLRKV 421

Query: 423 HIWDFARVNFVRTLLSKRKLQWMVDKGCVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQ 482
           HIWDFARVNFVRTLLSKRKLQWMVDK  VSNWDDPRFPT        MTVEGLRNFVLSQ
Sbjct: 422 HIWDFARVNFVRTLLSKRKLQWMVDKDLVSNWDDPRFPTVRGVRRRGMTVEGLRNFVLSQ 481

Query: 483 GPSRNVINLEWNLIWAFNKKVIDPVAPRHTAVVKPVKLHLEGDDVPQNPKIEMKLKHKKN 542
           GPSRNVINLEWNLIWAFNKKVIDPVAPRHTA+VKPVK H+EG   PQ P +++KLKHKKN
Sbjct: 482 GPSRNVINLEWNLIWAFNKKVIDPVAPRHTAIVKPVKFHVEG--APQTPDVQIKLKHKKN 539

Query: 543 PDVGEKKVIYYKDVLIDQEDADVVSEGEELTLMDWGNVIITKKNSDGSLVGKLHLEGDFK 602
           P VGEKKVIYY D+LIDQ+DAD V+EGEELTLMDWGN I+TKKN+DGSL GKLHLEGDFK
Sbjct: 540 PAVGEKKVIYYADILIDQDDADAVTEGEELTLMDWGNAIVTKKNADGSLTGKLHLEGDFK 599

Query: 603 KTKLKLTWLADTEDKVDVDLVDFDHLISKDKLEEGDNFEDFLTPETEFHTPAIADLNVKD 662
           KTKLKLTWLADT+DKVDVDLVDFDHLI+KDKLEEG++F D+LTP+TEFH  A+ADLNVKD
Sbjct: 600 KTKLKLTWLADTDDKVDVDLVDFDHLITKDKLEEGEDFADYLTPQTEFHVSAVADLNVKD 659

Query: 663 MKVGDVIQFERKGYYRLDSLAKDGKPYVFFTIPDGKAVNKYGAKK 707
           MK GD+IQFERKGYYRLDS A   KPYVFF IPDGK+VNKYGAKK
Sbjct: 660 MKKGDIIQFERKGYYRLDSFATADKPYVFFAIPDGKSVNKYGAKK 704

>Skud_7.22 Chr7 (43191..45317) [2127 bp, 708 aa] {ON} YGL245W (REAL)
          Length = 708

 Score = 1178 bits (3048), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 558/708 (78%), Positives = 624/708 (88%), Gaps = 1/708 (0%)

Query: 1   MSANLVINGKAPVVAYAELIAARIVNASKADAIKIEFVDDKKAAPATFNGEADSAFSKII 60
           M + L +NGKAP VAYAELIAARIVNA   ++I I+FVDDKKA  A  +   +  F+KI 
Sbjct: 1   MPSTLTVNGKAPSVAYAELIAARIVNALAPNSIAIQFVDDKKAPAAKLDDATEGVFNKIT 60

Query: 61  NAYQDVFSEG-VQGSSEWSKLASEEFIIKNFQKLSGSLAKLDSRLNLRTYILDSFTATPA 119
             +  +F  G  +  S W+ LA +E ++KNF KLS SL  LDS+LN+RT+IL     + A
Sbjct: 61  GKFAAIFDNGDKEQVSRWTDLAEKELVVKNFAKLSQSLETLDSQLNVRTFILGGLKYSAA 120

Query: 120 DIACWGALRSNGMVGSIIKNKVYVNVSRWYTMLELDPLFSGAHEFLTKSLQELKKASNSN 179
           D+ACWGALRSNGM GSIIKNKV VNVSRWYT+LE+DP+F  AH+FLTKSLQELKK++N  
Sbjct: 121 DVACWGALRSNGMCGSIIKNKVDVNVSRWYTLLEMDPIFGEAHDFLTKSLQELKKSANVG 180

Query: 180 KKKETHKANFEIGLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRF 239
           KKKETHKANFEI LPDAK+G+VVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRF
Sbjct: 181 KKKETHKANFEIDLPDAKVGQVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRF 240

Query: 240 DDTNPSKEKVEFQDSILEDLDLLGIKGDKITYSSDYFEEMYQLCVQLIKEGKAYCDDTPT 299
           DDTNPSKEK EFQDSILEDLDLLGIKGDKITYSSDYF+EM+  CVQ+IK+GKAYCDDTPT
Sbjct: 241 DDTNPSKEKEEFQDSILEDLDLLGIKGDKITYSSDYFQEMFDYCVQMIKDGKAYCDDTPT 300

Query: 300 EKMREERMDGIASARRDRSVEENLRIFNEEMKNGTEEGLKNCVRAKIDYKALNKALRDPV 359
           E+MREERMDGIASARR+RSVEENLR+F EEMKNGTEEGLKNCVRAKIDY+ALNK LRDPV
Sbjct: 301 ERMREERMDGIASARRNRSVEENLRLFTEEMKNGTEEGLKNCVRAKIDYEALNKTLRDPV 360

Query: 360 IFRCNLTPHHRTGTTWKMYPTYDFCVPIVDAIEGVTHALRTIEYRDRNPQYEWMLDALHL 419
           I+RCNLTPHHRTG+TWK+YPTYDFCVPIVDAIEGVTHALRTIEYRDRN QY+WML AL L
Sbjct: 361 IYRCNLTPHHRTGSTWKIYPTYDFCVPIVDAIEGVTHALRTIEYRDRNIQYDWMLQALRL 420

Query: 420 RKVHIWDFARVNFVRTLLSKRKLQWMVDKGCVSNWDDPRFPTXXXXXXXXMTVEGLRNFV 479
           RKVHIWDFAR+NFVRTLLSKRKLQWMVDK  V NWDDPRFPT        MTVEGLRNFV
Sbjct: 421 RKVHIWDFARINFVRTLLSKRKLQWMVDKDLVGNWDDPRFPTVRGVRRRGMTVEGLRNFV 480

Query: 480 LSQGPSRNVINLEWNLIWAFNKKVIDPVAPRHTAVVKPVKLHLEGDDVPQNPKIEMKLKH 539
           LSQGPSRNVINLEWNLIWAFNKKVIDP+APRHTA+V PVK+HLEG + PQ PK+EMK KH
Sbjct: 481 LSQGPSRNVINLEWNLIWAFNKKVIDPIAPRHTAIVNPVKIHLEGTEAPQEPKVEMKPKH 540

Query: 540 KKNPDVGEKKVIYYKDVLIDQEDADVVSEGEELTLMDWGNVIITKKNSDGSLVGKLHLEG 599
           KKNP VGEKK+IYYKD+++D+EDADV++  EE+TLMDWGNVIITKKN DGS+V KLHLEG
Sbjct: 541 KKNPAVGEKKLIYYKDIVVDREDADVINVDEEVTLMDWGNVIITKKNDDGSMVAKLHLEG 600

Query: 600 DFKKTKLKLTWLADTEDKVDVDLVDFDHLISKDKLEEGDNFEDFLTPETEFHTPAIADLN 659
           DFKKTK KLTWLADT+D V VDLVDFDHLI+KD+LEE ++FEDFLTP+TEFHT AIADLN
Sbjct: 601 DFKKTKHKLTWLADTKDVVPVDLVDFDHLITKDRLEEDESFEDFLTPQTEFHTDAIADLN 660

Query: 660 VKDMKVGDVIQFERKGYYRLDSLAKDGKPYVFFTIPDGKAVNKYGAKK 707
           VKDMKVGD+IQFERKGYYRLD+L K+GKPYVFFTIPDGK+VN+YGAKK
Sbjct: 661 VKDMKVGDIIQFERKGYYRLDALPKNGKPYVFFTIPDGKSVNRYGAKK 708

>Smik_7.16 Chr7 (33804..35930) [2127 bp, 708 aa] {ON} YGL245W (REAL)
          Length = 708

 Score = 1178 bits (3048), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 559/708 (78%), Positives = 622/708 (87%), Gaps = 1/708 (0%)

Query: 1   MSANLVINGKAPVVAYAELIAARIVNASKADAIKIEFVDDKKAAPATFNGEADSAFSKII 60
           M + L INGKAP+VAYAELIAARIVNA   ++I I FVDDKKA  A  +   +  FSKI 
Sbjct: 1   MPSTLTINGKAPIVAYAELIAARIVNALAPNSIAIVFVDDKKAPAAILDDATEDVFSKIT 60

Query: 61  NAYQDVFSEGVQGS-SEWSKLASEEFIIKNFQKLSGSLAKLDSRLNLRTYILDSFTATPA 119
             +  +F  G +   ++W  LA +E ++KNF KLS SL  LDS+LNLRT+IL     + A
Sbjct: 61  GKFAAIFDNGDKEQLAKWVDLAQKELVVKNFAKLSQSLEALDSQLNLRTFILGGLKYSAA 120

Query: 120 DIACWGALRSNGMVGSIIKNKVYVNVSRWYTMLELDPLFSGAHEFLTKSLQELKKASNSN 179
           D+ACWGALRSNGM GSIIKNKV VNVSRWYT+LE+DP+F  AH+FL+KSLQELKK++N  
Sbjct: 121 DVACWGALRSNGMCGSIIKNKVDVNVSRWYTLLEMDPIFGEAHDFLSKSLQELKKSANVG 180

Query: 180 KKKETHKANFEIGLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRF 239
           KKKETHKANFEI LP+AKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRF
Sbjct: 181 KKKETHKANFEIDLPEAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRF 240

Query: 240 DDTNPSKEKVEFQDSILEDLDLLGIKGDKITYSSDYFEEMYQLCVQLIKEGKAYCDDTPT 299
           DDTNPSKEK EFQDSILEDLDLLGIKGDKITYSSDYF+EMY  C+Q+IK+GKAYCDDTPT
Sbjct: 241 DDTNPSKEKEEFQDSILEDLDLLGIKGDKITYSSDYFQEMYDYCIQMIKDGKAYCDDTPT 300

Query: 300 EKMREERMDGIASARRDRSVEENLRIFNEEMKNGTEEGLKNCVRAKIDYKALNKALRDPV 359
           EKMREERMDGIAS+RRDRSVEENLRIF EEMKNGTEEGLKNCVRAKIDYKALNK LRDPV
Sbjct: 301 EKMREERMDGIASSRRDRSVEENLRIFTEEMKNGTEEGLKNCVRAKIDYKALNKTLRDPV 360

Query: 360 IFRCNLTPHHRTGTTWKMYPTYDFCVPIVDAIEGVTHALRTIEYRDRNPQYEWMLDALHL 419
           I+RCNLTPHHRTG+TWK+YPTYDFCVPIVDA+EGVTHALRTIEYRDRN QY+WML AL L
Sbjct: 361 IYRCNLTPHHRTGSTWKIYPTYDFCVPIVDAVEGVTHALRTIEYRDRNAQYDWMLQALRL 420

Query: 420 RKVHIWDFARVNFVRTLLSKRKLQWMVDKGCVSNWDDPRFPTXXXXXXXXMTVEGLRNFV 479
           RKVHIWDFAR+NFVRTLLSKRKLQWMVDK  V NWDDPRFPT        MTVEGLRNFV
Sbjct: 421 RKVHIWDFARINFVRTLLSKRKLQWMVDKDLVGNWDDPRFPTVRGVRRRGMTVEGLRNFV 480

Query: 480 LSQGPSRNVINLEWNLIWAFNKKVIDPVAPRHTAVVKPVKLHLEGDDVPQNPKIEMKLKH 539
           LSQGPSRNVINLEWNLIWAFNKK+IDP+APRHTA+V PVK+HLEG + PQ PK E K KH
Sbjct: 481 LSQGPSRNVINLEWNLIWAFNKKIIDPIAPRHTAIVNPVKIHLEGSEAPQEPKTETKPKH 540

Query: 540 KKNPDVGEKKVIYYKDVLIDQEDADVVSEGEELTLMDWGNVIITKKNSDGSLVGKLHLEG 599
           KKNP VGEKKVIYYKD+++D++DADV++  EE+TLMDWGNVIITKKN DGS++ KL+LEG
Sbjct: 541 KKNPAVGEKKVIYYKDIVVDKDDADVINVDEEITLMDWGNVIITKKNEDGSMIAKLNLEG 600

Query: 600 DFKKTKLKLTWLADTEDKVDVDLVDFDHLISKDKLEEGDNFEDFLTPETEFHTPAIADLN 659
           DFKKTK KLTWLADT+D V VDLVDFDHLI+KD+LEE ++FEDFLTP+TEFHT AIADLN
Sbjct: 601 DFKKTKHKLTWLADTKDVVPVDLVDFDHLITKDRLEEDESFEDFLTPQTEFHTDAIADLN 660

Query: 660 VKDMKVGDVIQFERKGYYRLDSLAKDGKPYVFFTIPDGKAVNKYGAKK 707
           VKDMK+GD+IQFERKGYYRLD+L KDGKPYVFFTIPDGK+VNKYGAKK
Sbjct: 661 VKDMKIGDIIQFERKGYYRLDALPKDGKPYVFFTIPDGKSVNKYGAKK 708

>CAGL0C01947g Chr3 (204411..206528) [2118 bp, 705 aa] {ON} highly
           similar to uniprot|P46655 Saccharomyces cerevisiae
           YGL245w
          Length = 705

 Score = 1176 bits (3041), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 571/708 (80%), Positives = 632/708 (89%), Gaps = 4/708 (0%)

Query: 1   MSANLVINGKAPVVAYAELIAARIVNASKADA-IKIEFVDDKKAAPATFNGEADSAFSKI 59
           MS+ LVINGKAPVVAYAELIAAR+VN SK+DA + +EFVDDKK+A ATF+G++D+A   I
Sbjct: 1   MSSTLVINGKAPVVAYAELIAARLVNDSKSDASVTVEFVDDKKSAAATFDGKSDNALEAI 60

Query: 60  INAYQDVFSEGVQGSSEWSKLASEEFIIKNFQKLSGSLAKLDSRLNLRTYILDSFTATPA 119
           +  + ++     + S  W KLA+EE +IKNFQKL+ SL KLD++LN RTYI        A
Sbjct: 61  VAKFPEILGAN-EESKPWIKLAAEELVIKNFQKLAQSLEKLDAQLNFRTYINGGLKFDSA 119

Query: 120 DIACWGALRSNGMVGSIIKNKVYVNVSRWYTMLELDPLFSGAHEFLTKSLQELKKASNSN 179
           DIACWGALRSNGMVGSIIKNKVYVNVSRWY +LE +P F  +HEFLTKSLQELKKA+N+ 
Sbjct: 120 DIACWGALRSNGMVGSIIKNKVYVNVSRWYLLLESNPSFGQSHEFLTKSLQELKKAANAG 179

Query: 180 KKKETHKANFEIGLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRF 239
           KKKE+HKANFEI LPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRF
Sbjct: 180 KKKESHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRF 239

Query: 240 DDTNPSKEKVEFQDSILEDLDLLGIKGDKITYSSDYFEEMYQLCVQLIKEGKAYCDDTPT 299
           DDTNPSKEK EFQDSILEDL+LLGIKGD+ITYSSDYF+EMY+LCV+LIKEGKAYCDDTPT
Sbjct: 240 DDTNPSKEKTEFQDSILEDLELLGIKGDRITYSSDYFQEMYELCVKLIKEGKAYCDDTPT 299

Query: 300 EKMREERMDGIASARRDRSVEENLRIFNEEMKNGTEEGLKNCVRAKIDYKALNKALRDPV 359
           EKMREERMDGIASARR+RSVEENL+IF E+MKNGTEEGLKNCVRAKIDY ALNK LRDPV
Sbjct: 300 EKMREERMDGIASARRERSVEENLKIFTEDMKNGTEEGLKNCVRAKIDYAALNKTLRDPV 359

Query: 360 IFRCNLTPHHRTGTTWKMYPTYDFCVPIVDAIEGVTHALRTIEYRDRNPQYEWMLDALHL 419
           I+RCNLTPHHRTG+ WKMYPTYDFCVPIVD+IEGVTHALRTIEYRDRN QY+W LD L+L
Sbjct: 360 IYRCNLTPHHRTGSEWKMYPTYDFCVPIVDSIEGVTHALRTIEYRDRNAQYDWFLDNLNL 419

Query: 420 RKVHIWDFARVNFVRTLLSKRKLQWMVDKGCVSNWDDPRFPTXXXXXXXXMTVEGLRNFV 479
           RKVHIWDFARVNFVRTLLSKRKLQWMVDK  VSNWDDPRFPT        MTVEGLRNFV
Sbjct: 420 RKVHIWDFARVNFVRTLLSKRKLQWMVDKNLVSNWDDPRFPTVRGVRRRGMTVEGLRNFV 479

Query: 480 LSQGPSRNVINLEWNLIWAFNKKVIDPVAPRHTAVVKPVKLHLEGDDVPQNPKIEMKLKH 539
           LSQGPSRNVINLEWNLIWAFNKKVIDPVAPRHTA+V PVK+H+EG   P++PK EMK KH
Sbjct: 480 LSQGPSRNVINLEWNLIWAFNKKVIDPVAPRHTAIVNPVKIHIEG--APESPKTEMKPKH 537

Query: 540 KKNPDVGEKKVIYYKDVLIDQEDADVVSEGEELTLMDWGNVIITKKNSDGSLVGKLHLEG 599
           KKNP VGEKKVIYY++V+ID+EDAD + + EE+TLMDWGN+IITKKN+DGS+  KLHLEG
Sbjct: 538 KKNPAVGEKKVIYYQNVVIDKEDADSIEDNEEVTLMDWGNIIITKKNADGSMEAKLHLEG 597

Query: 600 DFKKTKLKLTWLADTEDKVDVDLVDFDHLISKDKLEEGDNFEDFLTPETEFHTPAIADLN 659
           DFKKTK KLTWLADT+D V VDLVDFDHLISKDKLEE ++FEDFLTP+TEFHT AIADLN
Sbjct: 598 DFKKTKHKLTWLADTDDSVKVDLVDFDHLISKDKLEEDESFEDFLTPQTEFHTEAIADLN 657

Query: 660 VKDMKVGDVIQFERKGYYRLDSLAKDGKPYVFFTIPDGKAVNKYGAKK 707
           VKDM VGD+IQFERKGYYRLD+ AKDGKPYVFFTIPDGK+VNKYGAKK
Sbjct: 658 VKDMIVGDIIQFERKGYYRLDAEAKDGKPYVFFTIPDGKSVNKYGAKK 705

>TPHA0A06020 Chr1 complement(1361027..1363150) [2124 bp, 707 aa]
           {ON} Anc_3.569 YGL245W
          Length = 707

 Score = 1160 bits (3002), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 555/707 (78%), Positives = 624/707 (88%)

Query: 1   MSANLVINGKAPVVAYAELIAARIVNASKADAIKIEFVDDKKAAPATFNGEADSAFSKII 60
           M A L+I GK+ VVAY+ELIAARIVN+ K D+I IEFV+DKKAA A+ NGE D   SKI+
Sbjct: 1   MPATLIIGGKSSVVAYSELIAARIVNSVKPDSITIEFVEDKKAAAASLNGETDDVLSKIV 60

Query: 61  NAYQDVFSEGVQGSSEWSKLASEEFIIKNFQKLSGSLAKLDSRLNLRTYILDSFTATPAD 120
           +A  DVF EGV GS EW KLA  E +IKNFQKL+ SL KLD+ LNLRT+I    + + AD
Sbjct: 61  SANADVFPEGVTGSEEWVKLAVSELVIKNFQKLATSLDKLDAHLNLRTFINGGLSYSIAD 120

Query: 121 IACWGALRSNGMVGSIIKNKVYVNVSRWYTMLELDPLFSGAHEFLTKSLQELKKASNSNK 180
           IACWGALRSNGMVGSIIKNKV VNVSRWYT+ E +P+F  A+EFLTKSLQELKKAS++ K
Sbjct: 121 IACWGALRSNGMVGSIIKNKVNVNVSRWYTLFESNPIFGEANEFLTKSLQELKKASSAGK 180

Query: 181 KKETHKANFEIGLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFD 240
           KKETHKANFEI LPDAK+GEVVTRFPPEPSGYLHIGHAKAA+LNQYFA AYKGKLIIRFD
Sbjct: 181 KKETHKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAAILNQYFADAYKGKLIIRFD 240

Query: 241 DTNPSKEKVEFQDSILEDLDLLGIKGDKITYSSDYFEEMYQLCVQLIKEGKAYCDDTPTE 300
           DTNPSKEKVEFQ+SILEDL LLGIKGD+IT+SSDYF+EMY  C+QLIKEGKAYCDDTP +
Sbjct: 241 DTNPSKEKVEFQESILEDLALLGIKGDRITHSSDYFQEMYDYCIQLIKEGKAYCDDTPVD 300

Query: 301 KMREERMDGIASARRDRSVEENLRIFNEEMKNGTEEGLKNCVRAKIDYKALNKALRDPVI 360
           KMREERMDGIASARR+RSVEENL+IF EEM+NGTEEGL+NCVRAKIDY+ALNK LRDPVI
Sbjct: 301 KMREERMDGIASARRNRSVEENLKIFTEEMQNGTEEGLQNCVRAKIDYEALNKTLRDPVI 360

Query: 361 FRCNLTPHHRTGTTWKMYPTYDFCVPIVDAIEGVTHALRTIEYRDRNPQYEWMLDALHLR 420
           +RCNL PHHRTGT WKMYPTYDFCVPIVD++EGVTHALRTIEYRDRN QYEWML+A++LR
Sbjct: 361 YRCNLNPHHRTGTAWKMYPTYDFCVPIVDSLEGVTHALRTIEYRDRNAQYEWMLNAMNLR 420

Query: 421 KVHIWDFARVNFVRTLLSKRKLQWMVDKGCVSNWDDPRFPTXXXXXXXXMTVEGLRNFVL 480
           KVHIWDFARVNFVRTLLSKRKLQWMVDK  VSNWDDPRFPT        MT+EGLRNFV+
Sbjct: 421 KVHIWDFARVNFVRTLLSKRKLQWMVDKELVSNWDDPRFPTVRGVRRRGMTIEGLRNFVI 480

Query: 481 SQGPSRNVINLEWNLIWAFNKKVIDPVAPRHTAVVKPVKLHLEGDDVPQNPKIEMKLKHK 540
           SQGPSRNVINLEWNLIWAFNKKVIDPVAPR T V+ P+K+HL G D P+ P++EMK KH 
Sbjct: 481 SQGPSRNVINLEWNLIWAFNKKVIDPVAPRLTCVINPIKIHLSGADAPETPRVEMKPKHP 540

Query: 541 KNPDVGEKKVIYYKDVLIDQEDADVVSEGEELTLMDWGNVIITKKNSDGSLVGKLHLEGD 600
           KNP VGEK+VI+ KD++ID++DADV+ EGEE+TLM+WGN II KKN+DGS+   LHLEGD
Sbjct: 541 KNPAVGEKRVIFSKDIVIDKDDADVIEEGEEITLMNWGNAIIDKKNADGSIDATLHLEGD 600

Query: 601 FKKTKLKLTWLADTEDKVDVDLVDFDHLISKDKLEEGDNFEDFLTPETEFHTPAIADLNV 660
           FKKTK K+TWLA+TED   VDLVDFDHLI+KDKLEE ++FE+FLTP TEFHT AIAD+NV
Sbjct: 601 FKKTKHKITWLAETEDVTKVDLVDFDHLITKDKLEEDESFENFLTPNTEFHTDAIADVNV 660

Query: 661 KDMKVGDVIQFERKGYYRLDSLAKDGKPYVFFTIPDGKAVNKYGAKK 707
           KDMKVGD+IQFERKGYYRLD+L KDGKPY+FFTIPDGKAVNKYGAKK
Sbjct: 661 KDMKVGDIIQFERKGYYRLDALPKDGKPYIFFTIPDGKAVNKYGAKK 707

>AFR264W Chr6 (908580..910703) [2124 bp, 707 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGL245W (GUS1)
          Length = 707

 Score = 1157 bits (2994), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 551/707 (77%), Positives = 607/707 (85%)

Query: 1   MSANLVINGKAPVVAYAELIAARIVNASKADAIKIEFVDDKKAAPATFNGEADSAFSKII 60
           MS+ L+I  K+P VAYAELIAAR VN +K DA+ I+F + K+AA A+F+GE+ +A  +++
Sbjct: 1   MSSTLIIAAKSPAVAYAELIAARAVNEAKQDAVAIQFTEGKEAAAASFDGESQNALERMV 60

Query: 61  NAYQDVFSEGVQGSSEWSKLASEEFIIKNFQKLSGSLAKLDSRLNLRTYILDSFTATPAD 120
             Y DV     + ++ W   A  + ++K+F+KLSGSL KLD+ LNLRT++L     T AD
Sbjct: 61  EKYPDVLGSVPEEAAWWIAYARTDLVVKDFKKLSGSLEKLDAHLNLRTFVLGGMQPTVAD 120

Query: 121 IACWGALRSNGMVGSIIKNKVYVNVSRWYTMLELDPLFSGAHEFLTKSLQELKKASNSNK 180
           +A WGALRSNG VGSIIKNKVYVNVSRWYT LEL P F GAHEFL KSL+ELK A N NK
Sbjct: 121 VAVWGALRSNGPVGSIIKNKVYVNVSRWYTTLELIPAFGGAHEFLAKSLKELKAAGNVNK 180

Query: 181 KKETHKANFEIGLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFD 240
           KKETHKANFEI LPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFD
Sbjct: 181 KKETHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFD 240

Query: 241 DTNPSKEKVEFQDSILEDLDLLGIKGDKITYSSDYFEEMYQLCVQLIKEGKAYCDDTPTE 300
           DTNPSKE+VEFQDSILEDL+LLGIKGD+IT+SSDYF+EMY  CVQ+IKEGKAYCDDTPTE
Sbjct: 241 DTNPSKERVEFQDSILEDLELLGIKGDRITHSSDYFQEMYDYCVQMIKEGKAYCDDTPTE 300

Query: 301 KMREERMDGIASARRDRSVEENLRIFNEEMKNGTEEGLKNCVRAKIDYKALNKALRDPVI 360
           +MREERM+GIASARR+RSVEENL+IF EEMKNGTEEGLKNCVRAK DY ALNK L+DPV+
Sbjct: 301 RMREERMEGIASARRERSVEENLKIFTEEMKNGTEEGLKNCVRAKRDYAALNKTLKDPVL 360

Query: 361 FRCNLTPHHRTGTTWKMYPTYDFCVPIVDAIEGVTHALRTIEYRDRNPQYEWMLDALHLR 420
           +RCNLTPHHRTGT WK+YPTYDFCVPIVDA+EGVTHALRTIEYRDRN QYEWML+AL LR
Sbjct: 361 YRCNLTPHHRTGTAWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNALKLR 420

Query: 421 KVHIWDFARVNFVRTLLSKRKLQWMVDKGCVSNWDDPRFPTXXXXXXXXMTVEGLRNFVL 480
           KVHIWDFARVNFVRTLLSKRKLQW+VDK  VSNWDDPRFPT        MT+EGLRNFVL
Sbjct: 421 KVHIWDFARVNFVRTLLSKRKLQWLVDKQVVSNWDDPRFPTVRGVRRRGMTIEGLRNFVL 480

Query: 481 SQGPSRNVINLEWNLIWAFNKKVIDPVAPRHTAVVKPVKLHLEGDDVPQNPKIEMKLKHK 540
           SQGPSRNVINLEWNLIWAFNKKVIDP+APRHT V  PVKLHL G DVPQ P  EMK KHK
Sbjct: 481 SQGPSRNVINLEWNLIWAFNKKVIDPIAPRHTVVTNPVKLHLNGADVPQTPLTEMKPKHK 540

Query: 541 KNPDVGEKKVIYYKDVLIDQEDADVVSEGEELTLMDWGNVIITKKNSDGSLVGKLHLEGD 600
           KNP VGEKKVIYYKDVLI  EDA +++ GEE+TLMDWGN II  KN DGSL   L+LEGD
Sbjct: 541 KNPAVGEKKVIYYKDVLIGAEDAAMLAAGEEVTLMDWGNAIIRGKNDDGSLTADLNLEGD 600

Query: 601 FKKTKLKLTWLADTEDKVDVDLVDFDHLISKDKLEEGDNFEDFLTPETEFHTPAIADLNV 660
           FKKTK KLTWLADT D V VDLVDFDHLISKD+LEE DNFEDFLTPETEFHT AIADLNV
Sbjct: 601 FKKTKFKLTWLADTSDTVPVDLVDFDHLISKDRLEEEDNFEDFLTPETEFHTTAIADLNV 660

Query: 661 KDMKVGDVIQFERKGYYRLDSLAKDGKPYVFFTIPDGKAVNKYGAKK 707
           KDMKVGDVIQFER GYYRLD++    KP+VFFTIPDGKAVNKYGAKK
Sbjct: 661 KDMKVGDVIQFERTGYYRLDTVGSGDKPFVFFTIPDGKAVNKYGAKK 707

>ZYRO0E09570g Chr5 complement(762205..764325) [2121 bp, 706 aa] {ON}
           highly similar to uniprot|P46655 Saccharomyces
           cerevisiae YGL245W GUS1 Glutamyl-tRNA synthetase (GluRS)
           forms a complex with methionyl-tRNA synthetase (Mes1p)
           and Arc1p complex formation increases the catalytic
           efficiency of both tRNA synthetases and ensures their
           correct localization to the cytoplasm
          Length = 706

 Score = 1134 bits (2933), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 539/706 (76%), Positives = 609/706 (86%), Gaps = 2/706 (0%)

Query: 3   ANLVINGKAPVVAYAELIAARIVNASKADAIKIEFVDDKKAAPATFNGEADSAFSKIINA 62
            NLVINGKAPVVAYAELIA+RIVNA+  DAI +EFVD+K AAP  FNG +D  F+KII+ 
Sbjct: 2   VNLVINGKAPVVAYAELIASRIVNAAHKDAITVEFVDEKNAAPVVFNGSSDDTFAKIIST 61

Query: 63  YQDVFS-EGVQGSSEWSKLASEEFIIKNFQKLSGSLAKLDSRLNLRTYILDSFTATPADI 121
           Y DVF  E  +  + W K+A E+ ++KNFQ+LS SL +LD+ LNLRT+IL     + ADI
Sbjct: 62  YPDVFGHESSEEVAHWIKVAREQLVVKNFQQLSQSLERLDAVLNLRTFILGGLKISAADI 121

Query: 122 ACWGALRSNGMVGSIIKNKVYVNVSRWYTMLELDPLFSGAHEFLTKSLQELKKASNSNKK 181
            CWGALRSNGMVGSIIKNKVYVNVSRWYT+LEL+P F GAHE+LTKS+Q +KKA  + KK
Sbjct: 122 VCWGALRSNGMVGSIIKNKVYVNVSRWYTLLELNPSFGGAHEYLTKSMQGIKKAVTAGKK 181

Query: 182 KETHKANFEIGLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDD 241
           KE HKANFEI LPDAK+GEVVTRFPPEPSGYLHIGHAKAA+LN+YFA AYKGKLIIRFDD
Sbjct: 182 KEGHKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAAILNEYFAHAYKGKLIIRFDD 241

Query: 242 TNPSKEKVEFQDSILEDLDLLGIKGDKITYSSDYFEEMYQLCVQLIKEGKAYCDDTPTEK 301
           TNPSKE++EFQD+ILEDL+L+GIKGDKITYSSDYF+EMY LCVQLIKEGKAYCDDT  EK
Sbjct: 242 TNPSKERMEFQDAILEDLELMGIKGDKITYSSDYFQEMYDLCVQLIKEGKAYCDDTDVEK 301

Query: 302 MREERMDGIASARRDRSVEENLRIFNEEMKNGTEEGLKNCVRAKIDYKALNKALRDPVIF 361
           MREERM+GI SA+RD SVEENLRIF EEMKNGTE G KNCVRAKIDYKA NK LRDPVI+
Sbjct: 302 MREERMEGIPSAKRDLSVEENLRIFTEEMKNGTEFGQKNCVRAKIDYKAANKTLRDPVIY 361

Query: 362 RCNLTPHHRTGTTWKMYPTYDFCVPIVDAIEGVTHALRTIEYRDRNPQYEWMLDALHLRK 421
           RCNLTPHHRT   WKMYPTYDFCVPIVD+IEGVTHALRTIEYRDRN QY+WML AL LRK
Sbjct: 362 RCNLTPHHRTKGQWKMYPTYDFCVPIVDSIEGVTHALRTIEYRDRNAQYDWMLKALRLRK 421

Query: 422 VHIWDFARVNFVRTLLSKRKLQWMVDKGCVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLS 481
           VHIWDFARVNF+RTLLSKRKLQWMVD G VSNWDDPRFPT        MTVEGLRNFV+S
Sbjct: 422 VHIWDFARVNFMRTLLSKRKLQWMVDHGLVSNWDDPRFPTVRGVRRRGMTVEGLRNFVIS 481

Query: 482 QGPSRNVINLEWNLIWAFNKKVIDPVAPRHTAVVKPVKLHLEGDDVPQNPKIEMKLKHKK 541
           QGPS+NVINLEWNLIWA NKK+IDPVAPRHTAVV PV++ LEG+  P+ PK+E+K KHKK
Sbjct: 482 QGPSKNVINLEWNLIWAVNKKIIDPVAPRHTAVVDPVEITLEGEGAPETPKVELKPKHKK 541

Query: 542 NPDVGEKKVIYYKDVLIDQEDADVVSEGEELTLMDWGNVIITKKNSDGSLVGKLHLEGDF 601
           NP VGEKKVIY   ++ID+EDA V+  GEELTLMDWGN+IIT KN+DGSLV K +L GDF
Sbjct: 542 NPAVGEKKVIYSNKIIIDKEDASVLEVGEELTLMDWGNIIITSKNADGSLVAKTNLGGDF 601

Query: 602 KKTKLKLTWLADTEDKVDVDLVDFDHLISKDKLEEGDNFEDFLTPETEFHTPAIADLNVK 661
           KKTK K+TWLA+T D V V++VDFDHLI+KDKLEE +NF DF+TP+TEFHT A+ D+NVK
Sbjct: 602 KKTKHKVTWLANT-DYVPVEMVDFDHLITKDKLEEDENFTDFITPQTEFHTKAVGDVNVK 660

Query: 662 DMKVGDVIQFERKGYYRLDSLAKDGKPYVFFTIPDGKAVNKYGAKK 707
           DMKVGD+IQFERKGY RLDS A+  KPY+FFTIPDGK+VN+YGAKK
Sbjct: 661 DMKVGDIIQFERKGYCRLDSKAEGDKPYIFFTIPDGKSVNRYGAKK 706

>TBLA0E00190 Chr5 (24885..27008) [2124 bp, 707 aa] {ON} Anc_3.569
           YGL245W
          Length = 707

 Score = 1102 bits (2850), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 539/708 (76%), Positives = 616/708 (87%), Gaps = 2/708 (0%)

Query: 1   MSANLVINGKAPVVAYAELIAARIVNASKADAIKIEFVDDKKAAPATFNGEADSAFSKII 60
           MS  L+++GKA  VAY ELIAARIVN S A+A+ I FV+DKKAAPAT +G +D   +KI+
Sbjct: 1   MSTKLILSGKAQAVAYGELIAARIVNNSSANAVDISFVEDKKAAPATLDGSSDDVLAKIV 60

Query: 61  NAYQDVF-SEGVQGSSEWSKLASEEFIIKNFQKLSGSLAKLDSRLNLRTYILDSFTATPA 119
                 F S   +  + W+KLA E+ ++KNFQ+L+ +L  LD++LNLR+++L     + A
Sbjct: 61  ALSPSSFASASKEDVAHWTKLAQEKLVVKNFQQLAQTLEILDAQLNLRSFVLGGLNFSAA 120

Query: 120 DIACWGALRSNGMVGSIIKNKVYVNVSRWYTMLELDPLFSGAHEFLTKSLQELKKASNSN 179
           D+A WGALRSNGMVGSIIKNKVYVNVSRWY+ LEL+P F  +HEFLTKSLQELKKA+N+ 
Sbjct: 121 DVAVWGALRSNGMVGSIIKNKVYVNVSRWYSFLELEPAFGESHEFLTKSLQELKKAANAG 180

Query: 180 KKKETHKANFEIGLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRF 239
           KKKE+HKANFEI L DAK+GEVVTRFPPEPSGYLHIGHAKAA+LNQYFAQAYKGKLIIRF
Sbjct: 181 KKKESHKANFEIDLQDAKMGEVVTRFPPEPSGYLHIGHAKAAILNQYFAQAYKGKLIIRF 240

Query: 240 DDTNPSKEKVEFQDSILEDLDLLGIKGDKITYSSDYFEEMYQLCVQLIKEGKAYCDDTPT 299
           DDTNPSKEK EF++SI+EDL LLGIKGD++T+SSDYF+EMY  C+Q+IKEGKAYCDDTPT
Sbjct: 241 DDTNPSKEKEEFEESIIEDLALLGIKGDRVTHSSDYFQEMYDYCIQMIKEGKAYCDDTPT 300

Query: 300 EKMREERMDGIASARRDRSVEENLRIFNEEMKNGTEEGLKNCVRAKIDYKALNKALRDPV 359
           EKMREERM+G  SARR+RSVEENL+IF E+M NGTEEGLKNCVRAKIDYKALNK LRDPV
Sbjct: 301 EKMREERMEGEPSARRNRSVEENLKIFTEDMTNGTEEGLKNCVRAKIDYKALNKTLRDPV 360

Query: 360 IFRCNLTPHHRTGTTWKMYPTYDFCVPIVDAIEGVTHALRTIEYRDRNPQYEWMLDALHL 419
           I+RCNLTPHH TG  WK+YPTYDFCVPIVD++EGVTHALRTIEYRDRN QYEWMLDAL L
Sbjct: 361 IYRCNLTPHHITGDKWKVYPTYDFCVPIVDSLEGVTHALRTIEYRDRNAQYEWMLDALKL 420

Query: 420 RKVHIWDFARVNFVRTLLSKRKLQWMVDKGCVSNWDDPRFPTXXXXXXXXMTVEGLRNFV 479
           R VHIWDFARVNFVRTLLSKRKLQWMVDKG VSNWDDPRFPT        M++EGLRNFV
Sbjct: 421 RHVHIWDFARVNFVRTLLSKRKLQWMVDKGLVSNWDDPRFPTVRGVRRRGMSIEGLRNFV 480

Query: 480 LSQGPSRNVINLEWNLIWAFNKKVIDPVAPRHTAVVKPVKLHLEGDDVPQNPKIEMKLKH 539
           LSQGPSRNVINLEWNLIWAFNKKVIDP APRHTAVV P K+HLEG +VPQ  KIEMK KH
Sbjct: 481 LSQGPSRNVINLEWNLIWAFNKKVIDPTAPRHTAVVNPFKVHLEGSEVPQTDKIEMKPKH 540

Query: 540 KKNPDVGEKKVIYYKDVLIDQEDADVVSEGEELTLMDWGNVIITKKNSDGSLVGKLHLEG 599
           KKNPDVGEKKV++ K+++ID+EDADV+ EGEE TLMDWGN IITKK+++ S+  KLHLEG
Sbjct: 541 KKNPDVGEKKVVFSKNIIIDKEDADVLEEGEEFTLMDWGNAIITKKDAN-SITAKLHLEG 599

Query: 600 DFKKTKLKLTWLADTEDKVDVDLVDFDHLISKDKLEEGDNFEDFLTPETEFHTPAIADLN 659
           DFKKTK K+TWLADT+D V VDLVDFDHL++KD++EEG++FEDFLT +TEFHT AIADLN
Sbjct: 600 DFKKTKHKITWLADTKDVVSVDLVDFDHLLNKDRIEEGESFEDFLTEKTEFHTSAIADLN 659

Query: 660 VKDMKVGDVIQFERKGYYRLDSLAKDGKPYVFFTIPDGKAVNKYGAKK 707
           VKDMK+GD IQFERKGYYRLDSL K+G PYVFFTIPDGKAVNKYGAKK
Sbjct: 660 VKDMKIGDFIQFERKGYYRLDSLPKNGNPYVFFTIPDGKAVNKYGAKK 707

>ZYRO0C07018g Chr3 (528834..531245) [2412 bp, 803 aa] {ON} highly
           similar to uniprot|P13188 Saccharomyces cerevisiae
           YOR168W GLN4 Glutamine tRNA synthetase monomeric class I
           tRNA synthetase that catalyzes the specific
           glutaminylation of tRNA(Glu) N-terminal domain proposed
           to be involved in enzyme-tRNA interactions
          Length = 803

 Score =  242 bits (618), Expect = 9e-69,   Method: Compositional matrix adjust.
 Identities = 153/446 (34%), Positives = 244/446 (54%), Gaps = 30/446 (6%)

Query: 196 AKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKVEFQDSI 255
           A  G V TRFPPEP+GYLHIGH+KA ++N  +A+ + G   +RFDDTNP  E  E+ +SI
Sbjct: 246 ATHGLVHTRFPPEPNGYLHIGHSKAIMVNFGYAKFHGGHCYLRFDDTNPEAEAPEYFESI 305

Query: 256 LEDLDLLGIKGDKITYSSDYFEEMYQLCVQLIKEGKAYCDDTPTEKMREER---MDGI-- 310
           +  ++ LG    KITYSSDYF+++Y+L  +LI +GK Y  +   E+++  R    DG   
Sbjct: 306 IRMVNWLGFHPWKITYSSDYFDQLYELAERLISKGKGYVCNCAAEEIKASRGIKPDGTPG 365

Query: 311 ----ASARRDRSVEENLRIFNEEMKNGTEEGLKNCVRAKIDYKALNKALRDPVIFRCNLT 366
               A   R RSVEENL  F  +MK+G  +  +  +R K D  + +  + D + +R    
Sbjct: 366 GERHACKHRSRSVEENLTEFR-KMKDGHYQPGEATLRMKQDLSSPSPQMWDLIAYRVLNA 424

Query: 367 PHHRTGTTWKMYPTYDFCVPIVDAIEGVTHALRTIEYRDRNPQYEWMLDALHLRKVHIWD 426
           PH RTG  W++YPTYDF   +VD+ E +TH+L T E+      YEW+ D + + +    +
Sbjct: 425 PHPRTGNKWRIYPTYDFTHCLVDSFENITHSLCTTEFYLSRESYEWLCDQVDVFRPTQRE 484

Query: 427 FARVNFVRTLLSKRKLQWMVDKGCVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSR 486
           + R+N   T+LSKRK+  +VD+  V  WDDPR  T        +    + +F+ + G + 
Sbjct: 485 YGRLNITGTVLSKRKIAKLVDEKYVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVTT 544

Query: 487 NVINLEWNLIWAFNKKVIDPVAPRHTAVVKPVKLHLEGDDVPQNPKIEMKLKHKK-NPDV 545
           +V N++     +  +K ++   PR   ++ PV++ +  D+VP + +  + +  +   P+ 
Sbjct: 545 SVTNIQLVRFESAIRKYLEDTTPRLMFILDPVEVVV--DNVPDSFEDVVSIPFRPGTPEF 602

Query: 546 GEKKVIYYKDVLIDQED-ADVVSEGEELTLMDWGNVIITK-----------KNSDGSLVG 593
           GE++V + K V ID+ D ++  S+ E   L     V + K           K+SDG +  
Sbjct: 603 GEREVPFTKRVFIDRSDFSENASDKEFFRLTPEQPVGLIKVPHALIYKSLEKDSDGKIT- 661

Query: 594 KLHL----EGDFKKTKLKLTWLADTE 615
           K+H+    EG  KK K  + W+  +E
Sbjct: 662 KIHVHYDTEGKIKKPKTYIQWVPLSE 687

>TDEL0G04190 Chr7 (761363..763792) [2430 bp, 809 aa] {ON} Anc_6.51
           YOR168W
          Length = 809

 Score =  236 bits (602), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 139/387 (35%), Positives = 221/387 (57%), Gaps = 13/387 (3%)

Query: 199 GEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKVEFQDSILED 258
           G+V TRFPPEP+GYLHIGH+KA ++N  +A+   G+  +RFDDTNP  E  E+ +SI   
Sbjct: 252 GKVRTRFPPEPNGYLHIGHSKAIMVNFGYAKYNGGETYLRFDDTNPEAEAPEYFESIKRM 311

Query: 259 LDLLGIKGDKITYSSDYFEEMYQLCVQLIKEGKAYCDDTPTEKMREER---MDG------ 309
           +  LG K  KITYSSDYF+++Y+L   LIK GK Y     +E+++  R    DG      
Sbjct: 312 VSWLGFKPFKITYSSDYFDKLYELAEVLIKSGKGYVCHCTSEEVKAGRGIKEDGTPGGER 371

Query: 310 IASARRDRSVEENLRIFNEEMKNGTEEGLKNCVRAKIDYKALNKALRDPVIFRCNLTPHH 369
            A   RDRS+EE L  F + M+NG  +  +  +R K D  + +  + D V +R    PH 
Sbjct: 372 FACKDRDRSIEETLDEFRK-MRNGFYKPGEATLRMKQDLSSPSPQMWDLVAYRVLNAPHP 430

Query: 370 RTGTTWKMYPTYDFCVPIVDAIEGVTHALRTIEYRDRNPQYEWMLDALHLRKVHIWDFAR 429
           RTG+ WK+YPTYDF   +VD+ E +TH+L T E+      YEW+ D +H+ +    ++ R
Sbjct: 431 RTGSKWKIYPTYDFTHCLVDSFENITHSLCTTEFYLSRESYEWLCDQVHVFRPTQREYGR 490

Query: 430 VNFVRTLLSKRKLQWMVDKGCVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSRNVI 489
           +N   T+LSKRK+  +V++  V  WDDPR  T        +    + +F+ + G + +  
Sbjct: 491 LNITGTVLSKRKIAKLVEEKYVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVTTSTT 550

Query: 490 NLEWNLIWAFNKKVIDPVAPRHTAVVKPVKLHLEGDDVPQNPKIEMKLKHKK-NPDVGEK 548
           N++     +  +K ++   PR   V+ PV++ L  D++P++ +  +K+  +  +P+ GE+
Sbjct: 551 NIQVVRFESAIRKYLEDSTPRLMFVLDPVEVVL--DNLPEDYEELVKIPFRPGSPEFGER 608

Query: 549 KVIYYKDVLIDQEDADVVSEGEELTLM 575
           +V + K   I++ D    S+ +E   M
Sbjct: 609 EVPFTKRFFIERSDFSENSDDKEFFRM 635

>YOR168W Chr15 (649303..651732) [2430 bp, 809 aa] {ON}
           GLN4Glutamine tRNA synthetase, monomeric class I tRNA
           synthetase that catalyzes the specific glutaminylation
           of tRNA(Glu); N-terminal domain proposed to be involved
           in enzyme-tRNA interactions
          Length = 809

 Score =  236 bits (602), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 135/375 (36%), Positives = 212/375 (56%), Gaps = 15/375 (4%)

Query: 199 GEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKVEFQDSILED 258
           G+V TRFPPEP+GYLHIGH+KA ++N  +A+ + G   +RFDDTNP KE  E+ +SI   
Sbjct: 250 GKVRTRFPPEPNGYLHIGHSKAIMVNFGYAKYHNGTCYLRFDDTNPEKEAPEYFESIKRM 309

Query: 259 LDLLGIKGDKITYSSDYFEEMYQLCVQLIKEGKAYCDDTPTEKMREER---MDGI----- 310
           +  LG K  KITYSSDYF+E+Y+L   LIK GKAY      E+++  R    DG      
Sbjct: 310 VSWLGFKPWKITYSSDYFDELYRLAEVLIKNGKAYVCHCTAEEIKRGRGIKEDGTPGGER 369

Query: 311 -ASARRDRSVEENLRIFNEEMKNGTEEGLKNCVRAKIDYKALNKALRDPVIFRCNLTPHH 369
            A   RD+S+E+NL+ F  +M++G  +  +  +R K D  + +  + D + +R    PH 
Sbjct: 370 YACKHRDQSIEQNLQEF-RDMRDGKYKPGEAILRMKQDLNSPSPQMWDLIAYRVLNAPHP 428

Query: 370 RTGTTWKMYPTYDFCVPIVDAIEGVTHALRTIEYRDRNPQYEWMLDALHLRKVHIWDFAR 429
           RTGT W++YPTYDF   +VD++E +TH+L T E+      YEW+ D +H+ +    ++ R
Sbjct: 429 RTGTKWRIYPTYDFTHCLVDSMENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQREYGR 488

Query: 430 VNFVRTLLSKRKLQWMVDKGCVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSRNVI 489
           +N   T+LSKRK+  +VD+  V  WDDPR  T        +    + +F+ + G + +  
Sbjct: 489 LNITGTVLSKRKIAQLVDEKFVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVTTSTT 548

Query: 490 NLEWNLIWAFNKKVIDPVAPRHTAVVKPVKLHLE--GDDVPQNPKIEMKLKHKKNPDVGE 547
           N++     +  +K ++   PR   V+ PV++ ++   DD  +   I  +      P+ GE
Sbjct: 549 NIQVVRFESAVRKYLEDTTPRLMFVLDPVEVVVDNLSDDYEELATIPYR---PGTPEFGE 605

Query: 548 KKVIYYKDVLIDQED 562
           + V +     I++ D
Sbjct: 606 RTVPFTNKFYIERSD 620

>SAKL0E02134g Chr5 complement(162366..164771) [2406 bp, 801 aa] {ON}
           highly similar to uniprot|P13188 Saccharomyces
           cerevisiae YOR168W GLN4 Glutamine tRNA synthetase
           monomeric class I tRNA synthetase that catalyzes the
           specific glutaminylation of tRNA(Glu) N-terminal domain
           proposed to be involved in enzyme-tRNA interactions
          Length = 801

 Score =  231 bits (590), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 165/546 (30%), Positives = 278/546 (50%), Gaps = 61/546 (11%)

Query: 199 GEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKVEFQDSILED 258
           G+V TRFPPEP+GYLHIGH+KA ++N  +A+ + G   +RFDDTNP  E  E+ +SI   
Sbjct: 246 GKVRTRFPPEPNGYLHIGHSKAIMVNFGYAKYHNGVCYLRFDDTNPEAEAPEYFESIKRM 305

Query: 259 LDLLGIKGDKITYSSDYFEEMYQLCVQLIKEGKAYCDDTPTEKMREER---MDG------ 309
           +  LG +  KITYSSDYF+++Y L   LIK GKAY      E+++  R    DG      
Sbjct: 306 VSWLGFEPWKITYSSDYFDKLYDLAEVLIKNGKAYVCHCTAEEIKRGRGIKEDGTPGGER 365

Query: 310 IASARRDRSVEENLRIFNEEMKNGTEEGLKNCVRAKIDYKALNKALRDPVIFRCNLTPHH 369
           +A   RDR +EENL  F  +M++G  +  +  +R K D  + +  + D + +R    PH 
Sbjct: 366 VACVHRDRPIEENLEEFR-KMRDGVYKPGEAILRMKQDLSSPSPQMWDLIAYRVLNAPHP 424

Query: 370 RTGTTWKMYPTYDFCVPIVDAIEGVTHALRTIEYRDRNPQYEWMLDALHLRKVHIWDFAR 429
           RTG  WK+YPTYDF   +VD+ E +TH+L T E+      YEW+ D +H+ +    ++ R
Sbjct: 425 RTGDKWKIYPTYDFTHCLVDSFENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQREYGR 484

Query: 430 VNFVRTLLSKRKLQWMVDKGCVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSRNVI 489
           +N   T+LSKRK+  +V++G V  W+DPR  T        +    + +F+ + G + +  
Sbjct: 485 LNITGTVLSKRKIAKLVNEGIVRGWNDPRLFTLEAIRRRGVPPGAILSFINTLGVTTSTT 544

Query: 490 NLEWNLIWAFNKKVIDPVAPRHTAVVKPVKLHLEGDDVPQNPKIEMKLKHKK-NPDVGEK 548
           N++     +  +K ++    R   V+ PV++ +  D++P++ +  + + ++   P+ G++
Sbjct: 545 NIQVVRFESAIRKYLEDTTARLMFVLDPVEIVV--DNLPEDYEEMVTIPYRPGTPEFGDR 602

Query: 549 KVIYYKDVLIDQED-ADVVSEGEELTLMDWGNVIITK-----------KNSDGSLVGKLH 596
            V + K   I++ D ++   + E   L     V + K           ++SDG +V ++H
Sbjct: 603 TVPFTKKFFIERSDFSEAADDKEFFRLTPTQPVGLIKVPYTVSFQSVDRDSDGKIV-RIH 661

Query: 597 LEGD-----FKKTKLKLTWL---ADTEDKVDVDLVD-FDHLI-SKDKLEEGDNFEDFLTP 646
           ++ D      KK K  + W+   A     V +     ++ L  S++     + + + + P
Sbjct: 662 VKYDNDQAKAKKPKAYIQWVPFSAKHNSPVTISETRVYNQLFNSENPSSHPEGYLNDINP 721

Query: 647 ETEF-HTPAIADLNV------------------------KDMKVGDVIQFERKGYYRLDS 681
           E+E  +T ++ + N                         KD K     Q  R GY+ LD 
Sbjct: 722 ESEIVYTKSLVEHNFDHVIKNSPWVVNSVKESPFYVEEEKDRKEVCRFQAMRVGYFTLDK 781

Query: 682 LAKDGK 687
            ++DGK
Sbjct: 782 DSEDGK 787

>KNAG0M01100 Chr13 (194806..197205) [2400 bp, 799 aa] {ON} Anc_6.51
           YOR168W
          Length = 799

 Score =  231 bits (590), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 144/440 (32%), Positives = 241/440 (54%), Gaps = 28/440 (6%)

Query: 196 AKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKVEFQDSI 255
           A  G+V TRFPPEP+GYLHIGH+KA ++N  +A+ + G   +RFDDTNP  E  E+ +SI
Sbjct: 246 ATAGKVHTRFPPEPNGYLHIGHSKAIMVNFGYAKYHDGVCYLRFDDTNPEAEAPEYFESI 305

Query: 256 LEDLDLLGIKGDKITYSSDYFEEMYQLCVQLIKEGKAYCDDTPTEKMREER---MDG--- 309
              +  LG +  KITYSSDYF+++Y+L   LIK GK Y      E++R  R    DG   
Sbjct: 306 KRMVSWLGFEPWKITYSSDYFDKLYELAKVLIKNGKGYICHCTAEEIRRGRGIKEDGQPG 365

Query: 310 ---IASARRDRSVEENLRIFNEEMKNGTEEGLKNCVRAKIDYKALNKALRDPVIFRCNLT 366
                   R+ S+E+NL  F E MK G  +  +  +R K D+ + +  + D + +R    
Sbjct: 366 GERFGCKHRENSIEKNLEEF-ENMKEGKYQPGEATLRMKQDFSSPSPQMWDLIAYRVLNA 424

Query: 367 PHHRTGTTWKMYPTYDFCVPIVDAIEGVTHALRTIEYRDRNPQYEWMLDALHLRKVHIWD 426
           PH RTG+ WK+YPTYDF   +VD+ E +TH+L T E+      YEW+ D +H+ +    +
Sbjct: 425 PHPRTGSKWKIYPTYDFTHCLVDSFENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQRE 484

Query: 427 FARVNFVRTLLSKRKLQWMVDKGCVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSR 486
           + R+N   T+LSKRK+  +V++  V  WDDPR  T        +    + +F+ + G + 
Sbjct: 485 YGRLNITGTILSKRKIAKLVEEKIVRGWDDPRLYTLEAIRRRGVPPGAILSFINTLGVTT 544

Query: 487 NVINLEWNLIWAFNKKVIDPVAPRHTAVVKPVKLHLEGDDVPQNPKIEMKLKHKK-NPDV 545
           +V N++     +  +K ++   PR   V+ P+++ +  D++P++ +  +++ +K  + + 
Sbjct: 545 SVTNIQAVRFESAIRKYLEETTPRLMFVLDPIEVVV--DNLPEDHEELVEVPYKAGSAEF 602

Query: 546 GEKKVIYYKDVLIDQED-ADVVSEGEELTLMDWGNVIITK-----------KNSDGSLVG 593
           G + + +     ID+ D ++ V + E   L    +V + K           K+++G +  
Sbjct: 603 GSRTLPFTNRFYIDRSDFSETVDDKEFFRLTPSQSVGLVKVPRTVTFVSVEKDANGHIT- 661

Query: 594 KLHLEGDFKKTKLK--LTWL 611
           +LH+  D +K K K  + W+
Sbjct: 662 RLHVNYDSEKKKPKTYIQWV 681

>Smik_15.348 Chr15 (605412..607844) [2433 bp, 810 aa] {ON} YOR168W
           (REAL)
          Length = 810

 Score =  231 bits (588), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 134/375 (35%), Positives = 208/375 (55%), Gaps = 15/375 (4%)

Query: 199 GEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKVEFQDSILED 258
           G+V TRFPPEP+GYLHIGH+KA ++N  +A+ + G   +RFDDTNP KE  E+ +SI   
Sbjct: 251 GKVRTRFPPEPNGYLHIGHSKAIMVNFGYAKYHNGTCYLRFDDTNPEKEAPEYFESIKRM 310

Query: 259 LDLLGIKGDKITYSSDYFEEMYQLCVQLIKEGKAYCDDTPTEKMREER---MDG------ 309
           +  LG    KITYSSDYF+E+Y L   LIK GK Y      E+++  R    DG      
Sbjct: 311 VSWLGFMPWKITYSSDYFDELYGLAEVLIKNGKGYVCHCTAEEIKRGRGIKEDGTPGGQR 370

Query: 310 IASARRDRSVEENLRIFNEEMKNGTEEGLKNCVRAKIDYKALNKALRDPVIFRCNLTPHH 369
            A   RD+S+E NL+ F  +M++G  +  +  +R K D  + +  + D + +R    PH 
Sbjct: 371 FACKHRDQSIELNLQEF-RDMRDGKYKPGEAILRMKQDLSSPSPQMWDLIAYRVLNAPHP 429

Query: 370 RTGTTWKMYPTYDFCVPIVDAIEGVTHALRTIEYRDRNPQYEWMLDALHLRKVHIWDFAR 429
           RTGT WK+YPTYDF   +VD++E +TH+L T E+      YEW+ D +H+ +    ++ R
Sbjct: 430 RTGTKWKIYPTYDFTHCLVDSMENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQREYGR 489

Query: 430 VNFVRTLLSKRKLQWMVDKGCVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSRNVI 489
           +N   T+LSKRK+  +VD+  V  WDDPR  T        +    + +F+ + G + +  
Sbjct: 490 LNITGTVLSKRKIAQLVDEKFVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVTTSTT 549

Query: 490 NLEWNLIWAFNKKVIDPVAPRHTAVVKPVKLHLE--GDDVPQNPKIEMKLKHKKNPDVGE 547
           N++     +  +K ++   PR   V+ PV++ ++   DD  +   I  +      P+ GE
Sbjct: 550 NIQVVRFESAVRKYLEDTTPRLMFVLDPVEVIVDNLSDDYEELATIPFR---PGTPEFGE 606

Query: 548 KKVIYYKDVLIDQED 562
           + V +     I++ D
Sbjct: 607 RTVPFTNRFYIERSD 621

>NCAS0F00240 Chr6 complement(37406..39841) [2436 bp, 811 aa] {ON}
           Anc_6.51 YOR168W
          Length = 811

 Score =  228 bits (582), Expect = 8e-64,   Method: Compositional matrix adjust.
 Identities = 147/449 (32%), Positives = 238/449 (53%), Gaps = 33/449 (7%)

Query: 196 AKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKVEFQDSI 255
           A  G+V TRFPPEP+GYLHIGH+KA ++N  +A+   G  I+RFDDTNP  E  E+ +SI
Sbjct: 251 ATGGKVRTRFPPEPNGYLHIGHSKAIMVNFGYAKYNDGVCILRFDDTNPEAEAPEYFESI 310

Query: 256 LEDLDLLGIKGDKITYSSDYFEEMYQLCVQLIKEGKAY---CDDTPTEKMREERMDGI-- 310
              +  LG    KITYSSDYF+++Y L   LI   + Y   C     ++ R  + DG   
Sbjct: 311 KRMVSWLGFVPWKITYSSDYFDKLYDLAEVLINNDRGYICHCTAEEIKRGRGIKEDGTPG 370

Query: 311 ----ASARRDRSVEENLRIFNEEMKNGTEEGLKNCVRAKIDYKALNKALRDPVIFRCNLT 366
               A   R  S+E NL+ F   M++G  +  +  +R K D  + +  + D + +R    
Sbjct: 371 GERSACVHRSNSIETNLKEF-RNMRDGVYKPGEATLRMKQDLTSPSPQMWDLIAYRVLNA 429

Query: 367 PHHRTGTTWKMYPTYDFCVPIVDAIEGVTHALRTIEYRDRNPQYEWMLDALHLRKVHIWD 426
           PH RTGT WK+YPTYDF   +VD+ E +TH+L T E+R     YEW+ D +H+ +    +
Sbjct: 430 PHPRTGTKWKIYPTYDFTHCLVDSFENITHSLCTTEFRLSRESYEWLCDQVHVFRPAQRE 489

Query: 427 FARVNFVRTLLSKRKLQWMVDKGCVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSR 486
           + R+N   T+LSKRK+  +VD+  V  WDDPR  T        +    + +F+ + G + 
Sbjct: 490 YGRLNITGTVLSKRKIAKLVDEHHVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVTT 549

Query: 487 NVINLEWNLIWAFNKKVIDPVAPRHTAVVKPVKLHLEGDDVPQNPKIEMKLKHKK-NPDV 545
           +  N++        +K ++   PR   ++ P+++ +  D++P++ +  + + ++   P+ 
Sbjct: 550 STTNIQVARFENSIRKYLEDSTPRLMFILDPIEIVV--DNLPEDYEEILSIPYRAGTPEF 607

Query: 546 GEKKVIYYKDVLIDQEDADVVSEGEE-LTLMDWGNVIITK-----------KNSDGSLVG 593
           G++ V + K   I++ D   VS+ +E   L    NV + K           K+S+G +  
Sbjct: 608 GDRTVPFTKRFYIERSDFSEVSDDKEFFRLTPTQNVGLIKVPHTVSFKSVEKDSNGKIT- 666

Query: 594 KLHL-------EGDFKKTKLKLTWLADTE 615
           K+H+       EG  KK K  + W+  +E
Sbjct: 667 KIHVHYNNEAQEGKPKKPKTYIQWVPVSE 695

>Skud_15.332 Chr15 (598097..600526) [2430 bp, 809 aa] {ON} YOR168W
           (REAL)
          Length = 809

 Score =  228 bits (580), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 126/339 (37%), Positives = 195/339 (57%), Gaps = 12/339 (3%)

Query: 199 GEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKVEFQDSILED 258
           G+V TRFPPEP+GYLHIGH+KA ++N  +A+ + G   +RFDDTNP KE  E+ +SI   
Sbjct: 250 GKVRTRFPPEPNGYLHIGHSKAIMVNFGYARYHNGTCYLRFDDTNPEKEAPEYFESIKRM 309

Query: 259 LDLLGIKGDKITYSSDYFEEMYQLCVQLIKEGKAY---CDDTPTEKMREERMDG------ 309
           +  LG K  KITYSSDYF+E+Y L   LI  GK Y   C     ++ R  + DG      
Sbjct: 310 VSWLGFKPWKITYSSDYFDELYGLAEVLINNGKGYVCHCTGEEIKRSRGIKEDGTPGGER 369

Query: 310 IASARRDRSVEENLRIFNEEMKNGTEEGLKNCVRAKIDYKALNKALRDPVIFRCNLTPHH 369
            A   RD+S+E NL+ F  +M++G  +  +  +R K D  + +  + D + +R    PH 
Sbjct: 370 FACKHRDQSIELNLKEF-RDMRDGKYKPGEAILRMKQDLSSPSPQMWDLIAYRVLNAPHP 428

Query: 370 RTGTTWKMYPTYDFCVPIVDAIEGVTHALRTIEYRDRNPQYEWMLDALHLRKVHIWDFAR 429
           RTGT WK+YPTYDF   +VD++E +TH+L T E+      YEW+ D +H+ +    ++ R
Sbjct: 429 RTGTKWKIYPTYDFTHCLVDSMENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQREYGR 488

Query: 430 VNFVRTLLSKRKLQWMVDKGCVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSRNVI 489
           +N   T+LSKRK+  +VD+  V  WDDPR  T        +    + +F+ + G + +  
Sbjct: 489 LNITGTVLSKRKIAQLVDEKFVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVTTSTT 548

Query: 490 NLEWNLIWAFNKKVIDPVAPRHTAVVKPVKLHLEGDDVP 528
           N++     +  +K ++   PR   V+ P+++ +  D++P
Sbjct: 549 NIQVIRFESAVRKYLEDTTPRLMFVLDPIEVVV--DNLP 585

>Kwal_56.22559 s56 complement(179568..181970) [2403 bp, 800 aa] {ON}
           YOR168W (GLN4) - glutaminyl-tRNA synthetase [contig 185]
           FULL
          Length = 800

 Score =  226 bits (575), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 133/377 (35%), Positives = 212/377 (56%), Gaps = 13/377 (3%)

Query: 196 AKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKVEFQDSI 255
           A  G+V TRFPPEP+GYLHIGH+KA ++N  +A+   G   +RFDDTNP  E  E+ +SI
Sbjct: 242 ATGGKVHTRFPPEPNGYLHIGHSKAIMVNFGYAKHNDGVCYLRFDDTNPEAEAPEYFESI 301

Query: 256 LEDLDLLGIKGDKITYSSDYFEEMYQLCVQLIKEGKAY---CDDTPTEKMREERMDGI-- 310
              +  LG K  KITYSSDYF+++Y+L   LI   KAY   C     ++ R  + DG   
Sbjct: 302 KNMVAWLGFKPWKITYSSDYFDKLYELAEVLISNSKAYVCHCSGEEIKRGRGIKEDGTPG 361

Query: 311 ----ASARRDRSVEENLRIFNEEMKNGTEEGLKNCVRAKIDYKALNKALRDPVIFRCNLT 366
               A   R RSVEENL  F  +M++G  +  +  +R K D ++ +  + D + +R    
Sbjct: 362 GERRACVHRSRSVEENLTEF-RKMRDGHYKPGEAILRMKQDLESPSPQMWDLIAYRVLNA 420

Query: 367 PHHRTGTTWKMYPTYDFCVPIVDAIEGVTHALRTIEYRDRNPQYEWMLDALHLRKVHIWD 426
           PH RTG  WK+YPTYDF   +VD+ E +TH+L T E+      YEW+ D +H+ +    +
Sbjct: 421 PHPRTGDKWKIYPTYDFTHCLVDSFENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQRE 480

Query: 427 FARVNFVRTLLSKRKLQWMVDKGCVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSR 486
           + R+N   T+LSKRK+  +V++  V  WDDPR  T        +    + +F+ + G + 
Sbjct: 481 YGRLNITGTVLSKRKIAKLVNEHYVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVTT 540

Query: 487 NVINLEWNLIWAFNKKVIDPVAPRHTAVVKPVKLHLEGDDVPQNPKIEMKLKHKK-NPDV 545
           +  N++     +  +K ++   PR   ++ PV++ +  D++P + +  +K+ ++   P+ 
Sbjct: 541 STTNIQVVRFESAIRKYLEDNTPRLMMILDPVEVVV--DNLPDDYEELVKIPYRPGTPEF 598

Query: 546 GEKKVIYYKDVLIDQED 562
           GE+ V + K   I++ D
Sbjct: 599 GERSVPFTKKFYIERSD 615

>Kpol_1037.38 s1037 complement(93063..95489) [2427 bp, 808 aa] {ON}
           complement(93063..95489) [2427 nt, 809 aa]
          Length = 808

 Score =  225 bits (573), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 128/374 (34%), Positives = 210/374 (56%), Gaps = 13/374 (3%)

Query: 199 GEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKVEFQDSILED 258
           G+V TRFPPEP+GYLHIGH+KA ++N  +A+ + G   +RFDDTNP  E  E+ +SI   
Sbjct: 251 GKVHTRFPPEPNGYLHIGHSKAIMVNFGYAKYWDGVCYLRFDDTNPEAEAPEYFESIKRM 310

Query: 259 LDLLGIKGDKITYSSDYFEEMYQLCVQLIKEGKAY---CDDTPTEKMREERMDGI----- 310
           +  LG K  KITYSSDYF+++Y+L   LI+  + Y   C     ++ R  + DG      
Sbjct: 311 VSWLGFKPWKITYSSDYFDKLYELAEILIQNDRGYICHCTAEEIKRGRGIKEDGTPGGER 370

Query: 311 -ASARRDRSVEENLRIFNEEMKNGTEEGLKNCVRAKIDYKALNKALRDPVIFRCNLTPHH 369
            A   RDR VEE+L+ F   M++G  +  +  +R K D  + +  + D + +R    PH 
Sbjct: 371 SACKHRDRPVEESLKEFRN-MRDGVYQPGEATLRMKQDLTSPSPQMWDLIAYRVLNAPHP 429

Query: 370 RTGTTWKMYPTYDFCVPIVDAIEGVTHALRTIEYRDRNPQYEWMLDALHLRKVHIWDFAR 429
           RTG+ WK+YPTYDF   +VD+ E +TH+L T E+      YEW+ D +H+ +    ++ R
Sbjct: 430 RTGSKWKIYPTYDFTHCLVDSFENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQREYGR 489

Query: 430 VNFVRTLLSKRKLQWMVDKGCVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSRNVI 489
           +N   T+LSKRK+  +V+   V  WDDPR  T        +    + +F+ + G + +  
Sbjct: 490 LNITGTVLSKRKIAKLVEGNYVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVTTSTT 549

Query: 490 NLEWNLIWAFNKKVIDPVAPRHTAVVKPVKLHLEGDDVPQNPKIEMKLKHKK-NPDVGEK 548
           N++     +  +K ++   PR   V+ P+++ +  D++P++ +    + ++   P+ GE+
Sbjct: 550 NIQVVRFESAVRKFLEDTTPRLMFVLDPIEVVV--DNLPEDYEEIASIPYRPGTPEFGER 607

Query: 549 KVIYYKDVLIDQED 562
            V + K   I++ D
Sbjct: 608 NVPFTKKFYIERSD 621

>AGR259C Chr7 complement(1227063..1229459) [2397 bp, 798 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR168W
           (GLN4)
          Length = 798

 Score =  224 bits (571), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 130/377 (34%), Positives = 211/377 (55%), Gaps = 13/377 (3%)

Query: 196 AKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKVEFQDSI 255
           A  G+V TRFPPEP+GYLHIGH+KA ++N  +A+ + G   +RFDDTNP  E  E+ +SI
Sbjct: 242 ATGGKVHTRFPPEPNGYLHIGHSKAIMVNFGYAKHHGGVCYLRFDDTNPEAEAPEYFESI 301

Query: 256 LEDLDLLGIKGDKITYSSDYFEEMYQLCVQLIKEGKAYCDDTPTEKMREER---MDG--- 309
              +  LG    KITYSSDYF+++Y+L   LIK GK Y      E++R  R    DG   
Sbjct: 302 ERMVAWLGFSPWKITYSSDYFDQLYELAEVLIKNGKGYICHCTAEEIRRGRGIKEDGTPG 361

Query: 310 ---IASARRDRSVEENLRIFNEEMKNGTEEGLKNCVRAKIDYKALNKALRDPVIFRCNLT 366
              +  A R+R +EENL  F   M++G     +  +R K D  + +  + D V +R    
Sbjct: 362 GERLPCAHRERPIEENLAEFR-NMRDGKYAPGEAILRMKQDLSSPSPQMWDLVAYRVLNA 420

Query: 367 PHHRTGTTWKMYPTYDFCVPIVDAIEGVTHALRTIEYRDRNPQYEWMLDALHLRKVHIWD 426
           PH RTG+ W++YPTYDF   +VD++E +TH+L T E+      YEW+ D +H+ +    +
Sbjct: 421 PHPRTGSKWRIYPTYDFTHCLVDSLENITHSLCTAEFYLSRESYEWLCDQVHVFRPAQRE 480

Query: 427 FARVNFVRTLLSKRKLQWMVDKGCVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSR 486
           + R+N   T+LSKRK+  +V +  V  WDDPR  T        +    + +F+ + G + 
Sbjct: 481 YGRLNITGTVLSKRKIAKLVHEKYVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVTT 540

Query: 487 NVINLEWNLIWAFNKKVIDPVAPRHTAVVKPVKLHLEGDDVPQNPKIEMKLKHKK-NPDV 545
           +  N++     +  +K ++    R   V+ P+++ +  D++P++ +  + + ++   P+ 
Sbjct: 541 STTNIQVVRFESAIRKYLEDTTARLMFVLDPIEVIV--DNLPEDYEELVSIPYRPGTPEF 598

Query: 546 GEKKVIYYKDVLIDQED 562
           GE+ V + K   I++ D
Sbjct: 599 GERTVPFSKRFYIERSD 615

>KAFR0G02610 Chr7 (538902..541286) [2385 bp, 794 aa] {ON} Anc_6.51
           YOR168W
          Length = 794

 Score =  224 bits (570), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 132/381 (34%), Positives = 213/381 (55%), Gaps = 14/381 (3%)

Query: 199 GEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKVEFQDSILED 258
           G+V TRFPPEP+GYLHIGH+KA ++N  +A+ + GK  +RFDDTNP  E  E+ +SI   
Sbjct: 247 GKVHTRFPPEPNGYLHIGHSKAIMVNFGYAKHFGGKCYLRFDDTNPEAEAPEYFESIKRM 306

Query: 259 LDLLGIKGDKITYSSDYFEEMYQLCVQLIKEGKAY---CDDTPTEKMREERMDGI----- 310
           +  LG K  KITYSSDYF+++Y L   LIK  K Y   C     ++ R  + DG      
Sbjct: 307 VSWLGFKPWKITYSSDYFDKLYDLAEFLIKSDKGYICHCTAEEIKRGRGIKEDGTPGGER 366

Query: 311 -ASARRDRSVEENLRIFNEEMKNGTEEGLKNCVRAKIDYKALNKALRDPVIFRCNLTPHH 369
            A A R R +EE+L  F  +MK+G  E  K  +R K D ++ N  + D + +R    PH 
Sbjct: 367 SACAHRSRPIEESLAEF-RKMKDGFYEPGKAILRMKQDLQSPNPQMWDLIAYRVLNAPHP 425

Query: 370 RTGTTWKMYPTYDFCVPIVDAIEGVTHALRTIEYRDRNPQYEWMLDALHLRKVHIWDFAR 429
           RTG  W++YPTYDF   +VD+ E +TH+L T E+      YEW+ D +H+ +    ++ R
Sbjct: 426 RTGDKWRIYPTYDFTHCLVDSFENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQREYGR 485

Query: 430 VNFVRTLLSKRKLQWMVDKGCVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSRNVI 489
           +N   T+LSKRK+  +V+   V  WDDPR  T        +    + +F+ + G + +  
Sbjct: 486 LNITGTILSKRKIAKLVELHHVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVTTSDT 545

Query: 490 NLEWNLIWAFNKKVIDPVAPRHTAVVKPVKLHLEGDDVPQNPKIEMKLKHKKNPDVGEKK 549
           N++        +K ++   PR   ++ P+++ +  D++ ++ +  + + + K    G++ 
Sbjct: 546 NIQVARFETAVRKYLEETTPRLMFILDPIEIIV--DNLAEDYEEIVSIPYSKK--FGDRT 601

Query: 550 VIYYKDVLIDQEDADVVSEGE 570
           V + K + I+++D D  ++ E
Sbjct: 602 VPFTKRIYIERKDFDESADEE 622

>TBLA0G00450 Chr7 complement(90053..92479) [2427 bp, 808 aa] {ON}
           Anc_6.51 YOR168W
          Length = 808

 Score =  223 bits (569), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 129/385 (33%), Positives = 207/385 (53%), Gaps = 15/385 (3%)

Query: 199 GEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKVEFQDSILED 258
           G+V TRFPPEP+GYLHIGH+KA ++N  +A+ + G   +RFDDTNP  E  E+ +SI   
Sbjct: 251 GKVRTRFPPEPNGYLHIGHSKAIMVNFGYAKYHDGVCYLRFDDTNPEAEAPEYFESIKRM 310

Query: 259 LDLLGIKGDKITYSSDYFEEMYQLCVQLIKEGKAYCDDTPTEKMREERM---------DG 309
           +  LG K  KITYSSDYF+++Y+L   LI   K Y      E+++  R          D 
Sbjct: 311 VSWLGFKPWKITYSSDYFDKLYELAEVLINNDKGYICHCTAEEIKRGRGIKEDGTPGGDR 370

Query: 310 IASARRDRSVEENLRIFNEEMKNGTEEGLKNCVRAKIDYKALNKALRDPVIFRCNLTPHH 369
            A   R+R +EENL+ F   M++G  +  +  +R K D  + +  + D + +R    PH 
Sbjct: 371 FACVHRNRPIEENLKEFRS-MRDGKYQPGEAILRMKQDLTSPSPQMWDLIAYRVLNAPHP 429

Query: 370 RTGTTWKMYPTYDFCVPIVDAIEGVTHALRTIEYRDRNPQYEWMLDALHLRKVHIWDFAR 429
           RTGT WK+YPTYDF   +VD+ E +TH+L T E+      YEW+ D +H+ +    ++ R
Sbjct: 430 RTGTKWKIYPTYDFTHCLVDSFENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQREYGR 489

Query: 430 VNFVRTLLSKRKLQWMVDKGCVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSRNVI 489
           +N   T+LSKRK+  +V++  V  WDDPR  T        +    + +F+ + G + +  
Sbjct: 490 LNITGTVLSKRKIAKLVEEKYVRGWDDPRLFTLEAIRRRGVPPGSILSFINTLGVTTSTT 549

Query: 490 NLEWNLIWAFNKKVIDPVAPRHTAVVKPVKLHLE--GDDVPQNPKIEMKLKHKKNPDVGE 547
           N++     +  +K ++   PR   ++ P+++ ++   DD  +   I  +      P+ GE
Sbjct: 550 NIQVTRFESAIRKYLEDSTPRLMFILDPIEVVVDNLADDYEELVSIPYR---PATPEFGE 606

Query: 548 KKVIYYKDVLIDQEDADVVSEGEEL 572
           + V +     I++ D    S  +E 
Sbjct: 607 RNVPFTNKFYIERSDFSEDSSNKEF 631

>NDAI0K02860 Chr11 (646106..648550) [2445 bp, 814 aa] {ON} Anc_6.51
           YOR168W
          Length = 814

 Score =  223 bits (569), Expect = 6e-62,   Method: Compositional matrix adjust.
 Identities = 131/385 (34%), Positives = 208/385 (54%), Gaps = 15/385 (3%)

Query: 199 GEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKVEFQDSILED 258
           G+V TRFPPEP+GYLHIGH+KA ++N  +A+ + G   +RFDDTNP  E  E+ +SI   
Sbjct: 255 GKVRTRFPPEPNGYLHIGHSKAIMVNFGYAKYHDGVCYLRFDDTNPEAEAPEYFESIKRM 314

Query: 259 LDLLGIKGDKITYSSDYFEEMYQLCVQLIKEGKAY---CDDTPTEKMREERMDGI----- 310
           +  LG    KITYSSDYF+++Y L   LI  GK Y   C     ++ R  + DG      
Sbjct: 315 VHWLGFTPWKITYSSDYFDKLYDLAELLINNGKGYICHCTAEEIKRGRGIKEDGTPGGER 374

Query: 311 -ASARRDRSVEENLRIFNEEMKNGTEEGLKNCVRAKIDYKALNKALRDPVIFRCNLTPHH 369
            A   RDR +EENL+ F   M++G  +  +  +R K D  + +  + D + +R     H 
Sbjct: 375 HACKHRDRPIEENLQEF-RNMRDGKYQPGEAILRMKQDLTSPSPQMWDLIAYRVLNAAHP 433

Query: 370 RTGTTWKMYPTYDFCVPIVDAIEGVTHALRTIEYRDRNPQYEWMLDALHLRKVHIWDFAR 429
           RTGT WK+YPTYDF   +VD+ E +TH+L T E+      YEW+ D +H+ +    ++ R
Sbjct: 434 RTGTKWKIYPTYDFTHCLVDSFENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQREYGR 493

Query: 430 VNFVRTLLSKRKLQWMVDKGCVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSRNVI 489
           +N   T+LSKRK+  +VD+  V  WDDPR  T        +    + +F+ + G + +  
Sbjct: 494 LNITGTVLSKRKIAKLVDEKFVRGWDDPRLFTLEAIRRRGVPPGSILSFINTLGVTTSTT 553

Query: 490 NLEWNLIWAFNKKVIDPVAPRHTAVVKPVKLHLE--GDDVPQNPKIEMKLKHKKNPDVGE 547
           N++     +  +K ++   PR   ++ P+++ ++   DD  +   I  +      P+ GE
Sbjct: 554 NIQVVRFESAIRKYLEDTTPRLMFILDPIEVIVDNLSDDYEELVTIPYR---AGTPEFGE 610

Query: 548 KKVIYYKDVLIDQEDADVVSEGEEL 572
           + V +     I++ D   V++ +E 
Sbjct: 611 RTVPFTNKFFIERSDFSEVTDDKEF 635

>Suva_8.223 Chr8 (399431..401896) [2466 bp, 821 aa] {ON} YOR168W
           (REAL)
          Length = 821

 Score =  223 bits (567), Expect = 9e-62,   Method: Compositional matrix adjust.
 Identities = 130/375 (34%), Positives = 205/375 (54%), Gaps = 15/375 (4%)

Query: 199 GEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKVEFQDSILED 258
           G+V TRFPPEP+GYLHIGH+KA ++N  +A+ + G   +RFDDTNP KE  E+ +SI   
Sbjct: 250 GKVRTRFPPEPNGYLHIGHSKAIMVNFGYAKYHDGTCYLRFDDTNPEKEAPEYFESIKRM 309

Query: 259 LDLLGIKGDKITYSSDYFEEMYQLCVQLIKEGKAY---CDDTPTEKMREERMDG------ 309
           +  LG +  KITYSSDYF+E+Y+L   LI   K Y   C     ++ R  + DG      
Sbjct: 310 VSWLGFEPWKITYSSDYFDELYRLAEVLINNDKGYICHCTAEEIKRGRGIKEDGTPGGER 369

Query: 310 IASARRDRSVEENLRIFNEEMKNGTEEGLKNCVRAKIDYKALNKALRDPVIFRCNLTPHH 369
            A   RD+ +E NL+ F   M++G  +  +  +R K D  + +  + D + +R    PH 
Sbjct: 370 FACKHRDQPIELNLQEF-RNMRDGKYKPGEAILRMKQDLSSPSPQMWDLIAYRVLNAPHP 428

Query: 370 RTGTTWKMYPTYDFCVPIVDAIEGVTHALRTIEYRDRNPQYEWMLDALHLRKVHIWDFAR 429
           RTGT WK+YPTYDF   +VD++E +TH+L T E+      YEW+ D +H+ +    ++ R
Sbjct: 429 RTGTKWKIYPTYDFTHCLVDSMENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQREYGR 488

Query: 430 VNFVRTLLSKRKLQWMVDKGCVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSRNVI 489
           +N   T+LSKRK+  +VD+  V  WDDPR  T        +    + +F+ + G + +  
Sbjct: 489 LNITGTVLSKRKIAQLVDEKFVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVTTSTT 548

Query: 490 NLEWNLIWAFNKKVIDPVAPRHTAVVKPVKLHLE--GDDVPQNPKIEMKLKHKKNPDVGE 547
           N++     +  +K ++   PR   V+ P+++ ++   DD  +   I  +      P  GE
Sbjct: 549 NIQVVRFESAIRKYLEDTTPRLMFVLDPIEVVVDNLADDFEELATIPYR---PGTPAFGE 605

Query: 548 KKVIYYKDVLIDQED 562
           + V +     I++ D
Sbjct: 606 RTVPFTNKFYIERSD 620

>KLTH0C10340g Chr3 (857898..860300) [2403 bp, 800 aa] {ON} highly
           similar to uniprot|P13188 Saccharomyces cerevisiae
           YOR168W GLN4 Glutamine tRNA synthetase monomeric class I
           tRNA synthetase that catalyzes the specific
           glutaminylation of tRNA(Glu) N-terminal domain proposed
           to be involved in enzyme-tRNA interactions
          Length = 800

 Score =  222 bits (566), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 131/384 (34%), Positives = 216/384 (56%), Gaps = 13/384 (3%)

Query: 199 GEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKVEFQDSILED 258
           G+V TRFPPEP+GYLHIGH+KA ++N  +A+   G   +RFDDTNP  E  E+ +SI   
Sbjct: 245 GKVRTRFPPEPNGYLHIGHSKAIMVNFGYAKHNDGVCYLRFDDTNPEAEAPEYFESIKSM 304

Query: 259 LDLLGIKGDKITYSSDYFEEMYQLCVQLIKEGKAYCDDTPTEKMREER---MDGI----- 310
           +  LG K  KITYSSDYF+++Y+L  +LI  GKAY      E+++  R    DG      
Sbjct: 305 VSWLGFKPWKITYSSDYFDKLYELAEKLITNGKAYVCHCTAEEIKRGRGIKEDGTPGGER 364

Query: 311 -ASARRDRSVEENLRIFNEEMKNGTEEGLKNCVRAKIDYKALNKALRDPVIFRCNLTPHH 369
            A   R RSVEENL  F  +M++G  +  +  +R K D ++ +  + D + +R     H 
Sbjct: 365 HACVHRGRSVEENLAEFR-KMRDGAYKPGEATLRMKQDLESPSPQMWDLIAYRVLNASHP 423

Query: 370 RTGTTWKMYPTYDFCVPIVDAIEGVTHALRTIEYRDRNPQYEWMLDALHLRKVHIWDFAR 429
           RTG  WK+YPTYDF   +VD+ E +TH+L T E+      YEW+ D +H+ +    ++ R
Sbjct: 424 RTGDKWKIYPTYDFTHCLVDSFENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQREYGR 483

Query: 430 VNFVRTLLSKRKLQWMVDKGCVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSRNVI 489
           +N   T+LSKRK+  +V++  V  W+DPR  T        +    + +F+ + G + +  
Sbjct: 484 LNITGTILSKRKIAKLVNEHYVRGWNDPRLFTLEAIRRRGVPPGAILSFINTLGVTTSTT 543

Query: 490 NLEWNLIWAFNKKVIDPVAPRHTAVVKPVKLHLEGDDVPQNPKIEMKLKHKK-NPDVGEK 548
           N++     +  +K ++   PR   V+ PV++ +  D++P++ +  + + ++   P+ GE+
Sbjct: 544 NIQVVRFESAIRKYLEDNTPRLMMVLDPVEVVV--DNLPEDYEELVTVPYRPGTPEFGER 601

Query: 549 KVIYYKDVLIDQEDADVVSEGEEL 572
           +V +     I++ D    ++ +E 
Sbjct: 602 QVPFTGKFYIERSDFSEATDDKEF 625

>CAGL0L04532g Chr12 (524088..526475) [2388 bp, 795 aa] {ON} highly
           similar to uniprot|P13188 Saccharomyces cerevisiae
           YOR168w GLN4
          Length = 795

 Score =  222 bits (565), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 129/384 (33%), Positives = 216/384 (56%), Gaps = 13/384 (3%)

Query: 199 GEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKVEFQDSILED 258
           G+V TRFPPEP+GYLHIGH+KA ++N  +A+ + G   +RFDDTNP  E  E+ +SI   
Sbjct: 241 GKVHTRFPPEPNGYLHIGHSKAIMVNFGYAKYHDGVCYLRFDDTNPEAEAPEYFESIKRM 300

Query: 259 LDLLGIKGDKITYSSDYFEEMYQLCVQLIKEGKAYCDDTPTEKMREER---MDGI----- 310
           +  LG K  K+TYSSDYF+++Y+L   LIK GK Y      E+++  R    DG      
Sbjct: 301 VSWLGFKPWKVTYSSDYFDKLYELAEVLIKNGKGYVCHCTAEEIKRGRGIKEDGTPGGER 360

Query: 311 -ASARRDRSVEENLRIFNEEMKNGTEEGLKNCVRAKIDYKALNKALRDPVIFRCNLTPHH 369
            A   RD+SVE+NL  F   M++G  +  +  +R K + ++ +  + D + +R    PH 
Sbjct: 361 HACKHRDQSVEKNLEEFRA-MRDGKYKPGEAILRMKQNLESPSPQMWDLIAYRVLNAPHP 419

Query: 370 RTGTTWKMYPTYDFCVPIVDAIEGVTHALRTIEYRDRNPQYEWMLDALHLRKVHIWDFAR 429
           RTGT WK+YPTYDF   +VD+ E +TH+L T E+      YEW+ D +H+ +    ++ R
Sbjct: 420 RTGTKWKIYPTYDFTHCLVDSFENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQREYGR 479

Query: 430 VNFVRTLLSKRKLQWMVDKGCVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSRNVI 489
           +N   T+LSKRK+  +VD+  V  WDDPR  T        +    + +F+ + G + +  
Sbjct: 480 LNITGTVLSKRKIAKLVDEHFVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVTTSTT 539

Query: 490 NLEWNLIWAFNKKVIDPVAPRHTAVVKPVKLHLEGDDVPQNPKIEMKLKHKKNP-DVGEK 548
           N++     +  +K ++   PR   ++ P+++ +E  ++P++ +  + + ++    + G++
Sbjct: 540 NIQVVRFESAIRKYLEDSTPRLMMILDPIEVVVE--NLPEDYEELVTIPYRAGTKEFGDR 597

Query: 549 KVIYYKDVLIDQEDADVVSEGEEL 572
            V +     I++ D    +E +E 
Sbjct: 598 NVPFTNKFYIERADFSENTEDKEF 621

>KLLA0F20449g Chr6 (1898253..1900667) [2415 bp, 804 aa] {ON} highly
           similar to uniprot|P13188 Saccharomyces cerevisiae
           YOR168W GLN4 Glutamine tRNA synthetase monomeric class I
           tRNA synthetase that catalyzes the specific
           glutaminylation of tRNA(Glu) N-terminal domain proposed
           to be involved in enzyme-tRNA interactions
          Length = 804

 Score =  221 bits (563), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 123/324 (37%), Positives = 184/324 (56%), Gaps = 10/324 (3%)

Query: 196 AKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKVEFQDSI 255
           A  G+V TRFPPEP+GYLHIGH+KA ++N  FA+ + G   +RFDDTNP  E  E+ +SI
Sbjct: 246 ATGGKVHTRFPPEPNGYLHIGHSKAIMVNFGFAKYHNGVCYLRFDDTNPEAEAPEYFESI 305

Query: 256 LEDLDLLGIKGDKITYSSDYFEEMYQLCVQLIKEGKAY---CDDTPTEKMREERMDGI-- 310
              +  LG K  K TYSSDYF+E+YQL   LIK GKAY   C     ++ R  + DG   
Sbjct: 306 KSMVSWLGFKPWKTTYSSDYFDELYQLAETLIKNGKAYVCHCSAEEIKRGRGIKEDGTPG 365

Query: 311 ----ASARRDRSVEENLRIFNEEMKNGTEEGLKNCVRAKIDYKALNKALRDPVIFRCNLT 366
               A   R+R +EE+L  F  +M++G  +  +  +R K D  + +  + D + +R    
Sbjct: 366 GERKACVSRERPIEESLTEFR-KMRDGFYKPGEAILRMKQDLNSPSPQMWDLIAYRVLDA 424

Query: 367 PHHRTGTTWKMYPTYDFCVPIVDAIEGVTHALRTIEYRDRNPQYEWMLDALHLRKVHIWD 426
           PH RTG  WK+YPTYDF   +VD++E +TH+L T E+      YEW+ D +H+ +    +
Sbjct: 425 PHPRTGDKWKIYPTYDFTHCLVDSLENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQRE 484

Query: 427 FARVNFVRTLLSKRKLQWMVDKGCVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSR 486
           + R+N   T+LSKRK+  +V  G VS W+DPR  T        +    + +F+ + G + 
Sbjct: 485 YGRLNITGTVLSKRKIAKLVTGGYVSGWNDPRLFTLEAIRRRGVPPGAILSFINTLGVTT 544

Query: 487 NVINLEWNLIWAFNKKVIDPVAPR 510
           +  N++     +  +K ++   PR
Sbjct: 545 STTNIQVVRFESAIRKYLEDTTPR 568

>TPHA0J00550 Chr10 complement(123101..125527) [2427 bp, 808 aa] {ON}
           Anc_6.51 YOR168W
          Length = 808

 Score =  218 bits (554), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 119/337 (35%), Positives = 188/337 (55%), Gaps = 10/337 (2%)

Query: 196 AKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKVEFQDSI 255
           A  G V TRFPPEP+GYLHIGH+KA ++N  +A+ + G   +RFDDTNP  E  E+ +SI
Sbjct: 248 ATGGRVQTRFPPEPNGYLHIGHSKAIMVNFGYAKYWNGVCYLRFDDTNPEAEAPEYFESI 307

Query: 256 LEDLDLLGIKGDKITYSSDYFEEMYQLCVQLIKEGKAY---CDDTPTEKMREERMDGI-- 310
              +  LG K  K+TYSSDYF+++Y+L   LIK  K Y   C     ++ R  + DG   
Sbjct: 308 QRMVSWLGFKPWKVTYSSDYFDKLYELAEVLIKNDKGYICHCTAEEIKRGRGIKEDGTPG 367

Query: 311 ----ASARRDRSVEENLRIFNEEMKNGTEEGLKNCVRAKIDYKALNKALRDPVIFRCNLT 366
               A   RDR +EE+L+ F   M+ G  +  +  +R K D  + +  + D + +R   +
Sbjct: 368 GERSACKHRDRPIEESLQEFRN-MREGKYQPGEAILRMKQDLTSPSPQMWDLIAYRVLNS 426

Query: 367 PHHRTGTTWKMYPTYDFCVPIVDAIEGVTHALRTIEYRDRNPQYEWMLDALHLRKVHIWD 426
           PH RTG  WK+YPTYDF   +VD+ E ++H+L T E+      YEW+ D +H+ +    +
Sbjct: 427 PHPRTGDKWKIYPTYDFTHCLVDSFENISHSLCTTEFYLSRESYEWLCDQVHVFRPAQRE 486

Query: 427 FARVNFVRTLLSKRKLQWMVDKGCVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSR 486
           + R+N   T+LSKRK+  +V+   V  WDDPR  T        +    + +F+ + G + 
Sbjct: 487 YGRLNITGTVLSKRKIAKLVEGSYVRGWDDPRLYTLEAIRRRGIPPGAILSFINTLGVTT 546

Query: 487 NVINLEWNLIWAFNKKVIDPVAPRHTAVVKPVKLHLE 523
           +  N++     +  +K ++   PR   ++ P+++ +E
Sbjct: 547 STTNIQVARFESAIRKFLEDTTPRLMFILDPIEVIVE 583

>Ecym_3135 Chr3 (250906..253320) [2415 bp, 804 aa] {ON} similar to
           Ashbya gossypii AGR259C
          Length = 804

 Score =  214 bits (546), Expect = 6e-59,   Method: Compositional matrix adjust.
 Identities = 124/377 (32%), Positives = 210/377 (55%), Gaps = 13/377 (3%)

Query: 196 AKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKVEFQDSI 255
           A  G V TRFPPEP+GYLHIGH+KA ++N  +A+ + G   +RFDDTNP  E  E+ +SI
Sbjct: 248 ATGGRVQTRFPPEPNGYLHIGHSKAIMVNFGYAKYHNGICYLRFDDTNPEAEAPEYFESI 307

Query: 256 LEDLDLLGIKGDKITYSSDYFEEMYQLCVQLIKEGKAY---CDDTPTEKMREERMDGI-- 310
              +  LG K  KITYSSDYF+++Y L   LI+  K Y   C     ++ R  + DG   
Sbjct: 308 ERMVTWLGFKPWKITYSSDYFDQLYDLAEVLIQNNKGYVCHCTGEEIKRGRGIKEDGTPG 367

Query: 311 ----ASARRDRSVEENLRIFNEEMKNGTEEGLKNCVRAKIDYKALNKALRDPVIFRCNLT 366
               + + R+RS+ ENL  F  +M++G  +  +  +R K D  + +  + D + +R    
Sbjct: 368 GERKSCSHRERSITENLAAF-RKMRDGFYKPGEAILRMKQDLNSPSPQMWDLIAYRVLDA 426

Query: 367 PHHRTGTTWKMYPTYDFCVPIVDAIEGVTHALRTIEYRDRNPQYEWMLDALHLRKVHIWD 426
           PH RTG+ WK+YPTYDF   +VD+ E +TH+L T E+      YEW+ D +H+ +    +
Sbjct: 427 PHPRTGSKWKIYPTYDFTHCLVDSFENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQRE 486

Query: 427 FARVNFVRTLLSKRKLQWMVDKGCVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSR 486
           + R+N   T+LSKRK+  +V++  V  WDDPR  T        +    + +F+ + G + 
Sbjct: 487 YGRLNITGTVLSKRKIARLVNEKYVRGWDDPRLFTLEAIRRRGIPPGAILSFINTLGVTT 546

Query: 487 NVINLEWNLIWAFNKKVIDPVAPRHTAVVKPVKLHLEGDDVPQNPKIEMKLKHKK-NPDV 545
              N++     +  +K ++    R   ++ P+++ +  +++P++ +  + + ++   P+ 
Sbjct: 547 TTTNIQVVRFESAIRKYLEDTTARLMFLLDPIEVVV--NNLPEDYQELVTIPYRPGTPEF 604

Query: 546 GEKKVIYYKDVLIDQED 562
           G++ V + K   I++ D
Sbjct: 605 GDRTVPFTKRFYIERTD 621

>KNAG0L00620 Chr12 complement(92148..93701) [1554 bp, 517 aa] {ON}
           Anc_7.100 YOL033W
          Length = 517

 Score = 85.1 bits (209), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 68/232 (29%), Positives = 102/232 (43%), Gaps = 26/232 (11%)

Query: 198 IGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKVEFQDSILE 257
           +  VVTRF P P+G LH+G  + AL N   A+   GK I+R +DT+  +   E + +IL+
Sbjct: 38  VAPVVTRFAPSPTGLLHLGSLRTALYNYLLAKNTGGKFILRLEDTDRKRYHAEAEQNILD 97

Query: 258 DLDLLGIKGDKITY--SSDYFEEMY-QLCVQLIKEGKAY---CDDTPTEKMREERMDGIA 311
            LD   IK D   Y  S    E +Y +   QL+K G AY   C       +REE  D   
Sbjct: 98  TLDWCHIKWDGPMYRQSDRAREGLYTRYAEQLVKGGFAYKCFCSKERLNNLREEGYDRHC 157

Query: 312 SARRDRSVEE------NLRIFNEEMKNGTEEGLKNCVRAKIDYKALNKALRDPVIFRCNL 365
           +   D+ V         +R    E+ +  ++ L   VR  I  +       DPV+ + + 
Sbjct: 158 THLSDQEVNAFQGTPYVIRFKAPEVYDAVDDLLHGSVR--IQPRRDRHGFDDPVLLKSD- 214

Query: 366 TPHHRTGTTWKMYPTYDFCVPIVDAIEGVTHALRTIEYRDRNPQYEWMLDAL 417
                       +PTY     + D + GVTH +R  E+    P++  M  A 
Sbjct: 215 -----------RFPTYHLANVVDDHLMGVTHVIRGEEWLPSTPKHIAMYKAF 255

>NDAI0A08460 Chr1 (1951121..1952710) [1590 bp, 529 aa] {ON}
           Anc_7.100 YOL033W
          Length = 529

 Score = 77.4 bits (189), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 87/352 (24%), Positives = 142/352 (40%), Gaps = 68/352 (19%)

Query: 202 VTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKVEFQDSILEDLDL 261
           +TRF P P+G LH+G  + AL N   A++  GK I+R +DT+ S+   E   +I E L  
Sbjct: 43  ITRFAPSPTGLLHLGSLRTALYNYLLARSTNGKFILRLEDTDQSRIHPEAISNIYETLKW 102

Query: 262 LGIKGDK-ITYSSDYFEEMYQLCVQLIKEGKAY---CDDTPTEKMREERMDGIASARRDR 317
            GI  D+     SD     ++    L+  G AY   C     E++R +  +   S   DR
Sbjct: 103 CGINYDEGFIKQSDRLPIYHKYIKILLDSGAAYHCFCTKDRLEQLRRKNSNTPNSPSYDR 162

Query: 318 S--------VEENL--------RIFNEEMKNGTEEGLKNCVRAKIDYKALNKALRDPVIF 361
           +        VE NL        R+ + +      + L   V  +++ K       DP++ 
Sbjct: 163 NCYHLDTEIVESNLTANLPYTIRLKSPDRYPPFTDLLHGQVDIQLNQKERGVWFDDPILI 222

Query: 362 RCNLTPHHRTGTTWKMYPTYDFCVPIVDAIEGVTHALRTIEYRDRNPQYEWMLDALHLRK 421
           + +             YPTY F   + D + G+TH +R  E+    P++      + L +
Sbjct: 223 KSD------------GYPTYHFANVVDDHLMGITHVIRGEEWLPSTPKH------VALYQ 264

Query: 422 VHIWDFARVNFVRTL-------LSKRKLQWMV----DKGCVS----------NWDDPRFP 460
           +  WD  +   +  L       LSKRK  + V    +KG +            W  PR  
Sbjct: 265 LFGWDMPKFIHIPLLTSIDDKKLSKRKGDFSVLSLKEKGVLPEALVNFCALLGWSPPRDI 324

Query: 461 TXXXXXXXXMT-VEGLRNFVLSQGPSRNVINLEWNLIWAFNK-----KVIDP 506
                    M  +E L N       ++  + +++  +W FNK     K+ DP
Sbjct: 325 AKANHECFTMNEIEKLFNL---NHLTKGNVKVDYKKLWFFNKHFLREKIKDP 373

>NCAS0I00560 Chr9 complement(89020..90603) [1584 bp, 527 aa] {ON}
           Anc_7.100 YOL033W
          Length = 527

 Score = 75.1 bits (183), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 58/221 (26%), Positives = 102/221 (46%), Gaps = 16/221 (7%)

Query: 201 VVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKVEFQDSILEDLD 260
           V+TRF P P+G LH+G  + AL N   A+   GK I+R +DT+ ++   E   +I + L 
Sbjct: 46  VITRFAPSPTGLLHLGSLRTALYNYLLAKNTNGKFILRLEDTDQTRLHPEALKNIFDTLK 105

Query: 261 LLGIKGDKITYSSDYFEEMYQLCV-QLIKEGKAYCDDTPTEKMREERMDGIA--SARRDR 317
              ++ D+          +YQ  + +L+K G AY      E++ + R   +A  S   DR
Sbjct: 106 WCNMEYDEGPIEQSQRLPIYQEYIKKLLKSGHAYYCFCSRERLEQLRTGNMAPGSLSYDR 165

Query: 318 SVEENLRIFNEEMKNGTEEGLKNCVRAKIDYKALNKALRDPVIFRCNLTPHHRTGTTW-- 375
                + +  E +K   ++G+   +R K   +     + D +    N+ P++R G  +  
Sbjct: 166 KC---IHLDEETIKVNLDKGIPYTIRMKSPERY--PLIHDLLHGELNIQPNNREGMWFDD 220

Query: 376 ------KMYPTYDFCVPIVDAIEGVTHALRTIEYRDRNPQY 410
                   +PTY F   + D +  VTH +R  E+    P++
Sbjct: 221 PILIKSDGFPTYHFANVVDDHLMKVTHVIRGEEWLPSTPKH 261

>TBLA0E02180 Chr5 complement(532174..533769) [1596 bp, 531 aa] {ON}
           Anc_7.100 YOL033W
          Length = 531

 Score = 69.3 bits (168), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 67/275 (24%), Positives = 118/275 (42%), Gaps = 48/275 (17%)

Query: 201 VVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKVEFQDSILEDLD 260
           V TRF P P+G LH+G  + AL N   A+   G+ I+R +DT+  +     +++I   L 
Sbjct: 44  VRTRFAPSPTGSLHLGSLRTALYNYLLARNTGGQFILRIEDTDQKRLVKGAEENIYSSLK 103

Query: 261 LL---------GIKGDKITYSSDYFEEMYQLCV-QLIKEGKAY---CDDTPTEKMRE--E 305
            L         GI G    Y       +YQ  + +L+  GKAY   C       ++E  +
Sbjct: 104 WLGLQFDEGPNGINGPYGPYKQSERSSIYQKYINELLDNGKAYRCFCSKERLTGLKESAQ 163

Query: 306 RMDGIASARRDR--------SVEENL--------RIFNEEMKNGTEEGLKNCVRAKIDYK 349
           ++    +A  DR         +EENL        R+ + ++    E+ L   +  +  Y 
Sbjct: 164 KLKPPTTASYDRKCTNLTKSQIEENLKNKVPYTVRLLSPDLYPAFEDLLHGKLNIQPQYN 223

Query: 350 ALNKALRDPVIFRCNLTPHHRTGTTWKMYPTYDFCVPIVDAIEGVTHALRTIEYRDRNPQ 409
           ++++   DPV+ + +              PTY F   + D +  ++H +R  E+    P+
Sbjct: 224 SIDRRFDDPVLMKSD------------NLPTYHFANVVDDHLMKISHVIRGEEWLPSTPK 271

Query: 410 YEWMLDALHLRK---VHIWDFARVNFVRTLLSKRK 441
           +  + +A   +    +HI     +N  +  LSKRK
Sbjct: 272 HIAIYEAFGWKPPKYIHIPLLTTLNDKK--LSKRK 304

>TPHA0L00590 Chr12 complement(100345..102021) [1677 bp, 558 aa] {ON}
           Anc_7.100 YOL033W
          Length = 558

 Score = 68.2 bits (165), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 66/266 (24%), Positives = 120/266 (45%), Gaps = 30/266 (11%)

Query: 201 VVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKVEFQDSILEDLD 260
           V TRF P P+G++H+G  + AL N   A++  G+ ++R +DT+  +     ++ I E L 
Sbjct: 46  VRTRFAPSPTGFMHLGSLRTALYNYLLAKSTGGQFLLRLEDTDQKRLVEGAEEDIYETLK 105

Query: 261 LLGIKGDK-ITYSSDYF--------EEMYQLCVQLIKEG----KAYCDDTPTEKMRE--E 305
             GI+ D+    +S+ +         ++Y   ++++ E     K +C     ++M+E  +
Sbjct: 106 WCGIEYDEGPNVNSEAYGPFRQSERTKIYAKHIKVLLENGDAYKCFCTKERLDEMKESAQ 165

Query: 306 RMDGIASARRDRSVEENLRIFNEEMKNGTEEGLKNCVRAKI--DYKALNKALRDPVIFRC 363
           +++  +SA  DR     L +  EE+K          +R K    Y      L   +  + 
Sbjct: 166 KLNPPSSASYDRHC---LHLNEEEIKQKELLNSPYTIRLKSPEKYPEFEDLLHGKLSIQI 222

Query: 364 NLTPHHRTGTTWKM-----YPTYDFCVPIVDAIEGVTHALRTIEYRDRNPQYEWMLDALH 418
              PH +T     +      PTY F   + D +  +TH +R  E+    P++  M +AL 
Sbjct: 223 QYNPHKKTYDDPILIKSDGLPTYHFANVVDDHLMKITHVIRGEEWLPSTPKHISMYNALG 282

Query: 419 LRK---VHIWDFARVNFVRTLLSKRK 441
            +    +HI     +N  +  LSKRK
Sbjct: 283 WQAPKYIHIPLLTSINDKK--LSKRK 306

>Kpol_1044.12 s1044 complement(21668..23278) [1611 bp, 536 aa] {ON}
           complement(21668..23278) [1611 nt, 537 aa]
          Length = 536

 Score = 67.0 bits (162), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 58/242 (23%), Positives = 106/242 (43%), Gaps = 25/242 (10%)

Query: 198 IGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKVEFQDSILE 257
           I  V TRF P P+G+LH+G  + AL N   A+   G+ ++R +DT+  +   + +++I E
Sbjct: 38  ISPVRTRFAPSPTGFLHLGSLRTALYNYLLAKNTGGQFLLRLEDTDRKRLVKDAEENIYE 97

Query: 258 DLDLLGIKGDK---------ITYSSDYFEEMYQLCV-QLIKEGKAYCDDTPTEKM----- 302
            L   GI  D+           Y      ++YQ  + +L+  G AY    P E++     
Sbjct: 98  SLKWCGIDYDEGPNSQNQQFGPYRQSDRTKIYQKYIDKLLDNGHAYRCFCPKERLDSLRD 157

Query: 303 REERMDGIASARRDRSVEENLRIFNEEMKNGTEEGLKNCVRAKID--YKALNKALRDPVI 360
             +++    +   DR+    L + ++E++N    G+   VR K    Y   +  L   + 
Sbjct: 158 SAQKLQPPTTVSYDRNC---LHLNHDEIQNNINNGVSYTVRMKSPEIYPPFDDLLHGHIN 214

Query: 361 FRCNLTPHHRTGTTWKMY-----PTYDFCVPIVDAIEGVTHALRTIEYRDRNPQYEWMLD 415
            +  +  + R      +      PTY F   I D +  +TH +R  E+    P++  + +
Sbjct: 215 IQPQINSNDRRYDDPILMKSDNLPTYHFANVIDDHLMKITHVIRGEEWLPSTPKHIALYE 274

Query: 416 AL 417
           A 
Sbjct: 275 AF 276

>CAGL0F01133g Chr6 complement(114888..116486) [1599 bp, 532 aa] {ON}
           similar to uniprot|P48525 Saccharomyces cerevisiae
           YOL033w MSE1
          Length = 532

 Score = 66.6 bits (161), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 60/232 (25%), Positives = 99/232 (42%), Gaps = 20/232 (8%)

Query: 201 VVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKVEFQDSILEDLD 260
            VTRF P P+G LH+G  + AL N   A+   GK I+R +DT+ S+ K    D+I   L 
Sbjct: 46  AVTRFAPSPTGMLHLGSLRTALYNYLLAKKTGGKFILRIEDTDRSRLKDGAMDNIYNSLK 105

Query: 261 LLGIKGDKITYSSDYFEEMYQLCV-QLIKEGKAY---CDDTPTEKMREE--RMDGIASAR 314
              +K D+  Y      ++Y+  +  LI+ G+AY   C     + +R+   R+    +  
Sbjct: 106 WCNLKWDEGPYLQSERTDIYRKHINHLIETGRAYRCFCTKERLDDLRQSALRLVPPTNVS 165

Query: 315 RDRSVEENLRIFNEEMKNGTEEGLKNCVRAKIDYKALNKALRDPVIFRCNLTPHHRTG-- 372
            DR       +   E+K+  ++G+   VR K   K       D +  + +L P       
Sbjct: 166 YDRHCA---HLSEGEIKSKLDQGIPFTVRFKAPEKY--PPFEDLLHGKIDLQPQQNPSDI 220

Query: 373 -------TTWKMYPTYDFCVPIVDAIEGVTHALRTIEYRDRNPQYEWMLDAL 417
                       YPTY     I D    ++H +R  E+    P++  + +A 
Sbjct: 221 RYDDPILMKSDNYPTYHLANVIDDHDMKISHVIRGEEWLPSTPKHIALYEAF 272

>Suva_15.134 Chr15 (235964..237571) [1608 bp, 535 aa] {ON} YOL033W
           (REAL)
          Length = 535

 Score = 65.1 bits (157), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 85/380 (22%), Positives = 148/380 (38%), Gaps = 62/380 (16%)

Query: 168 SLQELKKASNSNKKKE-THKANFEIGLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQY 226
           SL  L K+  S K+KE  H +             V TRF P P+G+LH+G  + AL N  
Sbjct: 22  SLSPLNKSLLSKKRKEDVHPST-----------PVRTRFAPSPTGFLHLGSLRTALYNYL 70

Query: 227 FAQAYKGKLIIRFDDTNPSKEKVEFQDSILEDLDLLGIKGDKITYSSDYFEEMYQLCVQ- 285
            A+  KG+ ++R +DT+  +     +++I E L    I  D+        + +Y   V+ 
Sbjct: 71  LARNTKGQFLLRLEDTDQKRLVPGAEENIYEVLKWCKISYDETPVKQSERKSVYDKYVKI 130

Query: 286 LIKEGKAYCDDTPTEKMREERMDGI-----ASARRDRSVEENLRIFNEEMKNGTEEGLKN 340
           L+  G AY      E++ + R   +     + A  DR       +  EE+++   + +  
Sbjct: 131 LLSSGMAYRCFCSKERLNDLRRSAMELKPPSMASYDRCCAH---LAKEEIESKLAQDMPF 187

Query: 341 CVRAKI--DYKALNKALRDPVIFRCNLTPHHRTGTTWKM-----YPTYDFCVPIVDAIEG 393
            VR K    Y      L   +  +  +  + R      +      PTY     + D + G
Sbjct: 188 TVRFKSPEQYPTFTDVLHGEINLQPQVNYNDRRYDDLILVKSDKLPTYHLANVVDDHLMG 247

Query: 394 VTHALRTIEYRDRNPQYEWMLDALHLRKVHIWDFARVNFVRTL-------LSKRK----- 441
           +TH +R  E+    P++  + +A        WD+ +   +  L       LSKRK     
Sbjct: 248 ITHVIRGEEWLPSTPKHIALYNAFG------WDYPKFIHIPLLTTVGDKKLSKRKGDMSI 301

Query: 442 ---------LQWMVDKGCVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSRNVINLE 492
                     + +V+   +  W  PR            ++E L       G ++    ++
Sbjct: 302 SSLKNQGILPEALVNFCALFGWSPPR--DLASKKHECFSMEDLEKLFNLNGLTKGNAKVD 359

Query: 493 WNLIWAFNK-----KVIDPV 507
              +W FNK     ++ DPV
Sbjct: 360 DKKLWFFNKHFLQERISDPV 379

>Ecym_2626 Chr2 (1212098..1213819) [1722 bp, 573 aa] {ON} similar to
           Ashbya gossypii AEL338C
          Length = 573

 Score = 63.5 bits (153), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 79/346 (22%), Positives = 136/346 (39%), Gaps = 61/346 (17%)

Query: 203 TRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKVEFQDSILEDLDLL 262
           TRF P P+G+LH+G  + AL N   A+   G+ ++R +DT+ ++     + ++ +    L
Sbjct: 62  TRFAPSPTGFLHLGSLRTALFNYLLAKKTGGQFLLRLEDTDRTRLVPGSEQNLYDSFKWL 121

Query: 263 GIKGDK-----ITY----SSDYFEEMYQLCVQLIKEGKAYCDDTPTEKMREERMDGIA-- 311
           GI+ D+      TY     SD  E   +   QLI  G AY      E+++  R   +A  
Sbjct: 122 GIQYDEGPGVNETYGPYRQSDRTEIYKKYSDQLISTGHAYRCFCSKERLKGLRDSAMALK 181

Query: 312 ---SARRDR----------------SVEENLRIFNEEMKNGTEEGLKNCVRAKIDYKALN 352
              +   DR                 V   +R+ + E+    E+ L N +  +     ++
Sbjct: 182 PPTNVTYDRHCAKLSKEDIRSKIKMGVPYTIRLKSPEIYEPFEDLLHNEINLQPQINPID 241

Query: 353 KALRDPVIFRCNLTPHHRTGTTWKMYPTYDFCVPIVDAIEGVTHALRTIEYRDRNPQYEW 412
               DP++ + +              PTY F   I D +  +TH +R  E+    P++  
Sbjct: 242 VRYDDPILIKSS------------GLPTYHFAHVIDDHLMEITHVIRGQEWLPATPKHIV 289

Query: 413 MLDALHLRK---VHIWDFARVNFVRTLLSKRK----LQWMVDKG---------CV-SNWD 455
           +  A        +H+   A  N  +  LSKRK    +Q + +KG         CV   W 
Sbjct: 290 LYKAFGWNPPQFIHLPLLASTNNKK--LSKRKGDTNIQQLREKGILPEALINFCVLFGWA 347

Query: 456 DPRFPTXXXXXXXXMTVEGLRNFVLSQGPSRNVINLEWNLIWAFNK 501
            P             ++  L N       ++    L+ + +W FNK
Sbjct: 348 PPSPEDPDRKQSYRFSLAELENLFNLNHLTKGNAKLDESRLWNFNK 393

>KAFR0D01320 Chr4 complement(262226..263770) [1545 bp, 514 aa] {ON}
           Anc_7.100 YOL033W
          Length = 514

 Score = 63.5 bits (153), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 59/231 (25%), Positives = 94/231 (40%), Gaps = 27/231 (11%)

Query: 200 EVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKVEFQDSILEDL 259
            VVTRF P P+G LHIG  + AL N   A++  GK I+R +DT+ ++ K   +  I + L
Sbjct: 39  RVVTRFAPSPTGLLHIGSLRTALYNFLLARSTNGKFILRIEDTDRTRLKSGAEQDICDIL 98

Query: 260 DLLGIKGD-KITYSSDYFEEMYQLCVQLIKEGKAY---CDDTPTEKMREERMDGIASARR 315
           +   +K D      SD      +   +L++ G AY   C       MR    D       
Sbjct: 99  NWCNLKYDVGPIRQSDRIPIYEEYANKLLETGAAYRCFCTKDRLSTMRAHGYDRHCLHLS 158

Query: 316 DRSVEE---------NLRIFNEEMKNGTEEGLKNCVRAKIDYKALNKALRDPVIFRCNLT 366
           D  V            LR+ +    +  ++ L   V   I  +       DP++ + +  
Sbjct: 159 DNDVRRLFDAGHTRPVLRLKSPNKYDSFQDMLHGTV--NIQERKDRVGFDDPILMKSD-- 214

Query: 367 PHHRTGTTWKMYPTYDFCVPIVDAIEGVTHALRTIEYRDRNPQYEWMLDAL 417
                      +PTY F   + D +  VTH +R  E+    P++  +  AL
Sbjct: 215 ----------GFPTYHFANVVDDHLMEVTHVIRGDEWLPSTPKHIALYKAL 255

>YOL033W Chr15 (263475..265085) [1611 bp, 536 aa] {ON}
           MSE1Mitochondrial glutamyl-tRNA synthetase, predicted to
           be palmitoylated
          Length = 536

 Score = 63.5 bits (153), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 59/234 (25%), Positives = 101/234 (43%), Gaps = 24/234 (10%)

Query: 201 VVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKVEFQDSILEDLD 260
           V TRF P P+G+LH+G  + AL N   A+   G+ ++R +DT+  +     +++I E L 
Sbjct: 45  VRTRFAPSPTGFLHLGSLRTALYNYLLARNTNGQFLLRLEDTDQKRLIEGAEENIYEILK 104

Query: 261 LLGIKGDKITYSSDYFEEMYQLCVQ-LIKEGKAYCDDTPTEKMREERMDGI-----ASAR 314
              I  D+        + +Y   V+ L+  GKAY      E++ + R   +     + A 
Sbjct: 105 WCNINYDETPIKQSERKLIYDKYVKILLSSGKAYRCFCSKERLNDLRHSAMELKPPSMAS 164

Query: 315 RDRSVEENLRIFNEEMKNGTEEGLKNCVRAKIDYKALNKALRDPVIFRCNLTPHHRTGTT 374
            DR       +  EE+K+   +G+   VR K   +       D +  + NL P  +    
Sbjct: 165 YDRCCAH---LGEEEIKSKLAQGIPFTVRFKSPERY--PTFTDLLHGQINLQP--QVNFN 217

Query: 375 WKMY-----------PTYDFCVPIVDAIEGVTHALRTIEYRDRNPQYEWMLDAL 417
            K Y           PTY     + D + G+TH +R  E+    P++  + +A 
Sbjct: 218 DKRYDDLILVKSDKLPTYHLANVVDDHLMGITHVIRGEEWLPSTPKHIALYNAF 271

>TDEL0H03500 Chr8 (582143..583747) [1605 bp, 534 aa] {ON} Anc_7.100
           YOL033W
          Length = 534

 Score = 62.0 bits (149), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 59/225 (26%), Positives = 99/225 (44%), Gaps = 25/225 (11%)

Query: 201 VVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKVEFQDSILEDLD 260
           V TRF P P+G LHIG  + AL N   A+  +G+ ++R +DT+ ++     +++I + L 
Sbjct: 41  VRTRFAPSPTGMLHIGSLRTALYNYLLAKNTRGQFLLRLEDTDQNRLIQGAEENIYDSLK 100

Query: 261 LLGIKGDK---------ITYSSDYFEEMYQLCVQ-LIKEGKAY---CDDTPTEKMRE--E 305
             GI+ D+           Y      E+YQ  V  L+K G AY   C     + +RE  +
Sbjct: 101 WCGIEYDEGPGVNDEKFGPYRQSERTEIYQQHVDGLLKSGHAYRCFCSKERLDGLRESAK 160

Query: 306 RMDGIASARRDRSVEENLRIFNEEMKNGTEEGLKNCVRAKID--YKALNKALRDPVIFRC 363
           R+    +   DR  E    +   E++    + + + +R K    Y A +  L   V  + 
Sbjct: 161 RLKPPTTVTYDRKCES---LSQGEIEERLAQQIPHTIRLKAPERYPAFHDLLHGTVDIQP 217

Query: 364 NLTPHHRTGTTWKM-----YPTYDFCVPIVDAIEGVTHALRTIEY 403
            +  + R      +      PTY F   I D +  +TH +R  E+
Sbjct: 218 QVNVNDRRYDDPILIKSDNLPTYHFANVIDDHLMKITHVIRGEEW 262

>Skud_15.122 Chr15 (222353..223951) [1599 bp, 532 aa] {ON} YOL033W
           (REAL)
          Length = 532

 Score = 60.8 bits (146), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 77/325 (23%), Positives = 129/325 (39%), Gaps = 54/325 (16%)

Query: 141 VYVNVSRWYTMLELDPLFSGAHEFLTKSLQELKKASNSNKKKETHKANFEIGLPDAKIGE 200
           + + + R +  L L P        L KSL   K       K++ H ++            
Sbjct: 2   ILLRIPRRFYCLSLKPTKGVGPSSLNKSLLSRKT------KEDIHPSS-----------P 44

Query: 201 VVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKVEFQDSILEDLD 260
           V TRF P P+G+LH+G  + AL N   A+   G+ ++R +DT+  +     +++I + L 
Sbjct: 45  VRTRFAPSPTGFLHLGSLRTALYNYLLARNTNGQFLLRLEDTDQKRLIPGAEENIYDVLK 104

Query: 261 LLGIKGDKITYSSDYFEEMYQLCVQ-LIKEGKAYCDDTPTEKMREERMDGI-----ASAR 314
              I  D+        + +Y   V+ L+  G AY      E++ E R   +     + A 
Sbjct: 105 WCKINYDETAVKQSERKPIYDKYVKILLSSGMAYRCFCSKERLNELRRSAMELKPPSMAS 164

Query: 315 RDRSVEENLRIFNEEMKNGTEEGLKNCVRAKIDYKALNKALRDPVIFRCNLTPHHRTGTT 374
            DR       +  EE+ +   +G+   VR K   K       D +    NL P  +    
Sbjct: 165 YDRCCS---YLGEEEVNSKLSQGMPFTVRFKSPEKY--PLFADLLHGEINLQP--QVNFN 217

Query: 375 WKMY-----------PTYDFCVPIVDAIEGVTHALRTIEYRDRNPQYEWMLDALHLRKVH 423
            + Y           PTY     + D + G+TH +R  E+    P++  + +A       
Sbjct: 218 DRRYDDLILVKSDKLPTYHLANVVDDHLMGITHVIRGEEWLPSTPKHIALYNAFG----- 272

Query: 424 IWD---FARVNFVRTL----LSKRK 441
            WD   F  +  + T+    LSKRK
Sbjct: 273 -WDCPKFIHIPLLTTVGDKKLSKRK 296

>SAKL0B09548g Chr2 (809247..810911) [1665 bp, 554 aa] {ON} similar
           to uniprot|P48525 Saccharomyces cerevisiae YOL033W MSE1
           Mitochondrial glutamyl-tRNA synthetase encoded by a
           nuclear gene
          Length = 554

 Score = 59.3 bits (142), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 57/251 (22%), Positives = 102/251 (40%), Gaps = 49/251 (19%)

Query: 201 VVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKVEFQDSILEDLD 260
           V TRF P P+G LH+G  + AL N   A++  G+ ++R +DT+  +     + +I + L 
Sbjct: 61  VRTRFAPSPTGLLHMGSLRTALYNYLLARSTGGQFLLRLEDTDQKRLVPGAEQNIYDSLK 120

Query: 261 LLGIKGDK---------ITYSSDYFEEMYQLCV-QLIKEGKAY---CDDTPTEKMRE--E 305
             G++ D+           Y      E+YQ  + QL+  G AY   C     + +R   +
Sbjct: 121 WCGVEYDEGPGVNEDKFGPYRQSDRTEIYQHYIKQLLNSGHAYRCFCSKERLDGLRSSAQ 180

Query: 306 RMDGIASARRDRSVEENLRIFNEEMKNGTEEGLKNCVRAKI--DYKALNKALR------- 356
           ++    +A  DR   E   +  +E+    ++G+   VR K    Y      L        
Sbjct: 181 QLQPPTTASYDRHCTE---LTEDEIAENLKKGVPCTVRLKAPKKYPPFEDLLHGQLDMQI 237

Query: 357 ----------DPVIFRCNLTPHHRTGTTWKMYPTYDFCVPIVDAIEGVTHALRTIEYRDR 406
                     DP++ + +              PTY F   + D +  +TH +R  E+   
Sbjct: 238 QINMNDIRYDDPILMKSD------------GLPTYHFANVVDDHLMRITHVIRGEEWLPS 285

Query: 407 NPQYEWMLDAL 417
            P++  + +A 
Sbjct: 286 TPKHIALYNAF 296

>KLLA0F07975g Chr6 complement(746708..748336) [1629 bp, 542 aa] {ON}
           similar to uniprot|P48525 Saccharomyces cerevisiae
           YOL033W MSE1 Mitochondrial glutamyl-tRNA synthetase
           encoded by a nuclear gene
          Length = 542

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 66/275 (24%), Positives = 114/275 (41%), Gaps = 49/275 (17%)

Query: 201 VVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKVEFQDSILEDLD 260
           V TRF P P+G+LH+G  + AL N   A+   G+ ++R +DT+  +     + S+ + L 
Sbjct: 51  VRTRFAPSPTGFLHMGSLRTALYNYLLAKNTGGEFLLRLEDTDQKRLVPGAEQSLYDALK 110

Query: 261 LLGIKGDK--------ITYSSDYFEEMYQLCVQ-LIKEGKAY---CDDTPTEKMREE--- 305
              IK D+          Y      ++YQ  +  L+++G AY   C     + +RE    
Sbjct: 111 WCNIKYDEGPGVNEIYGPYRQSDRTKIYQEYINTLVEKGDAYKCFCSKERLDALRESAQK 170

Query: 306 -------RMDGIASARRDRSVEENLRI---FNEEMKNGTE-EGLKNCVRAKIDYK----A 350
                    D   S   D+ VE NL+    F    K+  +    ++ +  K+D +     
Sbjct: 171 LQPPTTVSYDRHCSKLSDQEVEANLKAGIPFTVRFKSPDKYPPFEDLLHGKLDIQPQVNP 230

Query: 351 LNKALRDPVIFRCNLTPHHRTGTTWKMYPTYDFCVPIVDAIEGVTHALRTIEYRDRNPQY 410
           L+    DP++ + +              PTY F   I D +  +TH +R  E+    P++
Sbjct: 231 LDIRYDDPILMKSD------------NLPTYHFANVIDDHLMKITHVIRGEEWLPSTPKH 278

Query: 411 EWMLDALHLRKVHIWDFARVNFVRTL----LSKRK 441
             + +A      H   +  +  + T     LSKRK
Sbjct: 279 TALYEAYGWTPPH---YVHIPLLTTTSDKKLSKRK 310

>KLTH0D02794g Chr4 complement(270516..272156) [1641 bp, 546 aa] {ON}
           similar to uniprot|P48525 Saccharomyces cerevisiae
           YOL033W MSE1 Mitochondrial glutamyl-tRNA synthetase
           encoded by a nuclear gene
          Length = 546

 Score = 58.9 bits (141), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 55/230 (23%), Positives = 94/230 (40%), Gaps = 25/230 (10%)

Query: 203 TRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKVEFQDSILEDLDLL 262
           TRF P P+G LHIG  + AL N   A++  G  ++R +DT+ ++     + +I E L   
Sbjct: 47  TRFAPSPTGLLHIGSLRTALYNYLLAKSTGGSFLLRLEDTDQNRLVPGAEKNIYESLSWC 106

Query: 263 GIKGDKIT----------YSSDYFEEMYQLCVQLIKEGKAY---CDDTPTEKMRE--ERM 307
           GI  D+              SD  E   Q   +L+  G AY   C     + +RE  +++
Sbjct: 107 GIHYDEGPGVNDKKNGPFRQSDRTEIYQQYTNKLLDSGHAYRCFCTKERLDGLRESAQKL 166

Query: 308 DGIASARRDRSVEENLRIFNEEMKNGTEEGLKNCVRAKID--YKALNKALRDPVIFRCNL 365
               +A  DR       +   E++   ++ +   +R K    Y      L   +  +  +
Sbjct: 167 QPPTTASYDRHCSH---LSEGEIREKLDQKVPFTIRLKSPERYPPFEDLLHGKLDMQPQV 223

Query: 366 TPHHRTG-----TTWKMYPTYDFCVPIVDAIEGVTHALRTIEYRDRNPQY 410
            P+ R             PTY F   + D +  +TH +R  E+    P++
Sbjct: 224 NPNDRRYDDPILVKSDALPTYHFANVVDDHLMDITHVVRGEEWLPSTPKH 273

>Smik_15.132 Chr15 (229667..231274) [1608 bp, 535 aa] {ON} YOL033W
           (REAL)
          Length = 535

 Score = 58.5 bits (140), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 87/377 (23%), Positives = 146/377 (38%), Gaps = 69/377 (18%)

Query: 169 LQELKKASNSNK-KKETHKANFEIGLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYF 227
           L  LKK+  S + KK+ H +     LP      V TRF P P+G LH+G  + AL N   
Sbjct: 23  LSPLKKSLLSKRIKKDIHPS-----LP------VRTRFAPSPTGLLHLGSLRTALYNYLL 71

Query: 228 AQAYKGKLIIRFDDTNPSKEKVEFQDSILEDLDLLGIKGDKITYSSDYFEEMYQLCVQ-L 286
           A+   G+ ++R +DT+  +     +  I + L+   I+ D+        + +Y   V+ L
Sbjct: 72  ARNTNGQFLLRLEDTDQKRLVPGAEKDIYDVLNWCKIEYDETVVRQSERKLVYDKYVKIL 131

Query: 287 IKEGKAYCDDTPTEKMREERMDGI-----ASARRDRSVEENLRIFNEEMKNGTEEGLKNC 341
           +  G AY      E++ + R   +     + A  DR       +  EE+ +   +G+   
Sbjct: 132 LSSGMAYRCFCSKERLNDLRHSAMELKPPSMASYDRCCAH---LKEEEINSNLTQGIPFT 188

Query: 342 VRAKI--DYKALNKALRDPVIFRCNLTPHHRTGTTWKMY-----------PTYDFCVPIV 388
           VR K    Y      L   V    NL P  +     K Y           PTY     + 
Sbjct: 189 VRFKSPEQYPVFTDLLHGEV----NLQP--QVNFNDKRYDDLILVKSDKLPTYHLANVVD 242

Query: 389 DAIEGVTHALRTIEYRDRNPQYEWMLDALHLRKVHIW---DFARVNFVRTL----LSKRK 441
           D + G+TH +R  E+    P++  + +A        W    F  +  + T+    LSKRK
Sbjct: 243 DHLMGITHVIRGEEWLPSTPKHIALYNAFG------WVCPKFIHIPLLTTVGDKKLSKRK 296

Query: 442 --------------LQWMVDKGCVSNWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSRN 487
                          + +++   +  W  PR            ++E L N     G ++ 
Sbjct: 297 GDMSISSLKKQGVLPEALINFCALFGWSPPR--DLASKRHECFSMEELENLFNLNGLTKG 354

Query: 488 VINLEWNLIWAFNKKVI 504
              ++   +W FNK  +
Sbjct: 355 NAKVDDKKLWFFNKHFL 371

>AEL338C Chr5 complement(12870..14471) [1602 bp, 533 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL033W
           (MSE1)
          Length = 533

 Score = 57.8 bits (138), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 52/238 (21%), Positives = 96/238 (40%), Gaps = 42/238 (17%)

Query: 203 TRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKVEFQDSILEDLDLL 262
           TRF P P+GYLH+G  + AL N   A+   G+ ++R +DT+  +   + + +I + L  L
Sbjct: 45  TRFAPSPTGYLHLGSLRTALYNYLLARNTNGQFLLRLEDTDQKRLVSDAEQNIYDTLQWL 104

Query: 263 GIKGDK--------ITYSSDYFEEMYQLCV-QLIKEGKAY---CDDTPTEKMREERM--- 307
           GI+ D+          Y       +Y+    +L+  G AY   C     E +R   M   
Sbjct: 105 GIQFDEGPGVNEVYGPYRQSDRSAIYKAHADKLLASGHAYRCFCSKERLENLRTSAMALQ 164

Query: 308 -----------DGIASARRDRSVEENLRIFNEEMKNGTEEGLKNCVRAKIDYKALNKA-- 354
                        ++    D  +++N+            E  ++ +  ++D +       
Sbjct: 165 PPTNVSYDRECANLSQEHIDHKLDQNVPFTLRFKSPAVYEPFEDLLHGRVDLQPQTNPND 224

Query: 355 LR--DPVIFRCNLTPHHRTGTTWKMYPTYDFCVPIVDAIEGVTHALRTIEYRDRNPQY 410
           +R  DPV+ + +              PTY F   + D +  +TH +R  E+    P++
Sbjct: 225 IRYDDPVLMKSD------------GLPTYHFANVVDDHLMKITHVIRGEEWLPSTPKH 270

>Kwal_26.7202 s26 complement(261450..263153) [1704 bp, 567 aa] {ON}
           YOL033W (MSE1) - Mitochondrial glutamyl-tRNA synthetase
           [contig 47] FULL
          Length = 567

 Score = 55.1 bits (131), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 56/237 (23%), Positives = 102/237 (43%), Gaps = 25/237 (10%)

Query: 203 TRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKVEFQDSILEDLDLL 262
           TRF P P+G LHIG  + AL N   A++  G+ ++R +DT+  +     ++SI E L   
Sbjct: 54  TRFAPSPTGLLHIGSLRTALYNYLLAKSTGGEFLLRLEDTDQKRLVPGAEESIYESLKWC 113

Query: 263 GIKGDKITYSSDY----FEE-----MYQLCV-QLIKEGKAYCDDTPTEKM-----REERM 307
           G+  D+    +D     F +     +YQ  + +L+  G AY    P E++       +++
Sbjct: 114 GLSFDEGPGVNDAEFGPFRQSDRTKIYQSYINKLLDLGVAYRCFCPKERLDNLRDSAQKL 173

Query: 308 DGIASARRDRSVEENLRIFNEEMKNGTEEGLKNCVRAKI--DYKALNKALRDPVIFRCNL 365
               +   DR    +     E+++   ++ +   VR K    Y      L   +  +  +
Sbjct: 174 QPPTTVSYDRHCAHH---STEKIQEQLDQKIPFTVRLKSPQKYPPFEDLLHGSIDMQPQV 230

Query: 366 TPH-HRTGTTWKM----YPTYDFCVPIVDAIEGVTHALRTIEYRDRNPQYEWMLDAL 417
            P+  R      M     PTY F   + D +  +TH +R  E+    P++  + +A 
Sbjct: 231 NPNDMRYDDPILMKSDGLPTYHFANVVDDHLMKITHVVRGEEWLPSTPKHIALYNAF 287

>ZYRO0D05808g Chr4 complement(493474..495075) [1602 bp, 533 aa] {ON}
           similar to uniprot|P48525 Saccharomyces cerevisiae
           YOL033W MSE1 Mitochondrial glutamyl-tRNA synthetase
           encoded by a nuclear gene
          Length = 533

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 55/233 (23%), Positives = 96/233 (41%), Gaps = 42/233 (18%)

Query: 201 VVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKVEFQDSILEDLD 260
           V TRF P P+G LH+G  + AL N   A+   G+ I+R +DT+ S+     +++I + L 
Sbjct: 40  VRTRFAPSPTGLLHMGSLRTALYNYLLAKNTGGQFILRLEDTDQSRLVEGAEENIYDSLR 99

Query: 261 LLGIKGDK--------ITYSSDYFEEMYQLCV-QLIKEGKAY---CDDTPTEKMRE--ER 306
              +  D+          Y      E+Y+  +  L++ G AY   C     E +RE   +
Sbjct: 100 WCKLHYDEGPMVGGPFGPYRQSERTEIYRSYIGTLLESGHAYRCFCPKERLEDLRESARK 159

Query: 307 MDGIASARRDR--------SVEENL--------RIFNEEMKNGTEEGLKNCVRAKIDYKA 350
           +    +A  DR         +++NL        R+   E     ++ L   +  +    A
Sbjct: 160 LQPPTTASYDRHCAHMSPHEIKQNLDNDVAYTIRLRAPEKYPIIQDLLHGTLDIQPQVNA 219

Query: 351 LNKALRDPVIFRCNLTPHHRTGTTWKMYPTYDFCVPIVDAIEGVTHALRTIEY 403
            +    DP++ + +              PTY F   I D +  +TH +R  E+
Sbjct: 220 NDVRYDDPILVKSD------------NLPTYHFANVIDDHLMEITHVIRGEEW 260

>KNAG0C03230 Chr3 (632659..634344) [1686 bp, 561 aa] {ON} Anc_5.527
           YDR422C
          Length = 561

 Score = 32.7 bits (73), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 33/144 (22%), Positives = 55/144 (38%), Gaps = 21/144 (14%)

Query: 18  ELIAARIVNASKADAIKIEFVDDKKAAPATFNGEADSAFSKIINAYQDVFSEGVQGSSEW 77
           EL     VN  K + IK E   + K      NG+ D   ++++N+ QD     +Q   + 
Sbjct: 420 ELFQFDDVNTRKTNDIK-EVRKESKLETLYPNGKFDFTLARVVNSNQDALFASIQKIGKM 478

Query: 78  SKLASEEFIIKNF---------------QKLSGSLAKLDSRLNLRTYILDSFTATPADIA 122
           +   +EE+ +  F               +  SG +  +   +NLR  +    T+   DI 
Sbjct: 479 TTEEAEEYFLTKFKVSDLPIYLNSTYLNKNFSGEVNHIIPHVNLRHLLT---TSIKEDII 535

Query: 123 CWGALRSNGMVGSIIKNKVYVNVS 146
           C G   +    G  I   +Y   S
Sbjct: 536 CVGC--TTRYAGKFITQVIYAPCS 557

>TPHA0E02450 Chr5 (520692..523397) [2706 bp, 901 aa] {ON} Anc_3.554
           YGL233W
          Length = 901

 Score = 32.0 bits (71), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 27/94 (28%), Positives = 45/94 (47%), Gaps = 6/94 (6%)

Query: 522 LEGDDVPQNPKIEMKLKHKKNPDVGEKKVIYYKDVLIDQEDADVVSEGEELTLMDWGNVI 581
           +E +++ QNP I +KL    N +   K+       LID + +D++   E    +DW N  
Sbjct: 636 METENIMQNPDIGIKLSSINNYEESRKQAESQLIELIDNKVSDILETVE----LDW-NAT 690

Query: 582 ITKKNSDGSLVGKLH-LEGDFKKTKLKLTWLADT 614
           +T++  D S+V     LE  F  T + L +   T
Sbjct: 691 VTREEPDFSIVDIAQFLEMMFSSTLVNLPYSVQT 724

>ZYRO0C05368g Chr3 complement(414760..415392) [633 bp, 210 aa] {ON}
           similar to uniprot|P40555 Saccharomyces cerevisiae
           YIL007C
          Length = 210

 Score = 30.8 bits (68), Expect = 8.9,   Method: Composition-based stats.
 Identities = 32/131 (24%), Positives = 59/131 (45%), Gaps = 26/131 (19%)

Query: 83  EEFIIKNFQKLSGSLAKLDSRLNLRTYILDSFTATPADIACWGALRSNGMVGSIIKNKVY 142
           E+ +  N Q+L+   A +DS L     +++ F     D+     +R N     +++N ++
Sbjct: 36  EKELGSNLQRLNDEHADMDSPL-----VVNGFPRDDIDVLQVRLIRRNV---HMLRNDLH 87

Query: 143 VNVSRWYTMLELDPLFSGAHEFLTKSLQELKKASNSNKKKETH-KANFEIGLPDAKIGEV 201
             + R             +HE + +   EL+    +  ++ETH  A+ E  +P AKI EV
Sbjct: 88  KVLER-------------SHELINQHFTELQ----AKTRQETHVAADVEHRIPFAKITEV 130

Query: 202 VTRFPPEPSGY 212
           V   P   +G+
Sbjct: 131 VPASPAAKAGF 141

>Smik_13.232 Chr13 complement(364426..366978) [2553 bp, 850 aa] {ON}
           YMR053C (REAL)
          Length = 850

 Score = 31.6 bits (70), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 36/139 (25%), Positives = 59/139 (42%), Gaps = 12/139 (8%)

Query: 87  IKNFQKLSGSLAKLDSRLNLRTYILDSFTATPADIACWGALRSNGMVGSIIKNKVY---- 142
           I NFQK  G L K  SR+ L    L+      A ++     +   MV S +++ +     
Sbjct: 396 IYNFQKKHG-LNKRKSRVYLDPRTLEKLFEVTAKVSNKDIFKLKKMVTSTVQDIIGKGNP 454

Query: 143 VNVSRWYTMLELDPLFSGAHE----FLTKSLQELKKASNSNKKKETHKANFEIGLPDAKI 198
           +N+S      +L+ L    H      L K     +K S     +E  K N++ G PD +I
Sbjct: 455 INLSHKILTTDLETLIHNIHGGSVGLLWKGKGHPRKCSTDISNEEFLKFNYQRGDPDRQI 514

Query: 199 GE---VVTRFPPEPSGYLH 214
            E   ++ +F  E + Y+ 
Sbjct: 515 RERDILLEKFRLEKTAYVQ 533

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.135    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 79,359,515
Number of extensions: 3713720
Number of successful extensions: 11369
Number of sequences better than 10.0: 82
Number of HSP's gapped: 11631
Number of HSP's successfully gapped: 82
Length of query: 707
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 590
Effective length of database: 40,065,477
Effective search space: 23638631430
Effective search space used: 23638631430
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)