Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0E15136g5.712ON1037103748420.0
Kwal_55.196455.712ON970104424590.0
KLLA0A00396g5.712ON1012106521270.0
NDAI0F002005.712ON1105112621090.0
ZYRO0B16544g5.712ON104486214880.0
KLTH0E00814g5.712ON97444314800.0
NCAS0G001705.712ON103048813971e-176
TDEL0B020805.712ON102546013781e-173
AFR296C5.712ON116946013601e-169
Ecym_40095.712ON151744913351e-162
Kpol_2001.785.712ON40342212321e-160
CAGL0H06721g5.712ON108145612451e-153
TPHA0D046605.712ON104547212091e-148
Smik_11.3625.712ON72144211151e-138
Skud_11.3385.712ON71244111071e-137
YKR098C (UBP11)5.712ON71744310741e-132
Suva_11.3355.712ON72446010671e-131
KAFR0D021605.712ON8464459621e-114
KAFR0H001505.712ON6564949171e-110
Skud_9.125.712ON10644928921e-102
Smik_9.135.712ON10604938861e-102
Suva_9.305.712ON10624898659e-99
YIL156W (UBP7)5.712ON10714948518e-97
CAGL0G02563gsingletonON6314548035e-94
KNAG0L022005.712ON11612718293e-93
TBLA0E017605.712ON12123168295e-93
Kpol_304.65.712ON5624917494e-87
TBLA0F036108.188ON11442782382e-19
KNAG0D019308.188ON9862582265e-18
Smik_4.3078.188ON9292372266e-18
YER144C (UBP5)8.188ON8053082248e-18
TPHA0C027708.188ON9702572241e-17
Suva_2.2288.188ON9272382231e-17
Skud_4.3238.188ON9262382212e-17
TDEL0B042208.188ON8252672202e-17
AFR007W8.188ON8482812193e-17
KAFR0C025908.188ON9782452185e-17
YDR069C (DOA4)8.188ON9262392176e-17
CAGL0G05247g8.188ON9472382123e-16
Kpol_1032.288.188ON8822562087e-16
NDAI0A036808.188ON11162672061e-15
Smik_5.3098.188ON8052662042e-15
CAGL0I06765g8.188ON8872752023e-15
Suva_5.2728.188ON7882822014e-15
NDAI0C059008.188ON8263532014e-15
KLLA0E10275g8.188ON7962592005e-15
Kwal_14.20088.188ON4242881976e-15
Ecym_61848.188ON8512441997e-15
ZYRO0G06798g8.188ON8772581997e-15
KLTH0H07678g8.188ON8612841998e-15
Skud_5.2818.188ON8232791971e-14
NCAS0B042808.188ON9222601943e-14
SAKL0H18986g8.188ON8932651836e-13
KNAG0G015908.188ON6711451523e-09
Skud_2.387.390ON7481241452e-08
Smik_2.497.390ON7451231433e-08
ZYRO0C17908g1.137ON12042061434e-08
Suva_2.507.390ON7501241425e-08
NCAS0A039108.188ON7952431415e-08
YBL067C (UBP13)7.390ON7471241407e-08
KNAG0C035807.390ON7761241398e-08
Smik_10.371.137ON12472741391e-07
YJL197W (UBP12)1.137ON12542451362e-07
ZYRO0B03300g7.390ON8131231334e-07
NCAS0D023905.18ON12111011301e-06
TDEL0C056401.137ON1178951291e-06
Skud_10.221.137ON12552111292e-06
SAKL0C04246g1.137ON12971451292e-06
AFR627C1.137ON12872241282e-06
Kpol_2001.541.137ON12231961273e-06
Suva_6.2761.137ON1256661264e-06
NDAI0E041807.390ON8271311245e-06
NDAI0A016707.390ON8461241229e-06
KNAG0C021801.137ON12312021221e-05
NCAS0E026107.390ON7171241211e-05
KNAG0B023707.390ON7531211211e-05
Kwal_33.136281.137ON1160631192e-05
CAGL0M11198g8.742ON4611071173e-05
Ecym_81401.137ON1264781183e-05
KAFR0F015601.137ON11712021184e-05
Ecym_46857.390ON7781301174e-05
TPHA0P006807.390ON7271421174e-05
NCAS0I031401.137ON1201681174e-05
NDAI0B004801.137ON12531281175e-05
TPHA0E008707.390ON715941165e-05
KLLA0C03476g1.137ON12521951175e-05
Kpol_534.231.369ON496861155e-05
TBLA0J006001.137ON14622221157e-05
Ecym_27171.369ON483831138e-05
TBLA0C012001.369ON503861131e-04
CAGL0I05522g7.390ON724991131e-04
NDAI0I025305.18ON11971011131e-04
CAGL0L01639g1.137ON11472151131e-04
TPHA0A025401.137ON12861201131e-04
KNAG0E012905.18ON11961161122e-04
TDEL0G004105.18ON11861111122e-04
KLTH0F03674g1.137ON1198641122e-04
TPHA0L022905.18ON11931171122e-04
TBLA0D010708.742ON4832621102e-04
SAKL0H04994g8.742ON4541411102e-04
NCAS0B005808.742ON4661131093e-04
KAFR0A042108.742ON4401331093e-04
KLLA0C06974g8.742ON4462331075e-04
NDAI0C059508.202ON1080851076e-04
KLLA0D08459g2.69ON7501151067e-04
CAGL0M13783g5.18ON11961001068e-04
KLTH0D12760g8.742ON4531351059e-04
Suva_13.4955.18ON12301071069e-04
NDAI0F034102.69ON8701371059e-04
Kwal_26.91518.742ON4541051030.001
YER098W (UBP9)7.390ON7541201040.001
CAGL0K10494g1.369ON495881030.001
AEL029W1.369ON446831020.002
YMR304W (UBP15)5.18ON12301081030.002
AEL242W8.540ON613981020.002
Smik_13.4318.742ON4711371010.003
ZYRO0D07062g5.18ON11931151020.003
Klac_YGOB_Anc_5.18b5.18ON1166991020.003
AGL357W5.18ON11661011010.003
AGR139C8.202ON789741010.003
Smik_13.5215.18ON12311081010.003
NCAS0D006001.369ON493851000.003
KLTH0H13354g1.369ON49558990.004
Skud_13.4785.18ON12311081000.004
YMR223W (UBP8)8.742ON471142990.005
Ecym_56715.18ON1176103990.005
Kpol_513.255.18ON1190115990.006
Kpol_1045.417.390ON712122980.007
Smik_5.2447.390ON749120970.008
Suva_13.4078.742ON471142970.008
TBLA0C070205.18ON124728980.008
KNAG0G029308.742ON459102970.008
KLTH0B09944g5.18ON1189115970.009
YFR010W (UBP6)1.369ON49999960.009
Skud_13.3928.742ON473144960.009
Kwal_34.162681.369ON44990960.009
KNAG0A019708.540ON471163960.010
SAKL0H00418g5.18ON1190121970.010
ZYRO0A05962g8.742ON465102950.012
KAFR0I026005.18ON1213132960.013
Ecym_62488.742ON466118950.013
Smik_5.3188.202ON909146950.014
Ecym_55448.202ON83474950.015
CAGL0I06600g8.202ON816143940.019
NCAS0A038408.202ON917141940.020
TBLA0B019308.202ON1019142940.023
KAFR0K018107.390ON71456930.023
TDEL0D024001.369ON49488920.031
NDAI0H035501.369ON50289910.034
Skud_5.2237.390ON748123920.035
Smik_7.3141.369ON49999910.037
TPHA0E017105.443ON128327920.039
Suva_6.831.369ON50089910.040
TBLA0A064705.443ON132030920.043
ZYRO0G01188g1.369ON50030910.044
KAFR0C045201.369ON499110900.055
NDAI0E008108.742ON493113900.058
KNAG0C019401.369ON49988900.058
KLLA0F18700g3.270ON77058900.059
SAKL0G02728g5.443ON123731900.062
Skud_6.941.369ON49987890.063
KLLA0E02377g5.443ON122031900.063
CAGL0A04477g7.390ON77031900.064
Kpol_1018.937.390ON75538890.069
TDEL0C015707.390ON76531890.070
Kpol_1064.488.742ON46699890.073
ZYRO0B11044g8.202ON826141890.075
YPL072W (UBP16)8.540ON499170890.078
KAFR0L017307.390ON70132880.092
KLLA0E20351g7.390ON69734880.099
ZYRO0D03982g8.540ON82181880.100
Skud_15.2865.443ON127871880.11
SAKL0H18656g8.202ON77276880.11
TPHA0A025101.369ON50532870.11
KLLA0A10791g1.369ON48430870.11
YOR124C (UBP2)5.443ON127271880.12
TPHA0J026205.443ON122527880.12
AGR370W7.390ON74027870.14
NDAI0C015505.443ON129539870.15
NDAI0A074103.270ON810234870.15
Kwal_55.213935.443ON123360870.16
TDEL0A016208.202ON795140860.16
Ecym_45145.443ON124627860.17
YER151C (UBP3)8.202ON912145860.17
CAGL0K10252g5.443ON126727860.18
Smik_15.3015.443ON127271860.19
ZYRO0F01276g3.270ON77620850.21
Suva_5.2177.390ON75427850.22
SAKL0F12430g7.390ON75427850.23
Kwal_26.95985.18ON119127850.24
NCAS0I016203.270ON79584850.25
Kpol_1024.448.540ON49682840.26
ZYRO0G01606g5.443ON130530840.29
ACL164C5.443ON138931840.29
SAKL0D10120g1.369ON49230840.30
Kpol_1016.15.443ON125131840.31
CAGL0H10186g3.270ON77820840.32
TDEL0B030608.540ON73481840.32
Kpol_219.1singletonON24956810.36
KLLA0E23387g8.540ON78289830.40
KNAG0J008003.270ON76520830.42
TDEL0D035503.270ON78020830.42
NCAS0C021108.540ON494380820.46
KAFR0D050705.443ON122732830.46
KNAG0B041905.443ON126230830.48
Ecym_11668.540ON69683820.51
Suva_8.1765.443ON127031820.53
TPHA0G005608.742ON463110810.53
KAFR0C004103.270ON76939820.54
SAKL0H10076g8.540ON76781820.57
TBLA0D006207.390ON117129820.60
TDEL0D025805.443ON127226820.60
TDEL0B036708.742ON463106810.62
KLTH0F15862g5.443ON124126820.63
NCAS0A143707.390ON72930810.72
KLLA0E08801g2.307ON77134810.72
Suva_4.2953.270ON782197810.75
Skud_4.1332.307ON78730800.85
Suva_4.1252.307ON79330800.90
Kwal_56.230843.270ON76253800.95
Kwal_27.120308.540ON74998791.3
Kwal_14.19578.202ON44477781.5
Skud_5.2898.202ON910145781.5
NCAS0H021005.443ON126930781.7
Suva_5.2808.202ON905145781.8
Kpol_1062.235.443ON1266111781.8
TBLA0E025703.270ON78519771.9
KLTH0E12540g8.540ON75285771.9
KAFR0E009308.540ON49881772.1
CAGL0H05335g8.540ON48386762.4
SAKL0D03322g3.270ON76520762.5
AFR551W8.742ON469108762.7
KAFR0B023708.202ON829141762.7
KLTH0H07370g8.202ON78175762.8
Skud_16.2098.540ON503107744.0
Smik_16.1638.540ON50172744.4
TBLA0H036008.540ON482394726.5
Smik_2.1893.270ON782190736.8
TPHA0D043508.202ON85476727.0
Kpol_251.73.270ON48020727.2
YOR022C5.604ON71554728.2
NDAI0G007802.307ON48691719.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0E15136g
         (1037 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0E15136g Chr5 complement(1258870..1261983) [3114 bp, 1037 aa...  1869   0.0  
Kwal_55.19645 s55 (62575..65487) [2913 bp, 970 aa] {ON} YIL156W ...   951   0.0  
KLLA0A00396g Chr1 (29717..32755) [3039 bp, 1012 aa] {ON} similar...   823   0.0  
NDAI0F00200 Chr6 (35966..39283) [3318 bp, 1105 aa] {ON} Anc_5.712     816   0.0  
ZYRO0B16544g Chr2 complement(1342476..1345610) [3135 bp, 1044 aa...   577   0.0  
KLTH0E00814g Chr5 (80059..82983) [2925 bp, 974 aa] {ON} similar ...   574   0.0  
NCAS0G00170 Chr7 (22237..25329) [3093 bp, 1030 aa] {ON} Anc_5.712     542   e-176
TDEL0B02080 Chr2 (369534..372611) [3078 bp, 1025 aa] {ON} Anc_5....   535   e-173
AFR296C Chr6 complement(972519..976028) [3510 bp, 1169 aa] {ON} ...   528   e-169
Ecym_4009 Chr4 (19798..24351) [4554 bp, 1517 aa] {ON} similar to...   518   e-162
Kpol_2001.78 s2001 complement(213762..214973) [1212 bp, 403 aa] ...   479   e-160
CAGL0H06721g Chr8 complement(667816..671061) [3246 bp, 1081 aa] ...   484   e-153
TPHA0D04660 Chr4 complement(1017401..1020538) [3138 bp, 1045 aa]...   470   e-148
Smik_11.362 Chr11 complement(623098..625263) [2166 bp, 721 aa] {...   434   e-138
Skud_11.338 Chr11 complement(614651..616789) [2139 bp, 712 aa] {...   431   e-137
YKR098C Chr11 complement(633026..635179) [2154 bp, 717 aa] {ON} ...   418   e-132
Suva_11.335 Chr11 complement(617850..620024) [2175 bp, 724 aa] {...   415   e-131
KAFR0D02160 Chr4 (432966..435506) [2541 bp, 846 aa] {ON} Anc_5.7...   375   e-114
KAFR0H00150 Chr8 (14149..16119) [1971 bp, 656 aa] {ON} Anc_5.712...   357   e-110
Skud_9.12 Chr9 (25211..28402) [3192 bp, 1064 aa] {ON} YIL156W (R...   348   e-102
Smik_9.13 Chr9 (25877..29059) [3183 bp, 1060 aa] {ON} YIL156W (R...   345   e-102
Suva_9.30 Chr9 (41061..42434,42912..44726) [3189 bp, 1062 aa] {O...   337   9e-99
YIL156W Chr9 (48091..51306) [3216 bp, 1071 aa] {ON}  UBP7Ubiquit...   332   8e-97
CAGL0G02563g Chr7 complement(235498..237393) [1896 bp, 631 aa] {...   313   5e-94
KNAG0L02200 Chr12 complement(394140..397625) [3486 bp, 1161 aa] ...   323   3e-93
TBLA0E01760 Chr5 complement(430209..433847) [3639 bp, 1212 aa] {...   323   5e-93
Kpol_304.6 s304 (18386..20071) [1686 bp, 562 aa] {ON} (18386..20...   293   4e-87
TBLA0F03610 Chr6 (890140..893574) [3435 bp, 1144 aa] {ON} Anc_8....    96   2e-19
KNAG0D01930 Chr4 (324705..327665) [2961 bp, 986 aa] {ON} Anc_8.1...    92   5e-18
Smik_4.307 Chr4 complement(551719..554508) [2790 bp, 929 aa] {ON...    92   6e-18
YER144C Chr5 complement(457806..460223) [2418 bp, 805 aa] {ON}  ...    91   8e-18
TPHA0C02770 Chr3 (604690..607602) [2913 bp, 970 aa] {ON} Anc_8.1...    91   1e-17
Suva_2.228 Chr2 complement(385322..388105) [2784 bp, 927 aa] {ON...    91   1e-17
Skud_4.323 Chr4 complement(560596..563376) [2781 bp, 926 aa] {ON...    90   2e-17
TDEL0B04220 Chr2 (747864..750341) [2478 bp, 825 aa] {ON} Anc_8.1...    89   2e-17
AFR007W Chr6 (448632..451178) [2547 bp, 848 aa] {ON} Syntenic ho...    89   3e-17
KAFR0C02590 Chr3 complement(503330..506266) [2937 bp, 978 aa] {O...    89   5e-17
YDR069C Chr4 complement(584939..587719) [2781 bp, 926 aa] {ON}  ...    88   6e-17
CAGL0G05247g Chr7 complement(491024..493867) [2844 bp, 947 aa] {...    86   3e-16
Kpol_1032.28 s1032 complement(57514..60162) [2649 bp, 882 aa] {O...    85   7e-16
NDAI0A03680 Chr1 (837931..841281) [3351 bp, 1116 aa] {ON}              84   1e-15
Smik_5.309 Chr5 complement(462971..465388) [2418 bp, 805 aa] {ON...    83   2e-15
CAGL0I06765g Chr9 (655806..658469) [2664 bp, 887 aa] {ON} simila...    82   3e-15
Suva_5.272 Chr5 complement(429119..431485) [2367 bp, 788 aa] {ON...    82   4e-15
NDAI0C05900 Chr3 complement(1350639..1353119) [2481 bp, 826 aa] ...    82   4e-15
KLLA0E10275g Chr5 (906675..909065) [2391 bp, 796 aa] {ON} simila...    82   5e-15
Kwal_14.2008 s14 (571638..572912) [1275 bp, 424 aa] {ON} YDR069C...    80   6e-15
Ecym_6184 Chr6 (341652..344207) [2556 bp, 851 aa] {ON} similar t...    81   7e-15
ZYRO0G06798g Chr7 (544095..546728) [2634 bp, 877 aa] {ON} some s...    81   7e-15
KLTH0H07678g Chr8 (677217..679802) [2586 bp, 861 aa] {ON} simila...    81   8e-15
Skud_5.281 Chr5 complement(448432..450903) [2472 bp, 823 aa] {ON...    80   1e-14
NCAS0B04280 Chr2 (777104..779872) [2769 bp, 922 aa] {ON} Anc_8.188     79   3e-14
SAKL0H18986g Chr8 (1683752..1686433) [2682 bp, 893 aa] {ON} simi...    75   6e-13
KNAG0G01590 Chr7 complement(354369..356384) [2016 bp, 671 aa] {O...    63   3e-09
Skud_2.38 Chr2 complement(77293..79539) [2247 bp, 748 aa] {ON} Y...    60   2e-08
Smik_2.49 Chr2 complement(87575..89812) [2238 bp, 745 aa] {ON} Y...    60   3e-08
ZYRO0C17908g Chr3 complement(1393864..1397478) [3615 bp, 1204 aa...    60   4e-08
Suva_2.50 Chr2 complement(90700..92952) [2253 bp, 750 aa] {ON} Y...    59   5e-08
NCAS0A03910 Chr1 (791578..793965) [2388 bp, 795 aa] {ON} Anc_8.188     59   5e-08
YBL067C Chr2 complement(93639..95882) [2244 bp, 747 aa] {ON}  UB...    59   7e-08
KNAG0C03580 Chr3 complement(699604..701934) [2331 bp, 776 aa] {O...    58   8e-08
Smik_10.37 Chr10 (61787..65530) [3744 bp, 1247 aa] {ON} YJL197W ...    58   1e-07
YJL197W Chr10 (63805..67569) [3765 bp, 1254 aa] {ON}  UBP12Ubiqu...    57   2e-07
ZYRO0B03300g Chr2 (273903..276344) [2442 bp, 813 aa] {ON} simila...    56   4e-07
NCAS0D02390 Chr4 complement(451930..455565) [3636 bp, 1211 aa] {...    55   1e-06
TDEL0C05640 Chr3 complement(1005536..1009072) [3537 bp, 1178 aa]...    54   1e-06
Skud_10.22 Chr10 (38735..42502) [3768 bp, 1255 aa] {ON} YJL197W ...    54   2e-06
SAKL0C04246g Chr3 (412865..416758) [3894 bp, 1297 aa] {ON} simil...    54   2e-06
AFR627C Chr6 complement(1572814..1576677) [3864 bp, 1287 aa] {ON...    54   2e-06
Kpol_2001.54 s2001 complement(144924..148595) [3672 bp, 1223 aa]...    54   3e-06
Suva_6.276 Chr6 complement(481843..485613) [3771 bp, 1256 aa] {O...    53   4e-06
NDAI0E04180 Chr5 complement(941527..944010) [2484 bp, 827 aa] {O...    52   5e-06
NDAI0A01670 Chr1 complement(368070..370610) [2541 bp, 846 aa] {O...    52   9e-06
KNAG0C02180 Chr3 (429789..433484) [3696 bp, 1231 aa] {ON} Anc_1....    52   1e-05
NCAS0E02610 Chr5 complement(520877..523030) [2154 bp, 717 aa] {O...    51   1e-05
KNAG0B02370 Chr2 complement(463599..465860) [2262 bp, 753 aa] {O...    51   1e-05
Kwal_33.13628 s33 (324581..328063) [3483 bp, 1160 aa] {ON} YJL19...    50   2e-05
CAGL0M11198g Chr13 (1102767..1104152) [1386 bp, 461 aa] {ON} sim...    50   3e-05
Ecym_8140 Chr8 complement(295730..299524) [3795 bp, 1264 aa] {ON...    50   3e-05
KAFR0F01560 Chr6 (310936..314451) [3516 bp, 1171 aa] {ON} Anc_1....    50   4e-05
Ecym_4685 Chr4 complement(1332993..1335329) [2337 bp, 778 aa] {O...    50   4e-05
TPHA0P00680 Chr16 (139640..141823) [2184 bp, 727 aa] {ON} Anc_7....    50   4e-05
NCAS0I03140 Chr9 complement(576993..580598) [3606 bp, 1201 aa] {...    50   4e-05
NDAI0B00480 Chr2 complement(89965..93726) [3762 bp, 1253 aa] {ON...    50   5e-05
TPHA0E00870 Chr5 complement(174245..176392) [2148 bp, 715 aa] {O...    49   5e-05
KLLA0C03476g Chr3 (314815..318573) [3759 bp, 1252 aa] {ON} simil...    50   5e-05
Kpol_534.23 s534 (53632..53653,53786..55254) [1491 bp, 496 aa] {...    49   5e-05
TBLA0J00600 Chr10 (129182..133570) [4389 bp, 1462 aa] {ON} Anc_1...    49   7e-05
Ecym_2717 Chr2 (1388844..1390295) [1452 bp, 483 aa] {ON} similar...    48   8e-05
TBLA0C01200 Chr3 complement(258492..259981,260188..260209) [1512...    48   1e-04
CAGL0I05522g Chr9 complement(521749..523923) [2175 bp, 724 aa] {...    48   1e-04
NDAI0I02530 Chr9 (584472..588065) [3594 bp, 1197 aa] {ON} Anc_5....    48   1e-04
CAGL0L01639g Chr12 (178104..181547) [3444 bp, 1147 aa] {ON} simi...    48   1e-04
TPHA0A02540 Chr1 (543606..547466) [3861 bp, 1286 aa] {ON} Anc_1....    48   1e-04
KNAG0E01290 Chr5 complement(254460..258050) [3591 bp, 1196 aa] {...    48   2e-04
TDEL0G00410 Chr7 complement(82945..86505) [3561 bp, 1186 aa] {ON...    48   2e-04
KLTH0F03674g Chr6 (321662..325258) [3597 bp, 1198 aa] {ON} simil...    48   2e-04
TPHA0L02290 Chr12 (479360..482941) [3582 bp, 1193 aa] {ON} Anc_5...    48   2e-04
TBLA0D01070 Chr4 complement(275843..277294) [1452 bp, 483 aa] {O...    47   2e-04
SAKL0H04994g Chr8 complement(445232..446596) [1365 bp, 454 aa] {...    47   2e-04
NCAS0B00580 Chr2 (86690..88090) [1401 bp, 466 aa] {ON} Anc_8.742       47   3e-04
KAFR0A04210 Chr1 (843659..844981) [1323 bp, 440 aa] {ON} Anc_8.7...    47   3e-04
KLLA0C06974g Chr3 complement(604344..605684) [1341 bp, 446 aa] {...    46   5e-04
NDAI0C05950 Chr3 complement(1361343..1364585) [3243 bp, 1080 aa]...    46   6e-04
KLLA0D08459g Chr4 complement(718046..720298) [2253 bp, 750 aa] {...    45   7e-04
CAGL0M13783g Chr13 (1354198..1357788) [3591 bp, 1196 aa] {ON} si...    45   8e-04
KLTH0D12760g Chr4 (1045108..1046469) [1362 bp, 453 aa] {ON} simi...    45   9e-04
Suva_13.495 Chr13 (857778..861470) [3693 bp, 1230 aa] {ON} YMR30...    45   9e-04
NDAI0F03410 Chr6 complement(820002..822614) [2613 bp, 870 aa] {O...    45   9e-04
Kwal_26.9151 s26 complement(1095026..1096390) [1365 bp, 454 aa] ...    44   0.001
YER098W Chr5 (355466..357730) [2265 bp, 754 aa] {ON}  UBP9Ubiqui...    45   0.001
CAGL0K10494g Chr11 (1023698..1025185) [1488 bp, 495 aa] {ON} hig...    44   0.001
AEL029W Chr5 (580062..581402) [1341 bp, 446 aa] {ON} Syntenic ho...    44   0.002
YMR304W Chr13 (874987..878679) [3693 bp, 1230 aa] {ON}  UBP15Ubi...    44   0.002
AEL242W Chr5 (182610..184451) [1842 bp, 613 aa] {ON} Syntenic ho...    44   0.002
Smik_13.431 Chr13 (700800..702215) [1416 bp, 471 aa] {ON} YMR223...    44   0.003
ZYRO0D07062g Chr4 complement(609322..612903) [3582 bp, 1193 aa] ...    44   0.003
Klac_YGOB_Anc_5.18b Chr3 (1201452..1202573,1202576..1204954) [35...    44   0.003
AGL357W Chr7 (33383..36883) [3501 bp, 1166 aa] {ON} Syntenic hom...    44   0.003
AGR139C Chr7 complement(1010460..1012829) [2370 bp, 789 aa] {ON}...    44   0.003
Smik_13.521 Chr13 (857682..861377) [3696 bp, 1231 aa] {ON} YMR30...    44   0.003
NCAS0D00600 Chr4 (102081..103562) [1482 bp, 493 aa] {ON} Anc_1.3...    43   0.003
KLTH0H13354g Chr8 complement(1165485..1166953,1167017..1167035) ...    43   0.004
Skud_13.478 Chr13 (848446..852141) [3696 bp, 1231 aa] {ON} YMR30...    43   0.004
YMR223W Chr13 (716715..718130) [1416 bp, 471 aa] {ON}  UBP8Ubiqu...    43   0.005
Ecym_5671 Chr5 complement(1362706..1366236) [3531 bp, 1176 aa] {...    43   0.005
Kpol_513.25 s513 (71125..74697) [3573 bp, 1190 aa] {ON} (71125.....    43   0.006
Kpol_1045.41 s1045 complement(95233..97371) [2139 bp, 712 aa] {O...    42   0.007
Smik_5.244 Chr5 (364470..366719) [2250 bp, 749 aa] {ON} YER098W ...    42   0.008
Suva_13.407 Chr13 (697513..698928) [1416 bp, 471 aa] {ON} YMR223...    42   0.008
TBLA0C07020 Chr3 (1694706..1698449) [3744 bp, 1247 aa] {ON} Anc_...    42   0.008
KNAG0G02930 Chr7 (644555..645934) [1380 bp, 459 aa] {ON} Anc_8.7...    42   0.008
KLTH0B09944g Chr2 complement(826050..829619) [3570 bp, 1189 aa] ...    42   0.009
YFR010W Chr6 (165067..166566) [1500 bp, 499 aa] {ON}  UBP6Ubiqui...    42   0.009
Skud_13.392 Chr13 (690758..692179) [1422 bp, 473 aa] {ON} YMR223...    42   0.009
Kwal_34.16268 s34 (268814..270163) [1350 bp, 449 aa] {ON} YFR010...    42   0.009
KNAG0A01970 Chr1 (157670..159085) [1416 bp, 471 aa] {ON} Anc_8.5...    42   0.010
SAKL0H00418g Chr8 (50575..54147) [3573 bp, 1190 aa] {ON} similar...    42   0.010
ZYRO0A05962g Chr1 complement(474545..475942) [1398 bp, 465 aa] {...    41   0.012
KAFR0I02600 Chr9 (525365..529006) [3642 bp, 1213 aa] {ON} Anc_5....    42   0.013
Ecym_6248 Chr6 (468203..469603) [1401 bp, 466 aa] {ON} similar t...    41   0.013
Smik_5.318 Chr5 complement(474889..477618) [2730 bp, 909 aa] {ON...    41   0.014
Ecym_5544 Chr5 (1102256..1104760) [2505 bp, 834 aa] {ON} similar...    41   0.015
CAGL0I06600g Chr9 (639096..641546) [2451 bp, 816 aa] {ON} simila...    41   0.019
NCAS0A03840 Chr1 (780031..782784) [2754 bp, 917 aa] {ON} Anc_8.2...    41   0.020
TBLA0B01930 Chr2 (439859..442918) [3060 bp, 1019 aa] {ON} Anc_8....    41   0.023
KAFR0K01810 Chr11 (375304..377448) [2145 bp, 714 aa] {ON} Anc_7....    40   0.023
TDEL0D02400 Chr4 (467340..467361,467436..468898) [1485 bp, 494 a...    40   0.031
NDAI0H03550 Chr8 complement(865851..867359) [1509 bp, 502 aa] {O...    40   0.034
Skud_5.223 Chr5 (351514..353760) [2247 bp, 748 aa] {ON} YER098W ...    40   0.035
Smik_7.314 Chr7 (526664..528163) [1500 bp, 499 aa] {ON} YFR010W ...    40   0.037
TPHA0E01710 Chr5 (343977..347828) [3852 bp, 1283 aa] {ON} Anc_5....    40   0.039
Suva_6.83 Chr6 complement(143456..144958) [1503 bp, 500 aa] {ON}...    40   0.040
TBLA0A06470 Chr1 (1588461..1592423) [3963 bp, 1320 aa] {ON} Anc_...    40   0.043
ZYRO0G01188g Chr7 (95655..95676,95759..97239) [1503 bp, 500 aa] ...    40   0.044
KAFR0C04520 Chr3 complement(901847..903330,903422..903437) [1500...    39   0.055
NDAI0E00810 Chr5 complement(163826..165307) [1482 bp, 493 aa] {O...    39   0.058
KNAG0C01940 Chr3 complement(375973..377472) [1500 bp, 499 aa] {O...    39   0.058
KLLA0F18700g Chr6 (1718738..1721050) [2313 bp, 770 aa] {ON} simi...    39   0.059
SAKL0G02728g Chr7 complement(223607..227320) [3714 bp, 1237 aa] ...    39   0.062
Skud_6.94 Chr6 complement(173619..175118) [1500 bp, 499 aa] {ON}...    39   0.063
KLLA0E02377g Chr5 complement(218647..222309) [3663 bp, 1220 aa] ...    39   0.063
CAGL0A04477g Chr1 (442089..444401) [2313 bp, 770 aa] {ON} simila...    39   0.064
Kpol_1018.93 s1018 (248094..250361) [2268 bp, 755 aa] {ON} (2480...    39   0.069
TDEL0C01570 Chr3 complement(269169..271466) [2298 bp, 765 aa] {O...    39   0.070
Kpol_1064.48 s1064 (88495..89895) [1401 bp, 466 aa] {ON} (88495....    39   0.073
ZYRO0B11044g Chr2 complement(869260..871740) [2481 bp, 826 aa] {...    39   0.075
YPL072W Chr16 (418512..420011) [1500 bp, 499 aa] {ON}  UBP16Deub...    39   0.078
KAFR0L01730 Chr12 (316860..318965) [2106 bp, 701 aa] {ON} Anc_7....    39   0.092
KLLA0E20351g Chr5 (1810593..1812686) [2094 bp, 697 aa] {ON} simi...    39   0.099
ZYRO0D03982g Chr4 (324687..327152) [2466 bp, 821 aa] {ON} weakly...    39   0.100
Skud_15.286 Chr15 complement(511346..515182) [3837 bp, 1278 aa] ...    39   0.11 
SAKL0H18656g Chr8 (1658629..1660947) [2319 bp, 772 aa] {ON} some...    39   0.11 
TPHA0A02510 Chr1 (536076..536097,536233..537728) [1518 bp, 505 a...    38   0.11 
KLLA0A10791g Chr1 complement(934135..935573,935718..935733) [145...    38   0.11 
YOR124C Chr15 complement(554824..558642) [3819 bp, 1272 aa] {ON}...    39   0.12 
TPHA0J02620 Chr10 complement(580898..584575) [3678 bp, 1225 aa] ...    39   0.12 
AGR370W Chr7 (1416579..1418801) [2223 bp, 740 aa] {ON} Syntenic ...    38   0.14 
NDAI0C01550 Chr3 (327953..331840) [3888 bp, 1295 aa] {ON} Anc_5....    38   0.15 
NDAI0A07410 Chr1 complement(1691853..1694285) [2433 bp, 810 aa] ...    38   0.15 
Kwal_55.21393 s55 (816177..819878) [3702 bp, 1233 aa] {ON} YOR12...    38   0.16 
TDEL0A01620 Chr1 (291670..294057) [2388 bp, 795 aa] {ON} Anc_8.2...    38   0.16 
Ecym_4514 Chr4 complement(1025172..1028912) [3741 bp, 1246 aa] {...    38   0.17 
YER151C Chr5 complement(469686..472424) [2739 bp, 912 aa] {ON}  ...    38   0.17 
CAGL0K10252g Chr11 complement(998144..1001947) [3804 bp, 1267 aa...    38   0.18 
Smik_15.301 Chr15 complement(515941..519759) [3819 bp, 1272 aa] ...    38   0.19 
ZYRO0F01276g Chr6 (102883..105213) [2331 bp, 776 aa] {ON} simila...    37   0.21 
Suva_5.217 Chr5 (329688..331952) [2265 bp, 754 aa] {ON} YER098W ...    37   0.22 
SAKL0F12430g Chr6 (969369..971633) [2265 bp, 754 aa] {ON} simila...    37   0.23 
Kwal_26.9598 s26 complement(1283781..1287356) [3576 bp, 1191 aa]...    37   0.24 
NCAS0I01620 Chr9 complement(299269..301656) [2388 bp, 795 aa] {O...    37   0.25 
Kpol_1024.44 s1024 (118060..119550) [1491 bp, 496 aa] {ON} (1180...    37   0.26 
ZYRO0G01606g Chr7 complement(123893..127810) [3918 bp, 1305 aa] ...    37   0.29 
ACL164C Chr3 complement(67792..71961) [4170 bp, 1389 aa] {ON} Sy...    37   0.29 
SAKL0D10120g Chr4 complement(845029..846491,846566..846581) [147...    37   0.30 
Kpol_1016.1 s1016 (585..4340) [3756 bp, 1251 aa] {ON} (585..4340...    37   0.31 
CAGL0H10186g Chr8 complement(993354..995690) [2337 bp, 778 aa] {...    37   0.32 
TDEL0B03060 Chr2 (545366..547570) [2205 bp, 734 aa] {ON} Anc_8.5...    37   0.32 
Kpol_219.1 s219 (1..750) [750 bp, 249 aa] {ON} (1..750) [750 nt,...    36   0.36 
KLLA0E23387g Chr5 complement(2079405..2081753) [2349 bp, 782 aa]...    37   0.40 
KNAG0J00800 Chr10 complement(134836..137133) [2298 bp, 765 aa] {...    37   0.42 
TDEL0D03550 Chr4 (653772..656114) [2343 bp, 780 aa] {ON} Anc_3.2...    37   0.42 
NCAS0C02110 Chr3 (398702..400186) [1485 bp, 494 aa] {ON} Anc_8.5...    36   0.46 
KAFR0D05070 Chr4 complement(996195..999878) [3684 bp, 1227 aa] {...    37   0.46 
KNAG0B04190 Chr2 (795803..799591) [3789 bp, 1262 aa] {ON} Anc_5....    37   0.48 
Ecym_1166 Chr1 (339106..341196) [2091 bp, 696 aa] {ON} similar t...    36   0.51 
Suva_8.176 Chr8 complement(312595..316407) [3813 bp, 1270 aa] {O...    36   0.53 
TPHA0G00560 Chr7 complement(105403..106794) [1392 bp, 463 aa] {O...    36   0.53 
KAFR0C00410 Chr3 complement(85302..87611) [2310 bp, 769 aa] {ON}...    36   0.54 
SAKL0H10076g Chr8 (863358..865661) [2304 bp, 767 aa] {ON} simila...    36   0.57 
TBLA0D00620 Chr4 complement(159706..163221) [3516 bp, 1171 aa] {...    36   0.60 
TDEL0D02580 Chr4 (493355..497173) [3819 bp, 1272 aa] {ON} Anc_5....    36   0.60 
TDEL0B03670 Chr2 complement(656511..657902) [1392 bp, 463 aa] {O...    36   0.62 
KLTH0F15862g Chr6 (1288742..1292467) [3726 bp, 1241 aa] {ON} sim...    36   0.63 
NCAS0A14370 Chr1 (2830136..2832325) [2190 bp, 729 aa] {ON} Anc_7...    36   0.72 
KLLA0E08801g Chr5 (784991..787306) [2316 bp, 771 aa] {ON} simila...    36   0.72 
Suva_4.295 Chr4 complement(520439..522787) [2349 bp, 782 aa] {ON...    36   0.75 
Skud_4.133 Chr4 (238225..240588) [2364 bp, 787 aa] {ON} YDL122W ...    35   0.85 
Suva_4.125 Chr4 (231011..233392) [2382 bp, 793 aa] {ON} YDL122W ...    35   0.90 
Kwal_56.23084 s56 complement(392398..394686) [2289 bp, 762 aa] {...    35   0.95 
Kwal_27.12030 s27 complement(1056215..1058464) [2250 bp, 749 aa]...    35   1.3  
Kwal_14.1957 s14 (549510..550844) [1335 bp, 444 aa] {ON} YER151C...    35   1.5  
Skud_5.289 Chr5 complement(460660..463392) [2733 bp, 910 aa] {ON...    35   1.5  
NCAS0H02100 Chr8 complement(406897..410706) [3810 bp, 1269 aa] {...    35   1.7  
Suva_5.280 Chr5 complement(441123..443840) [2718 bp, 905 aa] {ON...    35   1.8  
Kpol_1062.23 s1062 (51365..55165) [3801 bp, 1266 aa] {ON} (51365...    35   1.8  
TBLA0E02570 Chr5 complement(646995..649352) [2358 bp, 785 aa] {O...    34   1.9  
KLTH0E12540g Chr5 complement(1111576..1113834) [2259 bp, 752 aa]...    34   1.9  
KAFR0E00930 Chr5 (198914..200410) [1497 bp, 498 aa] {ON} Anc_8.5...    34   2.1  
CAGL0H05335g Chr8 complement(512683..514134) [1452 bp, 483 aa] {...    34   2.4  
SAKL0D03322g Chr4 (270137..272434) [2298 bp, 765 aa] {ON} simila...    34   2.5  
AFR551W Chr6 (1427498..1428907) [1410 bp, 469 aa] {ON} Syntenic ...    34   2.7  
KAFR0B02370 Chr2 complement(460558..463047) [2490 bp, 829 aa] {O...    34   2.7  
KLTH0H07370g Chr8 (655985..658330) [2346 bp, 781 aa] {ON} some s...    34   2.8  
Skud_16.209 Chr16 (389855..391366) [1512 bp, 503 aa] {ON} YPL072...    33   4.0  
Smik_16.163 Chr16 (301703..303208) [1506 bp, 501 aa] {ON} YPL072...    33   4.4  
TBLA0H03600 Chr8 complement(877069..878517) [1449 bp, 482 aa] {O...    32   6.5  
Smik_2.189 Chr2 complement(335612..337960) [2349 bp, 782 aa] {ON...    33   6.8  
TPHA0D04350 Chr4 complement(934597..937161) [2565 bp, 854 aa] {O...    32   7.0  
Kpol_251.7 s251 (12280..13719) [1440 bp, 480 aa] {ON} (12280..13...    32   7.2  
YOR022C Chr15 complement(373710..375857) [2148 bp, 715 aa] {ON} ...    32   8.2  
NDAI0G00780 Chr7 (164452..165912) [1461 bp, 486 aa] {ON}               32   9.2  

>SAKL0E15136g Chr5 complement(1258870..1261983) [3114 bp, 1037 aa]
            {ON} uniprot|Q875P1 Saccharomyces kluyveri UBP7
          Length = 1037

 Score = 1869 bits (4842), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 919/1037 (88%), Positives = 919/1037 (88%)

Query: 1    MECSYTPEYSNELLQFVQDVYAQDIKHYYPXXXXXXXXXXXXHAEYLFESYHMMLKQGNQ 60
            MECSYTPEYSNELLQFVQDVYAQDIKHYYP            HAEYLFESYHMMLKQGNQ
Sbjct: 1    MECSYTPEYSNELLQFVQDVYAQDIKHYYPKLKLEKLIDLLEHAEYLFESYHMMLKQGNQ 60

Query: 61   EDALTAFIIGSFYVYLIIPQSIQFHTRNKSYGIYVDLRKYYQDETSMTNVLLMVTKKVDA 120
            EDALTAFIIGSFYVYLIIPQSIQFHTRNKSYGIYVDLRKYYQDETSMTNVLLMVTKKVDA
Sbjct: 61   EDALTAFIIGSFYVYLIIPQSIQFHTRNKSYGIYVDLRKYYQDETSMTNVLLMVTKKVDA 120

Query: 121  ILCKSRDFDDTKITRKRAYSVPSQALANQLRSLTLNNTDGLEQLPEVSKESDTLTNYADD 180
            ILCKSRDFDDTKITRKRAYSVPSQALANQLRSLTLNNTDGLEQLPEVSKESDTLTNYADD
Sbjct: 121  ILCKSRDFDDTKITRKRAYSVPSQALANQLRSLTLNNTDGLEQLPEVSKESDTLTNYADD 180

Query: 181  YTTIWSAPKLEPDDQLKLALNPPXXXXXXXXXXXXFVMDQHSKKFSIGESSSDEFEPIPT 240
            YTTIWSAPKLEPDDQLKLALNPP            FVMDQHSKKFSIGESSSDEFEPIPT
Sbjct: 181  YTTIWSAPKLEPDDQLKLALNPPSKSSSATSSLSSFVMDQHSKKFSIGESSSDEFEPIPT 240

Query: 241  QEALPMDHATPSEISQRTRHHSIVSSNDTGKSRKDSVESVANIYVQNVDRYNTHRKDSYH 300
            QEALPMDHATPSEISQRTRHHSIVSSNDTGKSRKDSVESVANIYVQNVDRYNTHRKDSYH
Sbjct: 241  QEALPMDHATPSEISQRTRHHSIVSSNDTGKSRKDSVESVANIYVQNVDRYNTHRKDSYH 300

Query: 301  SVYMLNEDDDTNEYDFFQNLSRLQKQYVISCEELMDILQSDERNNVLLVDLRISKRFHNN 360
            SVYMLNEDDDTNEYDFFQNLSRLQKQYVISCEELMDILQSDERNNVLLVDLRISKRFHNN
Sbjct: 301  SVYMLNEDDDTNEYDFFQNLSRLQKQYVISCEELMDILQSDERNNVLLVDLRISKRFHNN 360

Query: 361  HIVAPNLINIDPRDLWDVDRKVPISSDVELEKKMGSYQTFQSRSKFKYIVYYTDMKTFLN 420
            HIVAPNLINIDPRDLWDVDRKVPISSDVELEKKMGSYQTFQSRSKFKYIVYYTDMKTFLN
Sbjct: 361  HIVAPNLINIDPRDLWDVDRKVPISSDVELEKKMGSYQTFQSRSKFKYIVYYTDMKTFLN 420

Query: 421  IDFDYRLVFFQLLYASSSTRLRSPPKALLGDYEQWKTFIGQYAKHHDIVTGDYLFRPYAS 480
            IDFDYRLVFFQLLYASSSTRLRSPPKALLGDYEQWKTFIGQYAKHHDIVTGDYLFRPYAS
Sbjct: 421  IDFDYRLVFFQLLYASSSTRLRSPPKALLGDYEQWKTFIGQYAKHHDIVTGDYLFRPYAS 480

Query: 481  SAKSQKDKVKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQSIPAVHLPP 540
            SAKSQKDKVK                                        QSIPAVHLPP
Sbjct: 481  SAKSQKDKVKPISAPPVPATRPPPPPLPAQAPPALPSQAPPTLPSQAPPTQSIPAVHLPP 540

Query: 541  LPPKSAINLHYSVATGMQPPMPQVTTVSHAHRHRYLSHSKRSQHQHYSPISHQYISVPTI 600
            LPPKSAINLHYSVATGMQPPMPQVTTVSHAHRHRYLSHSKRSQHQHYSPISHQYISVPTI
Sbjct: 541  LPPKSAINLHYSVATGMQPPMPQVTTVSHAHRHRYLSHSKRSQHQHYSPISHQYISVPTI 600

Query: 601  EQSSNVYVSLSITGLRNLGSTCYINSMLQCLFATRKFRDIFLSPKYHDYISKGYIHRAQI 660
            EQSSNVYVSLSITGLRNLGSTCYINSMLQCLFATRKFRDIFLSPKYHDYISKGYIHRAQI
Sbjct: 601  EQSSNVYVSLSITGLRNLGSTCYINSMLQCLFATRKFRDIFLSPKYHDYISKGYIHRAQI 660

Query: 661  SRSFHMLFKKMYMNGGCSVVPSGFLKACNSMRPDFKIPNXXXXXXXXXXXXXXXXXXXXS 720
            SRSFHMLFKKMYMNGGCSVVPSGFLKACNSMRPDFKIPN                    S
Sbjct: 661  SRSFHMLFKKMYMNGGCSVVPSGFLKACNSMRPDFKIPNDQQDTQEFLLFLLDQLHDELS 720

Query: 721  DPEQVANDYPQLLLHDDDNLQVDGKEYDKWFEDSISKNGLSPIDSIFQGQMENCLQCQRC 780
            DPEQVANDYPQLLLHDDDNLQVDGKEYDKWFEDSISKNGLSPIDSIFQGQMENCLQCQRC
Sbjct: 721  DPEQVANDYPQLLLHDDDNLQVDGKEYDKWFEDSISKNGLSPIDSIFQGQMENCLQCQRC 780

Query: 781  GHSSYNYSTFYVLSLAIPTPGTSTFGKTKKVLLEDCINLFTSDEVLSGENAWDCPRCGTS 840
            GHSSYNYSTFYVLSLAIPTPGTSTFGKTKKVLLEDCINLFTSDEVLSGENAWDCPRCGTS
Sbjct: 781  GHSSYNYSTFYVLSLAIPTPGTSTFGKTKKVLLEDCINLFTSDEVLSGENAWDCPRCGTS 840

Query: 841  MSGSGPGEGKAKKKRKFLLPHDHVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMP 900
            MSGSGPGEGKAKKKRKFLLPHDHV                                  MP
Sbjct: 841  MSGSGPGEGKAKKKRKFLLPHDHVNNNRTSRFFKFRSKSRSRSSSPFNSSNGHNSGSSMP 900

Query: 901  GSEKWKSKKLTTIKTFNFITMPPILVIHLSRFFYDLTKKNSTVITYPLILNIVLKNNEVA 960
            GSEKWKSKKLTTIKTFNFITMPPILVIHLSRFFYDLTKKNSTVITYPLILNIVLKNNEVA
Sbjct: 901  GSEKWKSKKLTTIKTFNFITMPPILVIHLSRFFYDLTKKNSTVITYPLILNIVLKNNEVA 960

Query: 961  KYRLYGIVNHFGNLISGHYTSLVNKDLKHEIRHGQQKWYYFDDEVVKQDNNHGDFDAGIA 1020
            KYRLYGIVNHFGNLISGHYTSLVNKDLKHEIRHGQQKWYYFDDEVVKQDNNHGDFDAGIA
Sbjct: 961  KYRLYGIVNHFGNLISGHYTSLVNKDLKHEIRHGQQKWYYFDDEVVKQDNNHGDFDAGIA 1020

Query: 1021 SVSSSDVYVLFYERIYD 1037
            SVSSSDVYVLFYERIYD
Sbjct: 1021 SVSSSDVYVLFYERIYD 1037

>Kwal_55.19645 s55 (62575..65487) [2913 bp, 970 aa] {ON} YIL156W
            (UBP7) - Ubiquitin-specific protease [contig 159] FULL
          Length = 970

 Score =  951 bits (2459), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 520/1044 (49%), Positives = 658/1044 (63%), Gaps = 91/1044 (8%)

Query: 5    YTPEYSNELLQFVQDVYAQDIKHYYPXXXXXXXXXXXXHAEYLFESYHMMLKQGNQEDAL 64
            Y+PEYSNELLQFV++VY QDI HYYP            HAEYLFESY   L+     + L
Sbjct: 5    YSPEYSNELLQFVKEVYTQDIAHYYPRLRLEKLIDLLEHAEYLFESYRRSLEAKQNSELL 64

Query: 65   TAFIIGSFYVYLIIPQSIQFHTRNKSYGIYVDLRKYYQDETSMTNVLLMVTKKVDAILCK 124
            TAF++G FY+YLIIP SIQFH+R+KSY IY DLRKYYQDET+MTNVLLMVT  ++++   
Sbjct: 65   TAFVVGCFYIYLIIPHSIQFHSRDKSYAIYADLRKYYQDETNMTNVLLMVTGVIESV--- 121

Query: 125  SRD-FDDTKITRKRAYSVPSQALANQLRSLTLN--NTDGLEQLPEVSKESDTLTNYADDY 181
            SRD  +  KI RKRAYSVP + L++++++LTL+          PE   E+D         
Sbjct: 122  SRDELESAKIMRKRAYSVPHKKLSDKMQALTLSPETASSTNAGPETDNEND--------- 172

Query: 182  TTIWSAPKLEPDDQLKLALNPPXXXXXXXXXXXXFVMDQHSKKFSIG----ESSSDEFEP 237
            +T+W+AP+LEP+D LK+ L                    + + F +G     SSSD+ E 
Sbjct: 173  STMWTAPELEPNDHLKVNLG--------GHNSSVSSRSSNEQAFKVGNEGNSSSSDDIEM 224

Query: 238  I---PTQEALPMDHATPSEISQRTRHHSIVSSNDTGKSRKDSVES-VANIYVQNVDRYNT 293
                 TQ+  P   + P ++                ++ ++S++S V +IY Q VDRYNT
Sbjct: 225  AVHSTTQDQRPRRSSVPIKV----------------EAPQNSLQSTVDDIYCQKVDRYNT 268

Query: 294  HRKDSYHSVYMLNEDDDTNEYDFFQ-NLSRLQKQYVISCEELMDILQSDERNNVLLVDLR 352
            HRK SYHSV+M  +     EYD F  N +RLQKQ +I+C++L+ IL S+E   +LLVDLR
Sbjct: 269  HRKGSYHSVHMTGD-----EYDSFTFNTARLQKQSIITCDKLLRILDSEEAERLLLVDLR 323

Query: 353  ISKRFHNNHIVAPNLINIDPRDLWDVDRKVPISSDVELEKKMGSYQTFQSRSKFKYIVYY 412
              KRF  NHIVAPNL+N+DP +LWD  +   I  D  LE  +      +  S+FK+IVYY
Sbjct: 324  FIKRFETNHIVAPNLVNLDPMNLWDFAKGRAIEGDAPLE-VLNKNHALKDLSQFKHIVYY 382

Query: 413  TDMKTFLNIDFDYRLVFFQLLYASSSTRLRSPPKALLGDYEQWKTFIGQYAKHHDIVTGD 472
            TDMKTF+ +DFDY+LVFFQ+LY +S+ R+   PK LLG YEQWK F+ +  +    +   
Sbjct: 383  TDMKTFMRLDFDYQLVFFQMLY-TSNWRISCTPKVLLGGYEQWKKFLAKVPQSRVPIKEA 441

Query: 473  YLFRPYASSAKSQKDKVKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQS 532
            +LFR      ++    +                                          S
Sbjct: 442  FLFRLKPGGKETVASAI---------------IHQKASTPLPPSIPPPPPPVEKVSKADS 486

Query: 533  IPAVHLP-PLPPKSAINLHYSVATGMQPPMPQVTTVSHAHRHRYLSHSKRSQHQHYSPIS 591
                  P PLP K  + +  S+ +  +  +P       +H   + +H K  Q++    + 
Sbjct: 487  GSYTRAPFPLPAKEMV-IQSSLDSISRTQIP-------SHLESHYTHEKVLQNK----MH 534

Query: 592  HQYISVPTIEQSSNVYVSLSITGLRNLGSTCYINSMLQCLFATRKFRDIFLSPKYHDYIS 651
            H   ++PTIEQSSN YV+LSITGLRN+G+TCYINSMLQCLFATRKFRD+FLSPKY DY S
Sbjct: 535  HAEGTIPTIEQSSNEYVALSITGLRNMGNTCYINSMLQCLFATRKFRDLFLSPKYEDYFS 594

Query: 652  KGYIHRAQISRSFHMLFKKMYMNGGCSVVPSGFLKACNSMRPDFKIPNXXXXXXXXXXXX 711
            K Y +  Q+S+ F++LFKKMYMNGGCSVVP+GFLKACN++RPD KIP+            
Sbjct: 595  KRYSNPHQLSKYFNILFKKMYMNGGCSVVPTGFLKACNALRPDLKIPHNQQDTQEFLLFL 654

Query: 712  XXXXXXXXSDPEQVANDYPQLLLHDDDNLQVDGKEYDKWFEDSISKNGLSPIDSIFQGQM 771
                    S+   VANDYP LLLHDD++L VD KEYDKWFE +IS+NG+SPID+IFQGQM
Sbjct: 655  LSQLHDELSESNHVANDYPNLLLHDDESLAVDQKEYDKWFESNISENGISPIDAIFQGQM 714

Query: 772  ENCLQCQRCGHSSYNYSTFYVLSLAIPTPGTSTFGKTKKVLLEDCINLFTSDEVLSGENA 831
            EN L CQRCGHSSYNYS FYVLSLAIP    S+FG+ KK+ LEDCINLFTSDE L+ ENA
Sbjct: 715  ENGLLCQRCGHSSYNYSMFYVLSLAIPA-SMSSFGQKKKMRLEDCINLFTSDEKLTNENA 773

Query: 832  WDCPRCGTSMSGSGPGEGKAKKKRKFLLPHDHVXXXXXXXXXXXXXXXXXXXXXXXXXXX 891
            WDCP+CG+++SG+GP +G  KKKRKFL   D+                            
Sbjct: 774  WDCPKCGSAVSGNGP-DGD-KKKRKFLSTSDNSNGRSRSRFFKLRSKSRSRSVSPFHKPS 831

Query: 892  XXXXXXXMPGSEKWKSKKLTTIKTFNFITMPPILVIHLSRFFYDLTKKNSTVITYPLILN 951
                    P SEKWKSKKL+TIKT NF+++P +L IHLSRF YDLT KN+ VITYPL L+
Sbjct: 832  SQS-----PASEKWKSKKLSTIKTLNFVSLPSVLTIHLSRFLYDLTNKNNKVITYPLTLS 886

Query: 952  IVLKNNEVAKYRLYGIVNHFGNLISGHYTSLVNKDLKHEIRHGQQKWYYFDDEVVKQDNN 1011
            IVLKNNEV  YRLY I NHFGNLISGHYTSLVNKDL H++ +G+QKWYYFDDEV K+D N
Sbjct: 887  IVLKNNEVVNYRLYAIANHFGNLISGHYTSLVNKDLSHDLGNGRQKWYYFDDEVAKRDLN 946

Query: 1012 HGDFDAGIASVSSSDVYVLFYERI 1035
            HG+ DAGI SVSSSDVYVLFYE+I
Sbjct: 947  HGNIDAGITSVSSSDVYVLFYEKI 970

>KLLA0A00396g Chr1 (29717..32755) [3039 bp, 1012 aa] {ON} similar to
            uniprot|P40453 Saccharomyces cerevisiae YIL156W UBP7
            Ubiquitin-specific protease that cleaves
            ubiquitin-protein fusions
          Length = 1012

 Score =  823 bits (2127), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 478/1065 (44%), Positives = 617/1065 (57%), Gaps = 92/1065 (8%)

Query: 5    YTPEYSNELLQFVQDVYAQDIKHYYPXXXXXXXXXXXXHAEYLFESYHMMLKQGNQEDAL 64
            YTPEYS+ELL FVQ+VY+QD+KHYY              AE LFESY   L     ED L
Sbjct: 5    YTPEYSDELLSFVQEVYSQDVKHYYAKLKLEKLIELLEQAESLFESYRESLSVEKYEDCL 64

Query: 65   TAFIIGSFYVYLIIPQSIQFHTRNKSYGIYVDLRKYYQDETSMTNVLLMVTKKVDAILCK 124
              ++IGSFYV+LIIP S+QF  RNKSY IY DL+K YQDE +M+NVLLMV  KVD++L +
Sbjct: 65   CEYVIGSFYVFLIIPGSVQFSARNKSYSIYSDLKKLYQDELNMSNVLLMVLHKVDSVLNQ 124

Query: 125  SRDF---DDTKITRKRAYSVPSQALANQLRSLTLNNTDGLEQLPEVSKESDTLTNYADDY 181
            + +         +RKRA+SV    +  QL +L LNN D      + S + D    Y    
Sbjct: 125  NMEILAKQHLDPSRKRAFSVEEPIIRYQLHNLQLNNAD------QKSVDDD----YKSFA 174

Query: 182  TTIWSAPKLEPDDQLKLALNPPXXXXXXXXXXXXF------------VMDQHSKKFSIGE 229
            +T W AP+L+P+D+L LA+                             +D  S K     
Sbjct: 175  STEWKAPQLDPNDRLHLAIASSKTTESSSLNSISLDENLYKEQDDTDALDSVSDKLLGSI 234

Query: 230  SSSDEFEPIPTQEALPMDHATPSEISQRTRHHSIVSSNDTGKSRKDSVESVANIYVQNVD 289
               D  +       +P   + P+E     +HH + + ND+    ++         + + D
Sbjct: 235  HKPDLLDRTGIIRKVPRHQSLPTE-----QHHKLYAQNDSSLMLEN---------MDSFD 280

Query: 290  RYNTHRKDSYHSVYMLNEDDDTNEYDFFQNLSRLQKQYVISCEELMDILQSDE-RNNVLL 348
            R  THRKDSYHSVY+ +E +D N  +    L+R Q++  I C  L  +L+  E R N+LL
Sbjct: 281  RSRTHRKDSYHSVYLGDELEDLN--NISTGLARHQQENTIDCFALFSLLKDAESRENLLL 338

Query: 349  VDLRISKRFHNNHIVAPNLINIDPRDLWDVDRKVPISSDVELEKKMGSYQTFQSRSKFKY 408
            +DLR+ KRF +NH+VAPNL+NIDP  L+D ++   + S  E  KK+ +       S++  
Sbjct: 339  IDLRLPKRFESNHLVAPNLLNIDPCLLFDTEKGTSLES-FEALKKIVANPILDKISQYDN 397

Query: 409  IVYYTDMKTFLNIDFDYRLVFFQLLYASSSTRLRSPPKALLGDYEQWKTFIGQYAKHHDI 468
            IVYYTD K+F+++ F+Y L+ F+LL+  + T +   PK+LLG YEQWK F+ +  +  + 
Sbjct: 398  IVYYTDYKSFMHLTFNYELILFELLFKKTGTAI---PKSLLGGYEQWKAFLNKQLRDSEF 454

Query: 469  VTGDYLFRPYASSAK---SQKDKVKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 525
                +LFR   S+     + K  V+                                   
Sbjct: 455  DKSLFLFRKSKSAPSDKTASKPSVQTDNIIKSSPSILSKEHNDDTLISSTPPIPKVAPPP 514

Query: 526  XXXXXQSIPAV--HLPPLP---PKSAINLHYSVATGMQPPMPQVTTVSHAHRHRYLSHSK 580
                  S P +  + PP+P      A  L  S+A  ++ P     TV             
Sbjct: 515  LPGSPLSAPTIVYNRPPVPLPINSPAPLLKPSIAKELRTPQRNDWTV------------- 561

Query: 581  RSQHQHYSPISHQYISVPTIEQSSNVYVSLSITGLRNLGSTCYINSMLQCLFATRKFRDI 640
            ++QH H         S+PTIE+S N +VSLSITGLRN+G+TCYINSMLQCLF   +FRD+
Sbjct: 562  QTQHLHVP------FSIPTIERSPNEFVSLSITGLRNMGNTCYINSMLQCLFGCSQFRDL 615

Query: 641  FLSPKYHDYISKGYIHRAQISRSFHMLFKKMYMNGGCSVVPSGFLKACNSMRPDFKIPNX 700
            FL  KYH Y++    +   IS+ F +LF+KMY+NGGCSVVP+GFLKAC+ +RPDF IP  
Sbjct: 616  FLGGKYHRYLNPKRSNTI-ISKWFSLLFRKMYLNGGCSVVPNGFLKACHMLRPDFHIPTD 674

Query: 701  XXXXXXXXXXXXXXXXXXXSDPEQVANDYPQLLLHDDDNLQVDGKEYDKWFEDSISKNGL 760
                               S+P +VANDYP LLLHDD+ L VD KEYDKWF++ +  NGL
Sbjct: 675  QQDTQEFLLFLLDTLHDELSEPTKVANDYPNLLLHDDEKLLVDNKEYDKWFDEGLKNNGL 734

Query: 761  SPIDSIFQGQMENCLQCQRCGHSSYNYSTFYVLSLAIPT-PGTSTFGKTKKVL-LEDCIN 818
            SPID IFQGQMEN L+CQRCG +SYNYSTFYVLSLAIP  P   TF ++KK++ LEDCIN
Sbjct: 735  SPIDDIFQGQMENSLKCQRCGFTSYNYSTFYVLSLAIPAMPPPKTFSRSKKIIRLEDCIN 794

Query: 819  LFTSDEVLSGENAWDCPRCGTSMSGSGPGEGKA------KKKRKFL-LPHDHVXXXXXXX 871
            L+T DE+L+GENAWDCP+CGT  S S  G   +      KKK+ FL +  DH        
Sbjct: 795  LYTQDELLTGENAWDCPKCGTH-SNSSDGSMNSDETVDKKKKKNFLSVNGDH-------- 845

Query: 872  XXXXXXXXXXXXXXXXXXXXXXXXXXXMPGSEKWKSKKLTTIKTFNFITMPPILVIHLSR 931
                                        P     KSKK+TTIKT NFITMP ILVIHLSR
Sbjct: 846  KSRSKFFKLSSSRSGKRSLSPFKSNSVKPEKLHIKSKKMTTIKTLNFITMPNILVIHLSR 905

Query: 932  FFYDLTKKNSTVITYPLILNIVLKNNEVAKYRLYGIVNHFGNLISGHYTSLVNKDLKHEI 991
            FFYDLTKKN T+I YPLIL++VLKNNE+A+YRLYGI+NHFGNL+SGHYTSLVNK L HEI
Sbjct: 906  FFYDLTKKNETMINYPLILDVVLKNNEIARYRLYGIINHFGNLVSGHYTSLVNKHLSHEI 965

Query: 992  RHGQQKWYYFDDEVVKQDNNHGDFDAGIASVSSSDVYVLFYERIY 1036
            R GQQKWYYFDDEVVK++ NHGDFD GI S+SS DVYVLFYERI+
Sbjct: 966  RKGQQKWYYFDDEVVKKEFNHGDFDRGITSISSGDVYVLFYERIH 1010

>NDAI0F00200 Chr6 (35966..39283) [3318 bp, 1105 aa] {ON} Anc_5.712
          Length = 1105

 Score =  816 bits (2109), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 486/1126 (43%), Positives = 645/1126 (57%), Gaps = 122/1126 (10%)

Query: 5    YTPEYSNELLQFVQDVYAQDIKHYYPXXXXXXXXXXXXHAEYLFESY-HMMLKQGNQEDA 63
            +TPEYSNELLQ VQ +Y  DIKHYYP            H EYL E +        N +D 
Sbjct: 9    FTPEYSNELLQKVQSIYHDDIKHYYPQLKLEKLLDLLEHTEYLLELFFTYNKNNTNNKDV 68

Query: 64   LTAFIIGSFYVYLIIPQSIQFHTRNKSYGIYVDLRKYYQDETSMTNVLLMVTKKVDAIL- 122
            LTAFI+G +Y++LIIPQSIQF ++NKSYGIY +L+K Y++ET MTNVLLMV  +++ +L 
Sbjct: 69   LTAFIVGCYYLFLIIPQSIQFQSKNKSYGIYTELKKLYENETHMTNVLLMVKDEIENVLD 128

Query: 123  ----CKSRDFDDTKITRKRAYSVPSQALANQLRSLTLNNTDGLEQ--------------- 163
                    D +   I R+RAYS+    L+NQ++SL+++N+   E                
Sbjct: 129  MDENNNGSDLNHRIIKRQRAYSISINELSNQVKSLSISNSIDQEHINNKTETSLTNQPPN 188

Query: 164  ---LP-------EVSKESDTLTNYADDYTTIWSAPKLEPDDQLKLALNPPXXXXXXXXXX 213
               LP       E S E    T++ D  + +W+AP LEP DQLKLA              
Sbjct: 189  HHLLPIILHCDEEFSNEEINATDF-DRASPLWTAPSLEPKDQLKLA-----------YTN 236

Query: 214  XXFVMDQHSKKFSIGESSSDEFEPIPTQEALPMDHAT----PSEISQRTRHHSIVSSN-- 267
                           +S++++F   P Q  +P D+ +    P +I       +I++++  
Sbjct: 237  NTNTKTNTDNNNGQKDSTANDFPFAPIQ--MPFDNGSAPDIPPKIPITKATTNIINNSES 294

Query: 268  ------DTGKSRKDSVESVA---------NIYVQNVDRYNTHRKDSYHSVYMLNE---DD 309
                   T      S+E++           I   N DR + HRKDSYHS+YM+++   D 
Sbjct: 295  ENNVNEGTMPFTTSSLENINNINNINNYKTIEQTNPDRASNHRKDSYHSIYMVDDGSADG 354

Query: 310  DTNEYD---FFQNLSRLQKQYVISCEELMDILQSD-ERNNVLLVDLRISKRFHNNHIVAP 365
             T  YD   +  +L RLQKQ +I+ +EL  IL +  E++ +LL+DLR  KRF +NHIVAP
Sbjct: 355  ITQYYDSNPYIHSLERLQKQCIITAQELFSILSNPIEKSKLLLIDLRFPKRFSSNHIVAP 414

Query: 366  NLINIDPRDLWDVDRKVPISSDVELEKKM---GSYQTFQSRSKFKYIVYYTDMKTFLNID 422
            NLI IDP  LW+     PI     LE  +    + +  Q+R++F+YIV+YTD KT++N +
Sbjct: 415  NLIMIDPMLLWNSKTNTPIYDITTLENLLYEPKARKLLQNRTQFEYIVFYTDNKTYMNTN 474

Query: 423  FDYRLVFFQLLYASSSTR-LRSPPKALLGDYEQWKTFIGQYAKHHDIVTGDYLFRPY--- 478
            FDY   FF LL  S + + ++S P  LLG Y++WK  +  Y++ ++   GDYL++P+   
Sbjct: 475  FDYSFTFFYLLVTSKTNKNIKSAPTHLLGGYDKWKKVLYSYSEQYNFNMGDYLYKPHRHS 534

Query: 479  ASSAKSQKDKVKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQSIPAVHL 538
              S K   D V                                          S     L
Sbjct: 535  GDSIKHHDDLVDSHILQPPSWKPPELPLRMRKRPPPPPPVAIPTPPVPHLLTNST----L 590

Query: 539  PPLPPKS----AINLHYSVATGMQPPMPQVTTVSHAHRHRYLS------------HSKRS 582
            PP+   +     I L     T +       +T S  HR++YL+             ++R 
Sbjct: 591  PPISSTTEQSPGIVLKTKTMTDLH------STKSQQHRNQYLTSYQHQVELARDDETRRK 644

Query: 583  QHQHYSPI---SHQYISVPTIEQSSNVYVSLSITGLRNLGSTCYINSMLQCLFATRKFRD 639
             HQ    +     +  S+PTIE+S N+YVSLSITGLRNLG+TCYINSMLQCLFATR FRD
Sbjct: 645  YHQERESLMLTRSRKFSIPTIEKSPNLYVSLSITGLRNLGNTCYINSMLQCLFATRLFRD 704

Query: 640  IFLSPKYHDYISKG-YIHRAQISRSFHMLFKKMYMNGGCSVVPSGFLKACNSMRPDFKIP 698
            +F+S K+  +I+   + +  +IS SF++LFKKMY+NGGCSVVP+ FLK CN +RPD +IP
Sbjct: 705  LFISSKFQSFINDSKFPNTPKISNSFNLLFKKMYLNGGCSVVPTSFLKTCNILRPDLRIP 764

Query: 699  NXXXXXXXXXXXXXXXXXXXXSDPEQVANDYPQLLLHDDDNLQVDGKEYDKWFEDSISKN 758
            +                    S+ ++V N+YP LLL+D++NL+V  KEY  WF+ ++  N
Sbjct: 765  DDQQDTQEFLMIILDRLHDELSNQQEVVNEYPNLLLYDENNLKVQNKEYKHWFDKNVIGN 824

Query: 759  GLSPIDSIFQGQMENCLQCQRCGHSSYNYSTFYVLSLAIPTPGTSTFGKTKKVLLEDCIN 818
            GLSPID IF GQMEN LQCQRCG+SSYNYSTFYVLSLAIP P ++TF ++K+V LE+CIN
Sbjct: 825  GLSPIDHIFSGQMENSLQCQRCGNSSYNYSTFYVLSLAIPKPSSTTFSRSKRVKLEECIN 884

Query: 819  LFTSDEVLSGENAWDCPRCGTSMSGSGPGEGK----AKKKRKFLLPHDHVXXXXXXXXXX 874
            +FTSDEVLSGENAWDCP+CG+S S +     K       K+K +  H+            
Sbjct: 885  MFTSDEVLSGENAWDCPKCGSSASSTISDSEKLLNVTSSKKKNMSSHNE-----HHRYKS 939

Query: 875  XXXXXXXXXXXXXXXXXXXXXXXXMPGS---EKWKSKKLTTIKTFNFITMPPILVIHLSR 931
                                    +P S   E WKSKKL TIKT NFI +PPILVIHLSR
Sbjct: 940  KFFTLHTRSHRSISPFRKKTSPAAVPSSTKNEPWKSKKLITIKTLNFIVLPPILVIHLSR 999

Query: 932  FFYDLTKKNSTVITYPLILNIVLKNNEVAKYRLYGIVNHFGNLISGHYTSLVNKDLKHEI 991
            F+YDLTKKN+TVITYPLILNIVLKNNEVAKYRLYGIVNH GNLISGHYTSLVNK+  H++
Sbjct: 1000 FYYDLTKKNNTVITYPLILNIVLKNNEVAKYRLYGIVNHSGNLISGHYTSLVNKEPNHDL 1059

Query: 992  RHGQQKWYYFDDEVVKQDNNHGDFDAGIASVSSSDVYVLFYERIYD 1037
               +Q+WYYFDDE VK++ NHGD D GI  VSS DVYVLFYERIY+
Sbjct: 1060 GSKKQRWYYFDDETVKEERNHGDMDKGILQVSSRDVYVLFYERIYE 1105

>ZYRO0B16544g Chr2 complement(1342476..1345610) [3135 bp, 1044 aa]
           {ON} similar to uniprot|P40453 Saccharomyces cerevisiae
           YIL156W UBP7 Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 1044

 Score =  577 bits (1488), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/862 (40%), Positives = 486/862 (56%), Gaps = 65/862 (7%)

Query: 5   YTPEYSNELLQFVQDVYAQDIKHYYPXXXXXXXXXXXXHAEYLFESYHMMLKQGNQEDAL 64
           +TPEYS+ELL+ V+D+Y  DIK +Y             H  YL+ES+   +K  N++DAL
Sbjct: 8   FTPEYSSELLRLVEDIYEDDIKPHYAVLKLEDLDDLMDHTRYLYESFSDEMKNRNKQDAL 67

Query: 65  TAFIIGSFYVYLIIPQSIQFHTRNKSYGIYVDLRKYYQDETSMTNVLLMVTKKVDAILCK 124
           TA+IIG +++YLIIPQS QF  RNK++ ++  L+K Y+++ +MTNVLLMV  +VD++L  
Sbjct: 68  TAYIIGCYFLYLIIPQSTQFQARNKTFQVHNALKKLYENQVNMTNVLLMVKDEVDSVL-- 125

Query: 125 SRDFDDTK-ITRKRAYSVPSQALANQLRSLTLNNTDGLEQLPEVSKESDTLTNYADDYT- 182
            RDF   K + RKRA+S P   L +++  LTL        LP++ K+ D + + ++ ++ 
Sbjct: 126 DRDFRKLKDVERKRAFSSPDNGLDSEISRLTLAGNGS--TLPKMHKKWDFIRSDSNFHSH 183

Query: 183 -----TIWSAPKLEPDDQLKLALNPPXXXXXXXXXXXXFVMDQHSKKFSIGESSSDEFEP 237
                 +W AP LEP+DQLKLAL+                +D   K     E+      P
Sbjct: 184 DTGNVPLWKAPNLEPNDQLKLALD--------SAVPSSLSVDTVGK-----EAPELSLSP 230

Query: 238 IPTQEALPMDHATPSEIS--------QRTRHHSIVSSNDTGKSRKDSVESVANIYVQNVD 289
           +      P  H + SE++        Q  RHH  V   +T +  KD  E   + +   VD
Sbjct: 231 L----GYP-KHKSKSELTVEEKEHPQQDHRHHHGVQQ-ETHQLGKDDDEQ--HFWDAKVD 282

Query: 290 RYNTHRKDSYHSVYMLNEDDDTNE-------YDFFQNLSRLQKQYVISCEELMDILQS-D 341
           R   HRKDSYHSVYM + D D  E           Q + RLQKQ +I+  EL  IL +  
Sbjct: 283 RAVAHRKDSYHSVYMDDGDHDFGENKGATFPESEVQAMKRLQKQSIITSPELFSILSNKK 342

Query: 342 ERNNVLLVDLRISKRFHNNHIVAPNLINIDPRDLWDVDRKVPISSDVELEKKMGSYQTFQ 401
           ERN +LL+DLR+  R+  N+I+APN++ IDPR LWDV+ K P++    L++++ +   F 
Sbjct: 343 ERNRLLLIDLRLQSRYKFNYILAPNMVFIDPRMLWDVNTKTPVTDISVLDERLKN-SIFN 401

Query: 402 SRSKFKYIVYYTDMKTFLNIDFDYRLVFFQLLYASSSTRLRSPPKALLGDYEQWKTFIGQ 461
            R  F +IVYYTDMKT++ +DFDY  VF+ L+ AS    LRS P  LLG YE+WK  + +
Sbjct: 402 KRGSFDFIVYYTDMKTYMEMDFDYLFVFYNLVVASQEVSLRSLPSYLLGGYEKWKAVLKK 461

Query: 462 YAKHHDIVTGDYLFRPYASSAKSQKDKVKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 521
           Y     I   DYL+RPY SS K  K+K                                 
Sbjct: 462 YLTQFGIRVDDYLYRPY-SSNKEGKEK------SANAKHIEPVPWKPPALPERMRNLPPP 514

Query: 522 XXXXXXXXXQSIPAVHLPPLPPKSAINLHYSVATGMQPPMPQVTTVSHAHRHRYLSHSKR 581
                    + +P    PP+PPK  I L          P  +  +         ++  + 
Sbjct: 515 PPPATLPITKEMP----PPVPPK--IQLEQQEDKNHTRPRSRTVSSPAEVPKNVVAPEQL 568

Query: 582 SQHQHYSPISHQYISVPTIEQSSNVYVSLSITGLRNLGSTCYINSMLQCLFATRKFRDIF 641
           SQ   Y P+  +  SVPTIE+S+N YV+LSITGLRNLG+TCYINSMLQCLFAT  FRD+F
Sbjct: 569 SQLDSY-PMRQRQFSVPTIERSNNKYVALSITGLRNLGATCYINSMLQCLFATNMFRDLF 627

Query: 642 LSPKYHDYISKGYIHRAQISRSFHMLFKKMYMNGGCSVVPSGFLKACNSMRPDFKIPNXX 701
               Y  + +       ++S+SF +L +KMYMNGGCSVVP+ FLK CN +RPDF IP+  
Sbjct: 628 EPSNYERFFNPELEDTGKLSKSFSVLIRKMYMNGGCSVVPTSFLKICNFLRPDFNIPDDQ 687

Query: 702 XXXXXXXXXXXXXXXXXXSDPEQVANDYPQLLLHDDDNLQVDGKEYDKWFEDSISKNGLS 761
                             S+  +V N +P+LLL+D +  +V  +EY +WFE+S+     S
Sbjct: 688 QDAQEFLMLTIDRLHDELSNQTEVLNAHPELLLYDAETSKVQKEEYKQWFENSLINTKFS 747

Query: 762 PIDSIFQGQMENCLQCQRCGHSSYNYSTFYVLSLAIPTPGTSTFGKTKK--VLLEDCINL 819
           PID IFQGQ+EN L C++CG+SSY+YSTFY+LSLAIP P +S    +K   V LEDCIN+
Sbjct: 748 PIDKIFQGQLENGLHCKKCGYSSYSYSTFYILSLAIPKPSSSFLSSSKGNWVNLEDCINM 807

Query: 820 FTSDEVLSGENAWDCPRCGTSM 841
           FTSDEV+S ENAWDCP+CG ++
Sbjct: 808 FTSDEVMSRENAWDCPKCGVTV 829

 Score =  195 bits (496), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 88/124 (70%), Positives = 105/124 (84%)

Query: 912  TIKTFNFITMPPILVIHLSRFFYDLTKKNSTVITYPLILNIVLKNNEVAKYRLYGIVNHF 971
            +I+  NF+T+PP+LVIHLSRF+YDLTKKN TVITYPLILNIVLKNNE  KYRLY +VNH 
Sbjct: 920  SIRATNFVTLPPVLVIHLSRFYYDLTKKNETVITYPLILNIVLKNNETLKYRLYAVVNHN 979

Query: 972  GNLISGHYTSLVNKDLKHEIRHGQQKWYYFDDEVVKQDNNHGDFDAGIASVSSSDVYVLF 1031
            GNLISGHYTSLVNK+  H++ + +Q+WYYFDDEVVK + +HG+   G+  VSS DVYVLF
Sbjct: 980  GNLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHGNLSQGVNKVSSKDVYVLF 1039

Query: 1032 YERI 1035
            YERI
Sbjct: 1040 YERI 1043

>KLTH0E00814g Chr5 (80059..82983) [2925 bp, 974 aa] {ON} similar to
            uniprot|P40453 Saccharomyces cerevisiae YIL156W UBP7
            Ubiquitin-specific protease that cleaves
            ubiquitin-protein fusions
          Length = 974

 Score =  574 bits (1480), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/443 (63%), Positives = 326/443 (73%), Gaps = 8/443 (1%)

Query: 593  QYISVPTIEQSSNVYVSLSITGLRNLGSTCYINSMLQCLFATRKFRDIFLSPKYHDYISK 652
            ++ ++PTIEQS N YV+LSITGLRN+G TCY+NSMLQCLFAT+ FRD+FLS KY  Y S+
Sbjct: 536  KHTAIPTIEQSPNEYVALSITGLRNIGCTCYVNSMLQCLFATKAFRDLFLSTKYEHYFSR 595

Query: 653  GYIHRAQISRSFHMLFKKMYMNGGCSVVPSGFLKACNSMRPDFKIPNXXXXXXXXXXXXX 712
             Y +  Q+S+ F++LFKKMYMNGGCSVVP+GFLKACN++RPDF+IP+             
Sbjct: 596  KYTNPNQLSKYFNVLFKKMYMNGGCSVVPTGFLKACNALRPDFRIPHDQQDTQEFLLFLL 655

Query: 713  XXXXXXXSDPEQVANDYPQLLLHDDDNLQVDGKEYDKWFEDSISKNGLSPIDSIFQGQME 772
                   S+  +VANDYP LLLHDD  L VD KEYD WFE  IS+NG+SPID+IFQGQME
Sbjct: 656  SQLHDELSESNRVANDYPGLLLHDDKKLDVDQKEYDTWFEKHISENGISPIDNIFQGQME 715

Query: 773  NCLQCQRCGHSSYNYSTFYVLSLAIPTPGTSTFGKTKKVLLEDCINLFTSDEVLSGENAW 832
            N L CQRCGHSS+NYS FYVLSLAIP+  TSTF + KKV LEDCINLFTSDE L+ ENAW
Sbjct: 716  NGLFCQRCGHSSFNYSVFYVLSLAIPS-STSTFSQRKKVRLEDCINLFTSDEQLTNENAW 774

Query: 833  DCPRCGTSMSGSGPGEGKAKKKRKFLLPHDHVXXXXXXXXXXXXXXXXXXXXXXXXXXXX 892
            DCP+CGTS SG+GP E   KKK++FLL  D                              
Sbjct: 775  DCPKCGTSASGTGPEE--EKKKKRFLLNPD-----TRASGNRSRFFKLRSKSRSRSVSPF 827

Query: 893  XXXXXXMPGSEKWKSKKLTTIKTFNFITMPPILVIHLSRFFYDLTKKNSTVITYPLILNI 952
                      EK KSKKLTTIKT NFI++P +L IHLSRFFYDLTKKN+ VITYPLIL+I
Sbjct: 828  RKQSSQQQNLEKLKSKKLTTIKTLNFISLPTVLTIHLSRFFYDLTKKNNKVITYPLILSI 887

Query: 953  VLKNNEVAKYRLYGIVNHFGNLISGHYTSLVNKDLKHEIRHGQQKWYYFDDEVVKQDNNH 1012
            VLKN ++ KYRLY I NHFGNLISGHYTSLVNKDL H++  G+QKWYYFDDE VK+D NH
Sbjct: 888  VLKNEQIMKYRLYAIANHFGNLISGHYTSLVNKDLDHDLNKGKQKWYYFDDETVKKDINH 947

Query: 1013 GDFDAGIASVSSSDVYVLFYERI 1035
            GD DAGI S+SSSDVYVLFYE+I
Sbjct: 948  GDIDAGITSISSSDVYVLFYEKI 970

 Score =  381 bits (978), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 217/461 (47%), Positives = 292/461 (63%), Gaps = 39/461 (8%)

Query: 5   YTPEYSNELLQFVQDVYAQDIKHYYPXXXXXXXXXXXXHAEYLFESYHMMLKQGNQEDAL 64
           Y+PEYSNELLQFV+DVY QDI HY+P            HAEYLFESY   L     ED L
Sbjct: 5   YSPEYSNELLQFVKDVYTQDIAHYFPKLRLEKLIDLLEHAEYLFESYRHALAANQAEDLL 64

Query: 65  TAFIIGSFYVYLIIPQSIQFHTRNKSYGIYVDLRKYYQDETSMTNVLLMVTKKVDAILCK 124
           TAF+ G FY+YLIIP SIQF +R+KSY IY DL+KYYQDE +MTNVLLMVT+ ++++   
Sbjct: 65  TAFVAGCFYIYLIIPHSIQFQSRDKSYAIYADLKKYYQDEANMTNVLLMVTEVIESM--- 121

Query: 125 SRD-FDDTKITRKRAYSVPSQALANQLRSLTLNNTDGLEQLPEVSKESDTLTNYADDYTT 183
           S+D  +  +I RKRAYSVP       +++L+  N+  +E  P+   E++      ++ TT
Sbjct: 122 SKDEVETARIMRKRAYSVPYGKSPVTIQALSKANSATVE--PDAPTETE-----FENGTT 174

Query: 184 IWSAPKLEPDDQLKLALNPPXXXXXXXXXXXXFVMDQHSKKFSIGESSSDEFEPIPTQEA 243
           +W+AP+LEP+D LK++L               F    +       ES S  FE  P   A
Sbjct: 175 MWTAPELEPNDHLKVSLGSHHSSTSSASSNEQFPKIHN-------ESHSFPFEE-PELHA 226

Query: 244 LPMDHATPSEISQRTRHHSIVSSNDTGKSRKDSVESVAN---IYVQNVDRYNTHRKDSYH 300
           L +          RTR  S+ +      SRK      +N      Q ++RY THRKDSYH
Sbjct: 227 LSLG-------GSRTRRSSVPAR----ASRKLGTTQASNSSDFNDQKINRYATHRKDSYH 275

Query: 301 SVYMLNEDDDTNEYDFFQNLSRLQKQYVISCEELMDILQSDERNNVLLVDLRISKRFHNN 360
           SV+M N+D D     F  NL+RLQKQ V++C++LM IL S +R+N+LL+DLR SKRF  N
Sbjct: 276 SVHMSNDDYDA----FTFNLARLQKQSVVTCDQLMRILCSQDRDNLLLIDLRFSKRFQTN 331

Query: 361 HIVAPNLINIDPRDLWDVDRKVPISSDVELEKKMGSYQTFQSRSKFKYIVYYTDMKTFLN 420
           HI+APNL+N+DP  LW+ ++  PI SDV+LE+ + + +   +RS+F+YIVYYTDMKTF+ 
Sbjct: 332 HILAPNLLNVDPTLLWNQNKGSPIESDVQLERTLDN-KLLNARSQFEYIVYYTDMKTFMK 390

Query: 421 IDFDYRLVFFQLLYASSSTRLRSPPKALLGDYEQWKTFIGQ 461
           +DFDY+LVFFQL+Y +S+  L+  PK LLG YEQWK F+ +
Sbjct: 391 LDFDYQLVFFQLIY-TSNKNLKCTPKVLLGGYEQWKKFLSK 430

>NCAS0G00170 Chr7 (22237..25329) [3093 bp, 1030 aa] {ON} Anc_5.712
          Length = 1030

 Score =  542 bits (1397), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 271/488 (55%), Positives = 330/488 (67%), Gaps = 31/488 (6%)

Query: 566  TVSHAHRHRYLSHSKRSQ---HQHYSPISHQYISVPTIEQSSNVYVSLSITGLRNLGSTC 622
            T+ + H  R L H +  Q   H   +    +  S+PTIE+S N+YVSLSITGLRNLG+TC
Sbjct: 558  TLMNLHSARPLLHERNYQIPPHLQQTTTLTRRPSIPTIERSPNLYVSLSITGLRNLGNTC 617

Query: 623  YINSMLQCLFATRKFRDIFLSPKYHDYISKG-YIHRAQISRSFHMLFKKMYMNGGCSVVP 681
            YINSMLQCLFATR+FRD+FL+ KY  +++   + +   IS SF++LFKKMY+NGGCSVVP
Sbjct: 618  YINSMLQCLFATRRFRDLFLTSKYSSFLNGSKFPNSPMISNSFNLLFKKMYLNGGCSVVP 677

Query: 682  SGFLKACNSMRPDFKIPNXXXXXXXXXXXXXXXXXXXXSDPEQVANDYPQLLLHDDDNLQ 741
            + FLK CN +RPD KIP+                    S+ ++V N+YP L+L+D ++L+
Sbjct: 678  TSFLKNCNVLRPDLKIPDDQQDTQEFLMIILDRLHDELSNQQEVVNEYPSLMLYDTNHLR 737

Query: 742  VDGKEYDKWFEDSISKNGLSPIDSIFQGQMENCLQCQRCGHSSYNYSTFYVLSLAIPTPG 801
            V  +EY  WFE S+  NGLSPID IFQGQ+EN LQCQRCGHSS+NYSTFYVLSLAIP P 
Sbjct: 738  VQHEEYKHWFEKSVIGNGLSPIDEIFQGQIENGLQCQRCGHSSFNYSTFYVLSLAIPKPS 797

Query: 802  TSTFGKTKKVLLEDCINLFTSDEVLSGENAWDCPRCGT------------SMSGSGPGEG 849
             + F ++K+V LEDCIN+FT+DE+LSGENAWDCP CG+            S+     GE 
Sbjct: 798  PTGFSRSKRVKLEDCINMFTNDEMLSGENAWDCPNCGSNAQDRVRVNTDQSVKKKRQGEE 857

Query: 850  KAKKKRKFLLPHDHVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPGSEKWKSKK 909
               K R F LP                                      +   ++WK+KK
Sbjct: 858  HRHKSRFFGLP---------------TRPHRSLSPFRKSGSSSTNSTSKIKHEQQWKTKK 902

Query: 910  LTTIKTFNFITMPPILVIHLSRFFYDLTKKNSTVITYPLILNIVLKNNEVAKYRLYGIVN 969
            L TIKT NFI +PP+LVIHLSRFFYDLTKKN TVITYPLILNIVLKNNEVAKY+LYGIVN
Sbjct: 903  LITIKTLNFIMLPPVLVIHLSRFFYDLTKKNKTVITYPLILNIVLKNNEVAKYKLYGIVN 962

Query: 970  HFGNLISGHYTSLVNKDLKHEIRHGQQKWYYFDDEVVKQDNNHGDFDAGIASVSSSDVYV 1029
            H GNLISGHYTSLVNK+  H + H QQ+WYYFDDEVVK + NHGD D GI+ VSS DVYV
Sbjct: 963  HTGNLISGHYTSLVNKEPGHNLNHNQQRWYYFDDEVVKAEGNHGDIDNGISKVSSKDVYV 1022

Query: 1030 LFYERIYD 1037
            LFYER+Y+
Sbjct: 1023 LFYERLYE 1030

 Score =  358 bits (918), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 218/511 (42%), Positives = 304/511 (59%), Gaps = 48/511 (9%)

Query: 2   ECSYTPEYSNELLQFVQDVYAQDIKHYYPXXXXXXXXXXXXHAEYLFESYHMMLKQGNQE 61
           + ++TPEYSNELL+ +Q VY +DIKHYYP            H EYLFE +     +GN +
Sbjct: 7   KSTFTPEYSNELLRRIQSVYKEDIKHYYPQLKLEKLLDLLEHTEYLFELFLHFGHEGNNK 66

Query: 62  DALTAFIIGSFYVYLIIPQSIQFHTRNKSYGIYVDLRKYYQDETSMTNVLLMVTKKVDAI 121
           DALT+FI+G +Y++LI+PQSIQF +RNKSYGIY DL+K Y+++ SMTNVLLMV  +++ I
Sbjct: 67  DALTSFIVGCYYLFLIMPQSIQFQSRNKSYGIYSDLKKLYENQASMTNVLLMVKDEIETI 126

Query: 122 LCKS--RDFDDT--KITRKRAYSVP-SQALANQLRSLTLNNTDGLEQLPE--------VS 168
           L K+  R+ ++T  +I R+RAYSVP S  L  QL SL++++ + L+  P           
Sbjct: 127 LEKTAEREINETNNRIVRQRAYSVPDSNDLTEQLHSLSVSDRN-LKSPPRKILMNNSFEH 185

Query: 169 KESDTLTNYADDYTTIWSAPKLEPDDQLKLA------LNPPXXXXXXXXXXXXFVMDQHS 222
            +SD +    D  + +W+AP LEP DQLKLA      L PP            +  D   
Sbjct: 186 SDSDVINEENDMSSPLWTAPPLEPTDQLKLAVLGNETLPPP---------VIPYEADIQE 236

Query: 223 KKFSIGESSSDEFEPIPTQEALPMDHATPSEISQRTRHHSIVS-SNDTGKSRKDSVESVA 281
           +   + + S  E  P  T      D  +P +        S++S  ND    R+ S  +  
Sbjct: 237 RTDLLKQPSIPELSPTTTSLKNSKDFNSPFQ--------SVISLDNDIPLVREPS--NNR 286

Query: 282 NIYVQNVDRYNTHRKDSYHSVYMLNED--DDTNEY----DFFQNLSRLQKQYVISCEELM 335
           +    N DR  THRKDSYHSVYM++E+  D  N++    D+ Q+L RLQKQ +I+ +EL+
Sbjct: 287 SFRETNADRSQTHRKDSYHSVYMIDEESTDKLNQFYDSTDYIQDLQRLQKQSIITAQELL 346

Query: 336 DILQS-DERNNVLLVDLRISKRFHNNHIVAPNLINIDPRDLWDVDRKVPISSDVELEKKM 394
            IL    ER  +LL+DLR SKR   NHIVAPN+++IDP  LWD     PI +   LEK +
Sbjct: 347 SILSCPPERIKLLLIDLRWSKRTALNHIVAPNVVSIDPHLLWDSATSTPIYNMETLEKLL 406

Query: 395 GSYQTFQSRSKFKYIVYYTDMKTFLNIDFDYRLVFFQLLYASSSTRLRSPPKALLGDYEQ 454
            + + F  R +F+Y+VYYTDMKT+++ DFDY    F LL   ++  LRS P  LLG Y++
Sbjct: 407 DN-ELFNRRHEFEYVVYYTDMKTYMHSDFDYNFTLFYLLTTETTNILRSTPTYLLGGYDK 465

Query: 455 WKTFIGQYAKHHDIVTGDYLFRPYASSAKSQ 485
           WK F+  YAK +DI   DYL+RPY  + KS+
Sbjct: 466 WKVFLHHYAKEYDINIPDYLYRPYDKALKSE 496

>TDEL0B02080 Chr2 (369534..372611) [3078 bp, 1025 aa] {ON} Anc_5.712
            YIL156W
          Length = 1025

 Score =  535 bits (1378), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 256/460 (55%), Positives = 324/460 (70%), Gaps = 21/460 (4%)

Query: 584  HQHYSPISHQ-YISVPTIEQSSNVYVSLSITGLRNLGSTCYINSMLQCLFATRKFRDIFL 642
            H H   +S Q + S+PTIE+SSN YVSLSITGLRNLG+TCYINSMLQCLFAT KFRD+F+
Sbjct: 578  HPHDQRLSLQRHYSIPTIEKSSNTYVSLSITGLRNLGNTCYINSMLQCLFATTKFRDLFV 637

Query: 643  SPKYHDYISKGYIHRAQISRSFHMLFKKMYMNGGCSVVPSGFLKACNSMRPDFKIPNXXX 702
            S K+ ++ ++ Y +R Q+S+SF++LF+KMY+NGGCSVVP+ FLK  + +RPD +IP+   
Sbjct: 638  SGKFEEFFNQNYSNRPQLSKSFNILFRKMYINGGCSVVPTSFLKVLDHLRPDLRIPDDQQ 697

Query: 703  XXXXXXXXXXXXXXXXXSDPEQVANDYPQLLLHDDDNLQVDGKEYDKWFEDSISKNGLSP 762
                             S+   VAN+YP LLL+D+  + V+GKEY KWFE+S+  NGL+P
Sbjct: 698  DTQEFLMVTLDRLHDELSNQAAVANEYPDLLLYDEHQMDVNGKEYKKWFEESVIGNGLAP 757

Query: 763  IDSIFQGQMENCLQCQRCGHSSYNYSTFYVLSLAIPTPGTSTFGKTKKVLLEDCINLFTS 822
            ID IFQGQ+EN L+CQRCG+SS++YSTFYVLSLAIP P TSTF + K+V LEDCIN+FT+
Sbjct: 758  IDHIFQGQIENILECQRCGNSSFSYSTFYVLSLAIPKPSTSTFSRAKRVKLEDCINMFTN 817

Query: 823  DEVLSGENAWDCPRCGTSMSGSGPGEGKAKKKRKFLLPHDHVXXXXXXXXXXXXXXXXXX 882
            DE+LSGENAWDCP+CG++++  GP              H                     
Sbjct: 818  DEILSGENAWDCPKCGSAVTDMGPN-------------HLKKSKKKKKSELGEERRSKSG 864

Query: 883  XXXXXXXXXXXXXXXXMPGS-------EKWKSKKLTTIKTFNFITMPPILVIHLSRFFYD 935
                            M GS       E WKSK+L+T KT NFI +PP+L+IHLSRF+YD
Sbjct: 865  FFRIHSKSKRSKSPFRMLGSTKFPLAMEDWKSKELSTKKTLNFIFLPPVLIIHLSRFYYD 924

Query: 936  LTKKNSTVITYPLILNIVLKNNEVAKYRLYGIVNHFGNLISGHYTSLVNKDLKHEIRHGQ 995
            LTKKN T++TYPL+LNI+LKNNE A+YRLY +VNH GNLISGHYTSLVNK+  H++  G+
Sbjct: 925  LTKKNDTIVTYPLVLNIILKNNETARYRLYAVVNHTGNLISGHYTSLVNKEPMHKLDKGR 984

Query: 996  QKWYYFDDEVVKQDNNHGDFDAGIASVSSSDVYVLFYERI 1035
            QKWYYFDDEVVK++  HG+ D GI  VSSSDVYVLFYER+
Sbjct: 985  QKWYYFDDEVVKEETKHGNIDQGILKVSSSDVYVLFYERL 1024

 Score =  348 bits (893), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 209/503 (41%), Positives = 284/503 (56%), Gaps = 36/503 (7%)

Query: 2   ECSYTPEYSNELLQFVQDVYAQDIKHYYPXXXXXXXXXXXXHAEYLFESYHMMLKQGNQE 61
           E S+TPEYSNELL+ VQ++Y  DIKHY+             H EYLFESY   L + N +
Sbjct: 5   EVSFTPEYSNELLRCVQNLYEDDIKHYFTQSKLEKLLDLLEHTEYLFESYLQFLHEKNNQ 64

Query: 62  DALTAFIIGSFYVYLIIPQSIQFHTRNKSYGIYVDLRKYYQDETSMTNVLLMVTKKVDAI 121
           DALTAFIIG +Y+YLI+PQSI+F TRNKSY I+ DL K YQ++ +MTNVLLMV  +VD+I
Sbjct: 65  DALTAFIIGCYYLYLIVPQSIEFQTRNKSYSIFNDLMKMYQNQANMTNVLLMVKDEVDSI 124

Query: 122 LCK-SRDFD--DTKITRKRAYSVPSQALANQLRSLTLNNTDGL-------EQLPEVSKES 171
           L + +R+F   + +  R RAYSVP +   ++L +L ++N + L           E  +E 
Sbjct: 125 LDRNAREFKEFEHQKARTRAYSVPDRNFESRLTNLNIHNENPLPLGDHQAASKSEQGRED 184

Query: 172 DTLTNYADDYTTIWSAPKLEPDDQLKLALNPPXXXXXXXXXXXXFVMDQ--HSKKFSIGE 229
                  +D + +W+AP LEP+DQL++AL+                +DQ   +K+ +I  
Sbjct: 185 MNNLQNDEDSSPVWTAPPLEPNDQLRIALD------ATPLSPSIMALDQPMATKELAIST 238

Query: 230 SSSDEFEPIPTQEALPMDHATPSEISQRTRHHSIVSSNDTGKSRKDSVESVANIYVQNVD 289
           S         ++ A  M   TP  I +      +  S   G S  D +     ++  NVD
Sbjct: 239 SRK-----ALSRRASAMG-PTPYPIEE------LDISGQDGNSHYDELGFNKTLWNANVD 286

Query: 290 RYNTHRKDSYHSVYMLNEDDDTN----EYDFFQNLSRLQKQYVISCEELMDIL-QSDERN 344
           R  THRKDSYHSVYM     D +      DF Q L RLQKQ +I+  EL  IL  S+E  
Sbjct: 287 RQTTHRKDSYHSVYMFEGGSDDHMPSISKDFTQGLERLQKQSIITAPELFTILSSSEESE 346

Query: 345 NVLLVDLRISKRFHNNHIVAPNLINIDPRDLWDVDRKVPISSDVELEKKMGSYQTFQSRS 404
            +LL+D R+SKR   NHI+AP  + IDPR LWD     PIS+   L++ +     F  R 
Sbjct: 347 KLLLIDFRLSKRSKVNHIIAPTTVEIDPRQLWDPKTNTPISNAATLDEIIKK-PAFLERG 405

Query: 405 KFKYIVYYTDMKTFLNIDFDYRLVFFQLLYASSSTRLRSPPKALLGDYEQWKTFIGQYAK 464
            + YIVYYTDMKT++ ID+DY    F LL AS +  LRS P  LLG YE+WK  +  Y+ 
Sbjct: 406 SYDYIVYYTDMKTYMTIDYDYMFTLFYLLTASPTVNLRSLPTHLLGGYEKWKKIMKNYSV 465

Query: 465 HHDIVTGDYLFRPYASSAKSQKD 487
            H +   +Y++RPY  S K+  D
Sbjct: 466 DHGVNMDNYIYRPYGESKKALPD 488

>AFR296C Chr6 complement(972519..976028) [3510 bp, 1169 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YIL156W
            (UBP7) and YKR098C (UBP11)
          Length = 1169

 Score =  528 bits (1360), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 263/460 (57%), Positives = 321/460 (69%), Gaps = 4/460 (0%)

Query: 578  HSKRSQHQHYSPISHQYISVPTIEQSSNVYVSLSITGLRNLGSTCYINSMLQCLFATRKF 637
            H++RS+    +  S  + SVPTIE++ N Y++LSITGLRN+ +TCYINSMLQCLF+T +F
Sbjct: 711  HTERSRGWLSAGSSEAHFSVPTIEKNPNEYIALSITGLRNMSNTCYINSMLQCLFSTTEF 770

Query: 638  RDIFLSPKYHDYISKGYIHRAQISRSFHMLFKKMYMNGGCSVVPSGFLKACNSMRPDFKI 697
            R++FLS KY  Y+    +    +SRSF+MLFKKMYMNGGCSVVPSGFLK C+ ++PD +I
Sbjct: 771  RNLFLSNKYSRYLKSSNMD--NMSRSFYMLFKKMYMNGGCSVVPSGFLKMCSYLKPDLRI 828

Query: 698  PNXXXXXXXXXXXXXXXXXXXXSDPEQVANDYPQLLLHDDDNLQVDGKEYDKWFEDSISK 757
            P+                    S    V NDYPQLLLH+   L+V+ KEY  WF+ +  K
Sbjct: 829  PHGQQDTQEFLLFLLDRLRDELSYLAAVVNDYPQLLLHESSVLKVNDKEYTTWFDQNFEK 888

Query: 758  NGLSPIDSIFQGQMENCLQCQRCGHSSYNYSTFYVLSLAIPTPGTSTFGKTKKVLLEDCI 817
            NGLSPIDSIFQGQ+E+ L CQRC  SSY+YSTFYVLSLA+P PG+  FGK KK+ LEDCI
Sbjct: 889  NGLSPIDSIFQGQIEHQLSCQRCDFSSYSYSTFYVLSLALPNPGSKAFGKAKKLRLEDCI 948

Query: 818  NLFTSDEVLSGENAWDCPRCGTSMSGSGP-GEGKAKKKRKFLLPHDHVXXXXXXXXXXXX 876
            N FT DEVL+G+N WDCP+CG + SG       K+K+K KF +  ++             
Sbjct: 949  NFFTCDEVLTGQNPWDCPKCGVNSSGDRQMNSEKSKRKNKFFMGSENANSANSNRDHLPR 1008

Query: 877  XXXXXXXXXXXXXXXXXXXXXXMPGS-EKWKSKKLTTIKTFNFITMPPILVIHLSRFFYD 935
                                     + EK  +KKL TIK+ NFIT+P IL+IHLSRF YD
Sbjct: 1009 LFKIGSKSRSRSSSPFISGPKSSGKTHEKRYNKKLATIKSLNFITLPRILIIHLSRFVYD 1068

Query: 936  LTKKNSTVITYPLILNIVLKNNEVAKYRLYGIVNHFGNLISGHYTSLVNKDLKHEIRHGQ 995
            LTKKN+TV+TYPLILNIVLKNNEVAKYRLY  +NHFG LISGHYTSLVNKDL+HEIR G+
Sbjct: 1069 LTKKNNTVVTYPLILNIVLKNNEVAKYRLYSTINHFGTLISGHYTSLVNKDLQHEIREGK 1128

Query: 996  QKWYYFDDEVVKQDNNHGDFDAGIASVSSSDVYVLFYERI 1035
            QKWYYFDDE+VK D NHG++D GI SVSSSDVY+LFYERI
Sbjct: 1129 QKWYYFDDEIVKLDPNHGNYDRGITSVSSSDVYLLFYERI 1168

 Score =  173 bits (438), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 94/210 (44%), Positives = 126/210 (60%), Gaps = 23/210 (10%)

Query: 1   MECSYTPEYSNELLQFVQDVYAQDIKHYYPXXXXXXXXXXXXHAEYLFESYHMMLKQGNQ 60
           M   Y PEYS+EL  FVQ+ Y Q ++  YP             A  LFESY  ++++G  
Sbjct: 1   MSVPYIPEYSSELRTFVQEAYEQQVQELYPRLRFEKLVDLLERAANLFESYQDLVREGQT 60

Query: 61  EDALTAFIIGSFYVYLIIPQSIQFHTRNKSYGIYVDLRKYYQDETSMTNVLLMVTKKVDA 120
            + L A++IG+FY+YLIIPQSI+FHTRN SY +Y DLRK+Y+ E +MTNV+ MVT+KVDA
Sbjct: 61  REGLMAYVIGAFYLYLIIPQSIEFHTRNLSYSLYTDLRKHYEREPNMTNVVQMVTEKVDA 120

Query: 121 ILCKSRDFD----DTKITRKRAYSVPSQALANQLRSLTLNNTDGLEQ---------LPEV 167
           +L +    D    DTK+ RKRAYSVP + +A    SL     DG  +         +PEV
Sbjct: 121 VLLRQTPEDGERGDTKLYRKRAYSVPEKGVARSSDSLQHLTVDGKRRGGHHAIGGAIPEV 180

Query: 168 SKESDTLTNYADDYTTIWSAPKLEPDDQLK 197
           + ++DTL          WSAPKLE +D L+
Sbjct: 181 AVQADTL----------WSAPKLEENDLLR 200

 Score =  125 bits (315), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 72/199 (36%), Positives = 110/199 (55%), Gaps = 8/199 (4%)

Query: 278 ESVANIYVQNVDRYNTHRKDSYHSVYMLNEDDDTNEYDFFQNLSRLQKQYVISCEELMDI 337
           ES  +   Q +DR +  R + Y+       + +    +    L+RL +   I C +LM I
Sbjct: 403 ESAVSFEQQELDRPHNSRVEPYNPF----ANGNAAGLESCNPLTRLYETSSIKCSDLMII 458

Query: 338 LQSDERNNVLLVDLRISKRFHNNHIVAPNLINIDPRDLWDVDRKVPISSDVELEKKMGSY 397
           L+SD ++ VL +DLR  KR+  NHIVA +LINIDP  LWD +R  PI+S  E E+++ + 
Sbjct: 459 LESDIQDRVLFIDLRPPKRYELNHIVARHLINIDPLLLWDTERSAPITSVNEFERRLDN- 517

Query: 398 QTFQSRSKFKYIVYYTDMKTFLNIDFDYRLVFFQLLYASSSTRLRSPPKALLGDYEQWKT 457
             F +R +F Y+V YTD  T +N+DF + L FF+L+Y      L    K L G Y+QW+ 
Sbjct: 518 PLFTTRGQFSYLVCYTDNHTSMNMDFKFELTFFELVYMGKPRLLT---KCLQGGYDQWRL 574

Query: 458 FIGQYAKHHDIVTGDYLFR 476
           ++    K       D+++R
Sbjct: 575 YLKTNTKSIHAKISDFMWR 593

>Ecym_4009 Chr4 (19798..24351) [4554 bp, 1517 aa] {ON} similar to
            Ashbya gossypii AFR296C
          Length = 1517

 Score =  518 bits (1335), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 263/449 (58%), Positives = 308/449 (68%), Gaps = 14/449 (3%)

Query: 589  PISHQYISVPTIEQSSNVYVSLSITGLRNLGSTCYINSMLQCLFATRKFRDIFLSPKYHD 648
            PI H   S+PTIE S N YV+LSITGLRN+ +TCYINSMLQCLF+T  FR++FLS KY  
Sbjct: 1083 PIPH--FSIPTIENSYNEYVALSITGLRNMSNTCYINSMLQCLFSTSAFRNLFLSNKYAH 1140

Query: 649  YISKGYIHRAQISRSFHMLFKKMYMNGGCSVVPSGFLKACNSMRPDFKIPNXXXXXXXXX 708
            Y+    +    +SRSF+MLF+KMYMNGGCSVVPSGFLK CN+++PD +IP          
Sbjct: 1141 YLKSPEMD--TMSRSFYMLFRKMYMNGGCSVVPSGFLKMCNTLKPDLRIPYGQQDTQEFL 1198

Query: 709  XXXXXXXXXXXSDPEQVANDYPQLLLHDDDNLQVDGKEYDKWFEDSISKNGLSPIDSIFQ 768
                       S  E V+NDY  LLLHD+  L VD  +Y+KWF+ +I +NGLSPID +FQ
Sbjct: 1199 LFLLDKLHDELSSIESVSNDYSHLLLHDNVRLYVDDAQYNKWFDQNIDQNGLSPIDDLFQ 1258

Query: 769  GQMENCLQCQRCGHSSYNYSTFYVLSLAIPTPGTSTFGKTKKVLLEDCINLFTSDEVLSG 828
            GQMEN L CQRCG+SSY YSTFYVLSLA+P P    FGKTKK+ LEDCIN FT DEVLS 
Sbjct: 1259 GQMENQLSCQRCGYSSYTYSTFYVLSLALPNPVAKAFGKTKKLRLEDCINFFTCDEVLSD 1318

Query: 829  ENAWDCPRCGTSMSGSGPGEGKAKKKRKFLLPHDHVXXXXXXXXXXXXXXXXXXXXXXXX 888
            +NAWDCPRC    S S       K KRK     + +                        
Sbjct: 1319 QNAWDCPRC---CSPSDYMSYDHKGKRKISTSFESLNGGNSSRSKLFKFGYKMRSRSEAP 1375

Query: 889  XXXXXXXXXXMPGSEKWKSKKLTTIKTFNFITMPPILVIHLSRFFYDLTKKNSTVITYPL 948
                         S+K  + K  T+K+ NFITMP ILVIHLSRF YDLTKKN+ V++YPL
Sbjct: 1376 KFSSKL-------SDKVSNGKPATVKSLNFITMPRILVIHLSRFIYDLTKKNNIVVSYPL 1428

Query: 949  ILNIVLKNNEVAKYRLYGIVNHFGNLISGHYTSLVNKDLKHEIRHGQQKWYYFDDEVVKQ 1008
            ILNIVLKN+EVAK+RLY IVNHFG LISGHYTSLVNK+L HEI HG+QKWYYFDDE+VK 
Sbjct: 1429 ILNIVLKNSEVAKFRLYSIVNHFGTLISGHYTSLVNKELNHEISHGKQKWYYFDDEIVKF 1488

Query: 1009 DNNHGDFDAGIASVSSSDVYVLFYERIYD 1037
            D NHGD+D GIASVSSS+VYVLFYERI+D
Sbjct: 1489 DTNHGDYDNGIASVSSSNVYVLFYERIFD 1517

 Score =  255 bits (651), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 178/493 (36%), Positives = 271/493 (54%), Gaps = 41/493 (8%)

Query: 1   MECSYTPEYSNELLQFVQDVYAQDIKHYYPXXXXXXXXXXXXHAEYLFESYHMMLKQGNQ 60
           ME  Y PEYS EL QFV++VY ++++  Y             H  YL ESY  +L +G  
Sbjct: 1   MEAPYMPEYSLELQQFVEEVYVENLEDCYQKLRLEKLIDLLEHGAYLLESYRELLGRGQV 60

Query: 61  EDALTAFIIGSFYVYLIIPQSIQFHTRNKSYGIYVDLRKYYQDETSMTNVLLMVTKKVDA 120
           E  +TA+++G+FY+YLIIPQSI+FHTRN SY IYVDL+++Y+ + +M NV+L+V  KV +
Sbjct: 61  EAGITAYVVGAFYLYLIIPQSIEFHTRNLSYSIYVDLKRHYESDPNMMNVMLLVAAKVGS 120

Query: 121 I--LCKSRDFDD---TKIT-RKRAYSVP---SQALANQLRSLTL--NNTDGLEQLPEVSK 169
           +  L  S + D+    + T RKRAYS+    S  LA+ L  L++  ++T G       ++
Sbjct: 121 VMQLYLSGEGDEKYGARFTGRKRAYSMQSCDSSKLADTLGKLSIERSSTRGTTVFEGKTE 180

Query: 170 ESDTLTNYADD--YTTIWSAPKLEPDDQLKLALNPPXXXXXXXXXXXXFVMDQHSKKFSI 227
           +        DD    T+WSAP LEPDDQLKLA++                 D  +K   +
Sbjct: 181 QGAFGQQQQDDEWEDTVWSAPNLEPDDQLKLAVS------YSHSPSIHDTSDSKTKDSGL 234

Query: 228 GESSSDEFEPIPTQEALPMDHATPSEISQRTRHHSI-VSSNDTGKSRKDSVESVANIYVQ 286
             +S+ EF          +D    SE        S+ V S+D      D + S+ + +  
Sbjct: 235 ENNSAAEFS--------VLDEEWVSERRSGFMSQSLQVDSSD--NKNNDELPSIGD-HND 283

Query: 287 NVDRYNTHRKDSYHSVYMLNEDDDTNEYDFFQNLSRLQKQYVISCEELMDILQSDERNNV 346
            +DR+ TH +D  + +   N+     E     ++  L +   I C +L+  L S ER+++
Sbjct: 284 VLDRFYTHGQDLRYPI--CNDGVVPCEN---SSIMWLYESSSIKCLDLLSKLTSSERSSM 338

Query: 347 LLVDLRISKRFHNNHIVAPNLINIDPRDLWDVDRKVPISSDVELEKKMGSYQTFQSRSKF 406
           LL+DLR+ KR+  +HI+A N+INIDP  LWD ++  P+SS  ELE  + ++  F+SR +F
Sbjct: 339 LLIDLRLPKRYEYSHILAENVINIDPELLWDDEKGAPVSSVKELELVIDNH-LFRSRRQF 397

Query: 407 KYIVYYTDMKTFLNIDFDYRLVFFQLLYASSSTRLRSPPKALLGDYEQWKTFIGQYAKHH 466
             IV YTD  T++ IDFD+  + F+LLY     R +   K L G YEQWK+F+ +  +  
Sbjct: 398 ATIVCYTDNYTYMQIDFDFVFLLFRLLYLG---RPQLVLKTLSGGYEQWKSFLKELKRTE 454

Query: 467 DIVTGDYLF-RPY 478
            I+  D+L+ RP+
Sbjct: 455 SIILSDFLWKRPH 467

>Kpol_2001.78 s2001 complement(213762..214973) [1212 bp, 403 aa] {ON}
            complement(213762..214973) [1212 nt, 404 aa]
          Length = 403

 Score =  479 bits (1232), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 232/422 (54%), Positives = 285/422 (67%), Gaps = 30/422 (7%)

Query: 627  MLQCLFATRKFRDIFLSPKYHDYISKGYIHRAQISRSFHMLFKKMYMNGGCSVVPSGFLK 686
            M+QCLF T+  RD+F+S KY  Y+SK     + +SRSF +LFKKMY+NGGCSVVP+ FLK
Sbjct: 1    MVQCLFGTKLLRDLFISSKYEKYLSKRIDRSSNLSRSFSILFKKMYLNGGCSVVPTSFLK 60

Query: 687  ACNSMRPDFKIPNXXXXXXXXXXXXXXXXXXXXSDPEQVANDYPQLLLHDDDNLQVDGKE 746
             CN +RPD +IP+                    S+ E V  DYP L+L+D   L+V+ KE
Sbjct: 61   TCNQLRPDLRIPDDQQDTQEFLMLMLDRLHDELSNQETVGIDYPDLVLYDTRKLRVNNKE 120

Query: 747  YDKWFEDSISKNGLSPIDSIFQGQMENCLQCQRCGHSSYNYSTFYVLSLAIPTPGTSTFG 806
            Y KWF+ +I  NGLSPID IFQGQ+EN L CQRCG  SYNYSTFYVLSLAIP P + TF 
Sbjct: 121  YSKWFDKTIFANGLSPIDHIFQGQIENTLTCQRCGFVSYNYSTFYVLSLAIPKPSSGTFS 180

Query: 807  KTKKVLLEDCINLFTSDEVLSGENAWDCPRCGTS-----------MSGSGPGEGKAKKKR 855
            ++K+V LEDCIN+FT+DEVLSGENAWDC  CG+S            +G+G  + +++K R
Sbjct: 181  RSKRVKLEDCINMFTNDEVLSGENAWDCSNCGSSSVHNVEQRKDKTTGNGEEKKRSRKSR 240

Query: 856  KFLLPHDHVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPGSEKWKSKKLTTIKT 915
             FLLP+                                      P  EK K KKL TIK+
Sbjct: 241  LFLLPN-------------------INGRSSRSISPFRKSASPRPPHEKLKHKKLVTIKS 281

Query: 916  FNFITMPPILVIHLSRFFYDLTKKNSTVITYPLILNIVLKNNEVAKYRLYGIVNHFGNLI 975
             NFI++PP LVIHLSRF+YDL+KKN T++TYPLILNIVL NNE AKYRLYGIVNH GNLI
Sbjct: 282  MNFISLPPTLVIHLSRFYYDLSKKNETIVTYPLILNIVLNNNETAKYRLYGIVNHTGNLI 341

Query: 976  SGHYTSLVNKDLKHEIRHGQQKWYYFDDEVVKQDNNHGDFDAGIASVSSSDVYVLFYERI 1035
            SGHYT+LVNK+  HE++  +QKWYYFDDEVVK++NNHG+ D G+  VSSS VYVLFYER+
Sbjct: 342  SGHYTTLVNKEKNHELKKDKQKWYYFDDEVVKEENNHGNIDEGVIKVSSSQVYVLFYERV 401

Query: 1036 YD 1037
            Y+
Sbjct: 402  YN 403

>CAGL0H06721g Chr8 complement(667816..671061) [3246 bp, 1081 aa] {ON}
            similar to uniprot|P40453 Saccharomyces cerevisiae
            YIL156w UBP7
          Length = 1081

 Score =  484 bits (1245), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 242/456 (53%), Positives = 298/456 (65%), Gaps = 22/456 (4%)

Query: 596  SVPTIEQSSNVYVSLSITGLRNLGSTCYINSMLQCLFATRKFRDIFLSPKYHDYISKGYI 655
            S+PTIE++SN YV+ S+TGLRNLG+TCYIN MLQ LFAT + +++F+S KY +Y  K   
Sbjct: 631  SIPTIEKNSNPYVAYSVTGLRNLGNTCYINCMLQSLFATNELKNLFISGKYREYQMKPND 690

Query: 656  HR-AQISRSFHMLFKKMYMNGGCSVVPSGFLKACNSMRPDFKIPNXXXXXXXXXXXXXXX 714
            ++ + IS +F  LF KMYMNGGC+VVPSGFLK CN +RPD +IP+               
Sbjct: 691  NKESAISNTFANLFNKMYMNGGCTVVPSGFLKICNFLRPDLRIPDDQQDTQEFLLFILNR 750

Query: 715  XXXXXSDPEQVANDYPQLLLHDDDNLQVDGKEYDKWFEDSISKNGLSPIDSIFQGQMENC 774
                 S+   V NDYP LLL+DDD + VD ++Y KWF+ ++  NGLSP+D +FQGQMEN 
Sbjct: 751  LHDELSNQVNVINDYPNLLLYDDDKMMVDKEKYKKWFDKTVVANGLSPVDGVFQGQMENA 810

Query: 775  LQCQRCGHSSYNYSTFYVLSLAIPTPGTSTFGKTKKVLLEDCINLFTSDEVLSGENAWDC 834
            LQCQRCG+ S NYSTFYVLSLA+P P    F K+ +V LEDCIN+FTSDEVL+GENAWDC
Sbjct: 811  LQCQRCGYESVNYSTFYVLSLALPKPSAPAFYKSGRVKLEDCINMFTSDEVLTGENAWDC 870

Query: 835  PRCG-----------TSMSGSGPGEGKAKKKRKFL-LPHDHVXXXXXXXXXXXXXXXXXX 882
            P+CG           TS     P      KK KF  LP                      
Sbjct: 871  PKCGSKAVEPRFTSRTSTQTILPNSPHHHKKSKFFGLPTGKAISRSKSPFRKLGLLEKHE 930

Query: 883  XXXXXXXXXXXXXXXXMPGSEKW---KSKKLTTIKTFNFITMPPILVIHLSRFFYDLTKK 939
                                E+W   KSKKL TIKT NFI++P +L+IHLSRF+YDLTKK
Sbjct: 931  GKQEKLDKMERDEI------EEWHKMKSKKLVTIKTINFISLPKVLIIHLSRFYYDLTKK 984

Query: 940  NSTVITYPLILNIVLKNNEVAKYRLYGIVNHFGNLISGHYTSLVNKDLKHEIRHGQQKWY 999
            N  V++YPL+LNIVLKN E+ +Y+LY IVNH GNLISGHYTSLVNKD  H + + +QKWY
Sbjct: 985  NDAVVSYPLVLNIVLKNEEIVRYKLYSIVNHTGNLISGHYTSLVNKDPHHNLGNTEQKWY 1044

Query: 1000 YFDDEVVKQDNNHGDFDAGIASVSSSDVYVLFYERI 1035
            YFDDEVVK +  HG+ D GI  VSS +VYVLFYER+
Sbjct: 1045 YFDDEVVKAEKTHGNVDKGITKVSSKNVYVLFYERV 1080

 Score =  252 bits (644), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 175/544 (32%), Positives = 271/544 (49%), Gaps = 76/544 (13%)

Query: 5   YTPEYSNELLQFVQDVYAQDIKHYYPXXXXXXXXXXXXHAEYLFESYHMMLKQGNQEDAL 64
           +TPE+S +LL  +Q +Y  +I+  +P             A+ + E Y M     +   A+
Sbjct: 4   FTPEFSGQLLLQIQQIYVDEIRPQFPQLKLQRLLDLLEQAQCMLEDY-MGCVDVDTSKAV 62

Query: 65  TAFIIGSFYVYLIIPQSIQFHTRNKSYGIYVDLRKYYQDETSMTNVLLMVTKKVDAILCK 124
             FI G FY+YL++P+S+QF TR+KSY +Y +LR  Y+ + +MTNV+ MV ++V  I  +
Sbjct: 63  RVFITGCFYIYLVMPESMQFQTRSKSYSLYTELRHLYESQLNMTNVIAMVKEEVAQIQEQ 122

Query: 125 SRDF------DDTK-------------------ITRKRAYSVPSQALANQLR---SLTLN 156
             +F      DD+K                   ITR+ AYS+ S +  + L     L  +
Sbjct: 123 CDNFQDNEGVDDSKPLGNNLKGADNMLNQGKRLITRRSAYSISSPSGMSTLSLHDELPEH 182

Query: 157 NTDGLEQLPEVSKE------SDTLTNYADDYTTIWSAPKL-EPDDQLKLALNPPXXX-XX 208
            ++   + P V ++      +D L       T       + +P   L + LN        
Sbjct: 183 RSEQQTRFPSVERDQSNGMKADMLLEKKQSRTKSNPITNINQPRKSLDVTLNANNEIPTL 242

Query: 209 XXXXXXXFVMDQHSKKFSIGESSSDEFEPIPTQEALPMDHATPSEISQRTR--------- 259
                   V DQH++  S+  +++D  E    +   P+  A   + + + +         
Sbjct: 243 SLHSDDKAVFDQHNEAKSLPGTATDSDEEYYVEHGSPIWTAPDLDPNDQLKLALGTELLS 302

Query: 260 ---------------HHSIVSSNDTGKSRKDSVESVANIYVQNVDRYNTHRKDSYHSVYM 304
                          ++  VS  D    R    E +      + +R  THRKDSYHS+YM
Sbjct: 303 PPVMGLDGDTLGDDIYYETVSKGDDVSYRGKDFEDL------HANRLITHRKDSYHSIYM 356

Query: 305 LNEDDDT--NEYD----FFQNLSRLQKQYVISCEELMDILQS-DERNNVLLVDLRISKRF 357
           +++D++   N +D    F Q L RLQKQ +I+  EL  IL + +ER+ +LL+DLR++KR 
Sbjct: 357 IDDDNNNSKNYFDGSNAFIQGLERLQKQSIITAPELFSILSNPEERHKLLLIDLRLNKRS 416

Query: 358 HNNHIVAPNLINIDPRDLWDVDRKVPISSDVELEKKMGSYQTFQSRSKFKYIVYYTDMKT 417
             NHIVAPN++NIDP +LWD +   PI  D  LE+++ +   F  R K+ YIVYY+DMKT
Sbjct: 417 MANHIVAPNVVNIDPTNLWDNEANSPIYKDTILEQRLNN-PLFNGRLKYDYIVYYSDMKT 475

Query: 418 FLNIDFDYRLVFFQLLYASSSTRLRSPPKALLGDYEQWKTFIGQYAKHHDIVTGDYLFRP 477
           ++N ++DY  + F LL  +S   L S P ALLG YE+WK  +  Y   + I   DYL+RP
Sbjct: 476 YMNFEYDYSFILFYLL-TTSGKHLSSVPTALLGGYEKWKKVMNTYVSQYQIELDDYLYRP 534

Query: 478 YASS 481
           YA S
Sbjct: 535 YAPS 538

>TPHA0D04660 Chr4 complement(1017401..1020538) [3138 bp, 1045 aa] {ON}
            Anc_5.712 YIL156W
          Length = 1045

 Score =  470 bits (1209), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 246/472 (52%), Positives = 301/472 (63%), Gaps = 38/472 (8%)

Query: 581  RSQHQHYSPISHQYISVPTIEQSSNVYVSLSITGLRNLGSTCYINSMLQCLFATRKFRDI 640
            + +HQ Y  +      VPTIEQ+ N YVSLSITGLRNLG+TCYI+SMLQCLFAT   RD+
Sbjct: 594  QKKHQ-YKALKSYATPVPTIEQNPNTYVSLSITGLRNLGNTCYISSMLQCLFATTTLRDL 652

Query: 641  FLSPKYHDYISKGYIHRAQISRSFHMLFKKMYMNGGCSVVPSGFLKACNSMRPDFKIPNX 700
            F++ KY  YI+     +  +SRSF +LF+KMY+NGGCSVVP+ FLK CN +RPD KIP+ 
Sbjct: 653  FITTKYESYINHKVTDKINLSRSFSILFRKMYLNGGCSVVPASFLKTCNQLRPDLKIPDD 712

Query: 701  XXXXXXXXXXXXXXXXXXXSDPEQVANDYPQLLLHDDDNLQVDGKEYDKWFEDSISKNGL 760
                               S  + V NDY  LLL+D + + V   +Y KWFE+S    G+
Sbjct: 713  QQDTQEFLMLVLDRLHDELSKEDTVLNDYSNLLLYDAERMHVKVDQYKKWFENSNLSGGV 772

Query: 761  SPIDSIFQGQMENCLQCQRCGHSSYNYSTFYVLSLAIPTPGTSTFGKTKKVLLEDCINLF 820
            SPID IFQGQ+EN + CQRCG+SS+NYS+FYVLSLAIP     +F +T +V LEDCIN+F
Sbjct: 773  SPIDDIFQGQIENSINCQRCGYSSFNYSSFYVLSLAIPKISVMSFSRTNRVKLEDCINMF 832

Query: 821  TSDEVLSGENAWDCPRCGTS----------------MSGSGPGEGKAKKKRKFLLPHDHV 864
            T DEVLSGENAWDC RCG+                  S +     + +K R FLLP  + 
Sbjct: 833  TRDEVLSGENAWDCSRCGSQSDNFVKTSHNDHHKEHTSETTDDSKQNRKSRLFLLPKKY- 891

Query: 865  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPGSEKWKSKKLTTIKTFNFITMPPI 924
                                                 SEKWKSKK+ TIK+ NFI MP I
Sbjct: 892  -------------------NPTSRSLSPFGRHSSHKSSEKWKSKKMETIKSLNFIKMPKI 932

Query: 925  LVIHLSRFFYDLTKKNSTVITYPLILNIVLKNNEVAKYRLYGIVNHFGNLI-SGHYTSLV 983
            LVIHLSRFFYD++KKN TV+ YPLILNIVLKN EV KYRLY IVNH GN + SGHYT+LV
Sbjct: 933  LVIHLSRFFYDMSKKNETVVAYPLILNIVLKNEEVCKYRLYAIVNHMGNQVASGHYTTLV 992

Query: 984  NKDLKHEIRHGQQKWYYFDDEVVKQDNNHGDFDAGIASVSSSDVYVLFYERI 1035
            NK+  H++   +Q+WYYFDDEVVK + NHG+ D G+  VSSS VYVLFYE+I
Sbjct: 993  NKNRNHDLGKNEQQWYYFDDEVVKHELNHGNIDEGVNKVSSSHVYVLFYEKI 1044

 Score =  281 bits (718), Expect = 7e-79,   Method: Compositional matrix adjust.
 Identities = 190/528 (35%), Positives = 278/528 (52%), Gaps = 80/528 (15%)

Query: 1   MECSYTPEYSNELLQFVQDVYAQDIKHYYPXXXXXXXXXXXXHAEYLFESYHMMLKQGNQ 60
           +E ++TPEYSNELL+ V D Y  +IK ++P            H  YL ESY  +L +   
Sbjct: 3   VESTFTPEYSNELLKRVSDTYNNEIKGHFPQLRLTKLIEMLEHTAYLLESYLDLLHEQKY 62

Query: 61  EDALTAFIIGSFYVYLIIPQSIQFHTRNKSYGIYVDLRKYYQDETSMTNVLLMVTKKVDA 120
           ++ L+A+I+G FY+YLIIP S QF  RNKS+ IY +L+  YQ++ +MTNVL +V  +VD+
Sbjct: 63  DECLSAYIVGCFYLYLIIPNSTQFQIRNKSFRIYNELKILYQNQANMTNVLAIVKNEVDS 122

Query: 121 ILCKS---RDFDDTKITRKRAYSVPSQALAN--QLRSLTLNN---------TDG-----L 161
           IL +S    +  +  I R RAYS P+  + N  +   L++N+         TD       
Sbjct: 123 ILDESILELEGIEKVIKRDRAYSSPAPKVNNISKFSKLSINDNHHNGETISTDNKLQSHF 182

Query: 162 EQLPEVSKESDT------------LTNYADDYTTIWSAPKLEPDDQLKLALNPPXXXXXX 209
            Q P  S  +++             +  A+D   IW  P LEP+DQLKLAL  P      
Sbjct: 183 PQTPNYSNSNNSTGSFNNVKSNSNSSEEAEDTAPIWHIPSLEPNDQLKLALEQPV----- 237

Query: 210 XXXXXXFVMDQHSKKFSIGESSSDEFEPIPTQEALPMDHATPSEISQRTRHHSIVSS--- 266
                              E S +E +     E L   ++ P    Q+ R+ SI S+   
Sbjct: 238 -------------------EFSDEEIDASSISEPLGRRYS-PLSPYQKKRNSSISSAFLV 277

Query: 267 ----NDTGKSRKDS--VESVANIYVQNVDRYNTHRKDSYHSVYMLNEDDDTN-------E 313
               N+  K   +S  +E +       VDR  THRKDSYHSVYM N+D++++        
Sbjct: 278 PFPHNENDKVHDNSMLIEDLP------VDRSVTHRKDSYHSVYMNNQDEESDSGAHYGLS 331

Query: 314 YDFFQNLSRLQKQYVISCEELMDILQS-DERNNVLLVDLRISKRFHNNHIVAPNLINIDP 372
             + Q++ RLQKQ VI+C EL  IL S  ER  +LLVDLRI K    NHI+AP++I IDP
Sbjct: 332 NSYIQSMDRLQKQNVITCSELYSILSSPTERQKLLLVDLRIPKASRTNHIIAPHIIKIDP 391

Query: 373 RDLWDVDRKVPISSDVELEKKMGSYQTFQSRSKFKYIVYYTDMKTFLNIDFDYRLVFFQL 432
             LW+ + + PI S  EL K++ +       +KF YIVYY+D++TF+  D+D+   FF L
Sbjct: 392 NLLWNEETQTPIYSFEELVKRINN-PLISEVNKFDYIVYYSDIRTFMVTDYDFCFTFFYL 450

Query: 433 LYASSSTRLRSPPKALLGDYEQWKTFIGQYAKHHDIVTGDYLFRPYAS 480
           L ++ S  L+  P  LLG +E+WK  +  Y K + I    ++ + +A+
Sbjct: 451 LLSTKSLNLKQVPTNLLGGFEKWKKVLKTYNKEYGIDITPFIKKLHAT 498

>Smik_11.362 Chr11 complement(623098..625263) [2166 bp, 721 aa] {ON}
            YKR098C (REAL)
          Length = 721

 Score =  434 bits (1115), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 222/442 (50%), Positives = 291/442 (65%), Gaps = 20/442 (4%)

Query: 597  VPTIEQSSNVYVSLSITGLRNLGSTCYINSMLQCLFATRKFRDIFLSPKYHDYI-SKGYI 655
            +PTIE S+++   LSITGL+N  +TCYINS++QCLF T  FRD+FL+ KY  ++ +  Y 
Sbjct: 287  LPTIEDSTSLLSQLSITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLQTDKYP 346

Query: 656  HRAQISRSFHMLFKKMYMNGGCSVVPSGFLKACNSMRPDFKIPNXXXXXXXXXXXXXXXX 715
               Q+SRS ++LFKKMY+NGG ++ P+GFLK C  +RPD  IP+                
Sbjct: 347  REVQLSRSIYVLFKKMYLNGGEAIAPNGFLKMCKKLRPDLNIPDDQQDTQEFLLIILARL 406

Query: 716  XXXXSDPEQVANDYPQLLLHDDDNLQVDGKEYDKWFEDSISKNGLSPIDSIFQGQMENCL 775
                S+   V   YP L+ +D +  QV+  +Y KW+E S+  +GLSPID IF+GQMEN L
Sbjct: 407  HEELSNG-TVTEYYPDLVSYDANAFQVNPSKYQKWYEGSVLTDGLSPIDYIFRGQMENIL 465

Query: 776  QCQRCGHSSYNYSTFYVLSLAIPTPGTSTF-GKTKKVLLEDCINLFTSDEVLSGENAWDC 834
            +CQRCG+SS++YSTFYVLSLAIP     +F  K+KK+ LEDCINLFTSDE LSG+N+WDC
Sbjct: 466  KCQRCGNSSHSYSTFYVLSLAIPKISLYSFTSKSKKIKLEDCINLFTSDEELSGDNSWDC 525

Query: 835  PRCGTSMSGSGPGEGKA-KKKRKFLLPHDHVXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 893
            P CGT+   +   E  + KKK  F   H                                
Sbjct: 526  PNCGTTDLKTKINESTSQKKKSTFFSFHSRSRSKSPHHHHHHHHHSHDNTEKH------- 578

Query: 894  XXXXXMPGSEKWKSKKLTTIKTFNFITMPPILVIHLSRFFYDLTKKNSTVITYPLILNIV 953
                    S+KW S+KLTT+K+ +FI +PPILVIHLSRF+YDLT+KN+TVITYPLILN++
Sbjct: 579  --------SKKWNSRKLTTVKSSDFIVLPPILVIHLSRFYYDLTRKNNTVITYPLILNVI 630

Query: 954  LKNNEVAKYRLYGIVNHFGNLISGHYTSLVNKDLKHEIRHGQQKWYYFDDEVVKQDNNHG 1013
            LKNN+V +Y+LYG VNH GNL++GHYTS VNK+  HEI   +Q W  FDD+ +KQ ++H 
Sbjct: 631  LKNNKVVRYKLYGTVNHIGNLVNGHYTSDVNKEKNHEIGLNRQVWITFDDDYIKQ-HHHD 689

Query: 1014 DFDAGIASVSSSDVYVLFYERI 1035
            DF+AG   VSSS+VYVLFYER+
Sbjct: 690  DFEAGKTEVSSSEVYVLFYERM 711

 Score =  106 bits (264), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 71/176 (40%), Positives = 101/176 (57%), Gaps = 9/176 (5%)

Query: 11  NELLQFVQDVYAQDIKHYYPXXXXXXXXXXXXHAEYLFESYHMMLKQGNQE-DALTAFII 69
           ++++  V++VY  DIK +Y             HA +LFE Y +   + NQE +ALTAFII
Sbjct: 6   DQVINLVRNVYEVDIKQFYSQLRLKNLRGLLDHAAHLFEVY-LRDSEINQEMEALTAFII 64

Query: 70  GSFYVYLIIPQSIQFHTRNKSYGIYVDLRKYYQDETSMTNVLLMVTKK----VDAILCKS 125
           G +Y+YL+IPQS+QF TRN  Y  Y  L+  YQDE  M+ VL +V ++    VD  L  S
Sbjct: 65  GGYYLYLVIPQSLQFQTRNNLYSSYAKLKNDYQDEQIMSYVLKIVKEESNMIVDRYLSDS 124

Query: 126 RDFDDTKITRKRAYSVPSQALANQLRSLTLNN--TDGLEQLPEVSKESDTLTNYAD 179
                T ITRKRAYS+P + L   + SL++ N   +   + P+VS +S   T+  D
Sbjct: 125 NRISRT-ITRKRAYSLPLRPLPVHMASLSILNQLENPRHETPKVSAKSINDTSVKD 179

>Skud_11.338 Chr11 complement(614651..616789) [2139 bp, 712 aa] {ON}
            YKR098C (REAL)
          Length = 712

 Score =  431 bits (1107), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 223/441 (50%), Positives = 285/441 (64%), Gaps = 18/441 (4%)

Query: 598  PTIEQSSNVYVSLSITGLRNLGSTCYINSMLQCLFATRKFRDIFLSPKYHDYI-SKGYIH 656
            PTIE S  +   LSITGL+N  +TCYINS++QCLF +  FRD+FL+ KY  ++ ++ Y  
Sbjct: 277  PTIEDSKGLLSKLSITGLQNPCNTCYINSIIQCLFGSTPFRDLFLTKKYRLFLKTEEYPK 336

Query: 657  RAQISRSFHMLFKKMYMNGGCSVVPSGFLKACNSMRPDFKIPNXXXXXXXXXXXXXXXXX 716
              Q+SRS + LFKKMY NGG ++VP+GFLK C  +RPD  IP+                 
Sbjct: 337  EVQLSRSIYSLFKKMYANGGSAIVPNGFLKMCKKLRPDLNIPDDQQDTQEFLLIILARIH 396

Query: 717  XXXSDPEQVANDYPQLLLHDDDNLQVDGKEYDKWFEDSISKNGLSPIDSIFQGQMENCLQ 776
               S+ E V   Y  L+ +D + LQV+  +Y KW+E++I  +GLSPID IF+GQMEN L+
Sbjct: 397  EELSN-ENVTKYYCDLVSYDTNALQVNPIKYQKWYEETILADGLSPIDHIFRGQMENILK 455

Query: 777  CQRCGHSSYNYSTFYVLSLAIPTPGTSTF-GKTKKVLLEDCINLFTSDEVLSGENAWDCP 835
            CQRCG+SS++YSTFYVLSLAIP     +F  K+KK+ LEDCINLFTSDE L+G+NAWDCP
Sbjct: 456  CQRCGNSSFSYSTFYVLSLAIPKNSVHSFTSKSKKIKLEDCINLFTSDEELTGDNAWDCP 515

Query: 836  RCGTSMSGSGPGEGKAKKKRKFLLPHDHVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 895
             C    S    GE  ++KKR  L                                     
Sbjct: 516  ECRIDDSKLKTGENSSQKKRSPLFSF--------------HSRSRSKSPHHHHHYHHHGS 561

Query: 896  XXXMPGSEKWKSKKLTTIKTFNFITMPPILVIHLSRFFYDLTKKNSTVITYPLILNIVLK 955
                  S KWKSK+LTTIK+ +FI +PPILVIHLSRF+YDLTKKN+ VITYPLILNI+LK
Sbjct: 562  DNTTKNSNKWKSKRLTTIKSLDFIFLPPILVIHLSRFYYDLTKKNNAVITYPLILNIILK 621

Query: 956  NNEVAKYRLYGIVNHFGNLISGHYTSLVNKDLKHEIRHGQQKWYYFDDEVVKQDNNHGD- 1014
            NN+V +Y+LYG VNH GNLI+GHYTS+VNK+  HEI   +Q W  FDD+ + Q +   D 
Sbjct: 622  NNKVVRYKLYGTVNHSGNLITGHYTSVVNKERSHEIGLNKQVWVTFDDDFIIQHHKDRDG 681

Query: 1015 FDAGIASVSSSDVYVLFYERI 1035
            F+AG   +SSS+VYVLFYER+
Sbjct: 682  FEAGKTKMSSSEVYVLFYERM 702

 Score =  107 bits (268), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 64/151 (42%), Positives = 87/151 (57%), Gaps = 5/151 (3%)

Query: 11  NELLQFVQDVYAQDIKHYYPXXXXXXXXXXXXHAEYLFESYHMMLKQGNQEDALTAFIIG 70
           +++L  V+DVY  DIK +Y             H  +LF+ Y   L+   + +ALTAFIIG
Sbjct: 6   DQILNLVRDVYEVDIKQFYSQLRLKNLRGLVDHTSHLFDVYLRDLEINREVEALTAFIIG 65

Query: 71  SFYVYLIIPQSIQFHTRNKSYGIYVDLRKYYQDETSMTNVLLMV----TKKVDAILCKSR 126
            +Y+YLIIPQS+QF TR+  Y  Y  L+  YQDE  M+ VL +V    T  VD  L  S 
Sbjct: 66  GYYLYLIIPQSLQFQTRSNLYSSYAKLKNSYQDEQLMSYVLRLVRDESTSIVDQYLSDSN 125

Query: 127 DFDDTKITRKRAYSVPSQALANQLRSLTLNN 157
               T ITRKRAYS+P + L   + SL+++N
Sbjct: 126 RITVT-ITRKRAYSLPLRPLPVHMASLSIHN 155

>YKR098C Chr11 complement(633026..635179) [2154 bp, 717 aa] {ON}
            UBP11Ubiquitin-specific protease that cleaves ubiquitin
            from ubiquitinated proteins
          Length = 717

 Score =  418 bits (1074), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 214/443 (48%), Positives = 288/443 (65%), Gaps = 19/443 (4%)

Query: 596  SVPTIEQSSNVYVSLSITGLRNLGSTCYINSMLQCLFATRKFRDIFLSPKYHDYI-SKGY 654
            ++P IE S+++   LSITGL+N  +TCYINS++QCLF T  FRD+FL+ KY  ++ +  Y
Sbjct: 281  NLPVIEDSNDLLSELSITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLNTNKY 340

Query: 655  IHRAQISRSFHMLFKKMYMNGGCSVVPSGFLKACNSMRPDFKIPNXXXXXXXXXXXXXXX 714
                Q+SRS ++LFKKMY+NGG +++P+ FLK C  +RPD  IP+               
Sbjct: 341  PKEVQLSRSIYVLFKKMYLNGGRAIIPNRFLKMCKKLRPDLNIPDDQQDTQEFLLIVLAR 400

Query: 715  XXXXXSDPEQVANDYPQLLLHDDDNLQVDGKEYDKWFEDSISKNGLSPIDSIFQGQMENC 774
                 S+ E V   YP L+ +D + LQV+  +Y+KW+E ++  +GLSPID I++GQ+EN 
Sbjct: 401  IHEELSN-ENVVKYYPDLVSYDANALQVNPSKYEKWYERNVITDGLSPIDHIYRGQLENI 459

Query: 775  LQCQRCGHSSYNYSTFYVLSLAIPTPGTSTF-GKTKKVLLEDCINLFTSDEVLSGENAWD 833
            L+CQRCG+SSY+YSTFYVLSLAIP     +F  K++K+ LEDCINLFT DE LSG+NAWD
Sbjct: 460  LKCQRCGNSSYSYSTFYVLSLAIPKLSLYSFTSKSRKIKLEDCINLFTGDEELSGDNAWD 519

Query: 834  CPRCGTSMSGSGPGEGKAKKKRKFLLPHDHVXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 893
            CP C  + S S   E  ++KK+  +                                   
Sbjct: 520  CPNCRITDSKSKKEEITSQKKKSTIFGF---------------HSRSRSKSPHHHHHHHH 564

Query: 894  XXXXXMPGSEKWKSKKLTTIKTFNFITMPPILVIHLSRFFYDLTKKNSTVITYPLILNIV 953
                    ++K  SKKLTTIK+ +FI +PPILVIHLSRF+YDLTKKNSTVITYPLILNI+
Sbjct: 565  SSDDSTKNAKKRNSKKLTTIKSLDFIVLPPILVIHLSRFYYDLTKKNSTVITYPLILNII 624

Query: 954  LKNNEVAKYRLYGIVNHFGNLISGHYTSLVNKDLKHEIRHGQQKWYYFDDEVVKQ-DNNH 1012
            LKN +V +Y+LYG VNH GNLI+GHYTS+VNK+  HEI   +Q W  FDD+ ++Q   + 
Sbjct: 625  LKNGKVIRYKLYGTVNHSGNLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDYIQQHRKDR 684

Query: 1013 GDFDAGIASVSSSDVYVLFYERI 1035
             +F+AG   +SS +VYVLFYER+
Sbjct: 685  NNFEAGKTEMSSDEVYVLFYERM 707

 Score =  106 bits (264), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 79/207 (38%), Positives = 113/207 (54%), Gaps = 15/207 (7%)

Query: 11  NELLQFVQDVYAQDIKHYYPXXXXXXXXXXXXHAEYLFESYHMMLKQGNQEDALTAFIIG 70
           +++L  V+ VY  DIK +Y             HA +LF  Y   L+   + +ALTAFIIG
Sbjct: 6   DQILNLVRKVYEVDIKQFYSQLRLKNLRGLLDHAAHLFNVYLRDLEINQEMEALTAFIIG 65

Query: 71  SFYVYLIIPQSIQFHTRNKSYGIYVDLRKYYQDETSMTNVLLMV----TKKVDAILCKSR 126
            +Y+YLIIPQS+QF TRN  Y  Y  L+  YQDE  M  VL +V    T  VD  L +S 
Sbjct: 66  CYYLYLIIPQSLQFQTRNNLYSSYAKLKNDYQDEHVMGYVLKVVRDESTVIVDRYLAESN 125

Query: 127 DFDDTKITRKRAYSVPSQALANQLRSLTLNNT-DG-LEQLP-EVSKES--DTLTNYADDY 181
               T I RKRAYS+P + L   + SL+++N  DG L ++P E++K +  ++  +   + 
Sbjct: 126 GICRT-IKRKRAYSLPLRPLPVHMASLSIHNKFDGSLHEIPNELTKPTNDNSKEDIVRES 184

Query: 182 TTIWSAPKLEPDDQL-----KLALNPP 203
             I S+ KLE   ++     K AL+ P
Sbjct: 185 NQIASSNKLEAGSEVAYYTSKEALSKP 211

>Suva_11.335 Chr11 complement(617850..620024) [2175 bp, 724 aa] {ON}
            YKR098C (REAL)
          Length = 724

 Score =  415 bits (1067), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 224/460 (48%), Positives = 293/460 (63%), Gaps = 10/460 (2%)

Query: 576  LSHSKRSQHQHYSPISHQYISVPTIEQSSNVYVSLSITGLRNLGSTCYINSMLQCLFATR 635
            L   ++ + +  S  + +   +P IE S N+   LSITGLRN  +TCYINSM+QCLF+T 
Sbjct: 259  LKSKEQEEEETVSASTSKTFKLPVIENSDNLLSELSITGLRNPCNTCYINSMVQCLFSTT 318

Query: 636  KFRDIFLSPKYHDYI-SKGYIHRAQISRSFHMLFKKMYMNGGCSVVPSGFLKACNSMRPD 694
             FRD+FL+ KY  ++ ++ Y    Q+S S ++LFKKMY+NGG +++P+GFLK C  +RPD
Sbjct: 319  LFRDLFLTKKYKLFLENEKYPKGLQLSHSIYVLFKKMYLNGGRAIIPNGFLKVCKKLRPD 378

Query: 695  FKIPNXXXXXXXXXXXXXXXXXXXXSDPEQVANDYPQLLLHDDDNLQVDGKEYDKWFEDS 754
              IP+                    S+   V   Y  L+L+D   LQV+  +Y KW E++
Sbjct: 379  LNIPDDQQDTQEFLMIILARIHEELSN-NNVTKYYSDLILNDATALQVNPSKYQKWCEET 437

Query: 755  ISKNGLSPIDSIFQGQMENCLQCQRCGHSSYNYSTFYVLSLAIPTPGTSTF-GKTKKVLL 813
            +  +GLSPID IFQGQMEN L+CQRCG+SSY+YSTFYVLSLAIP     +F  K+KK+ L
Sbjct: 438  VLSDGLSPIDHIFQGQMENILKCQRCGNSSYSYSTFYVLSLAIPKASLYSFTSKSKKIKL 497

Query: 814  EDCINLFTSDEVLSGENAWDCPRCGTSMSGSGPGEGKAKKKRKFLLPHDHVXXXXXXXXX 873
            EDCIN FTSDE LS +NAWDCP+C T+       E  ++KKR  L               
Sbjct: 498  EDCINFFTSDEELSDDNAWDCPKCRTAEYKLKKDENLSQKKRSILF------NLHSRPRS 551

Query: 874  XXXXXXXXXXXXXXXXXXXXXXXXXMPGSEKWKSKKLTTIKTFNFITMPPILVIHLSRFF 933
                                        S+KWKSKKLTTIK+ +FI +PPILVIHLSRF+
Sbjct: 552  KSPRHRHHHHHHRHKNDDAKKNDDATKNSKKWKSKKLTTIKSLDFIVLPPILVIHLSRFY 611

Query: 934  YDLTKKNSTVITYPLILNIVLKNNEVAKYRLYGIVNHFGNLISGHYTSLVNKDLKHEIRH 993
            YDLTKKN+TVITYPLILNI+LKNN+V +Y+LY  VNH GNLI+GHYTS+VNK+  HEI  
Sbjct: 612  YDLTKKNNTVITYPLILNIILKNNKVVRYKLYATVNHSGNLINGHYTSVVNKEKSHEIGL 671

Query: 994  GQQKWYYFDDEVVKQDN-NHGDFDAGIASVSSSDVYVLFY 1032
             +Q W  FDD+V+KQ + +  DF+ G   +SS++VYVLFY
Sbjct: 672  NRQVWVTFDDDVIKQHHKDRDDFETGRTEISSNEVYVLFY 711

 Score =  110 bits (276), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 71/173 (41%), Positives = 99/173 (57%), Gaps = 9/173 (5%)

Query: 11  NELLQFVQDVYAQDIKHYYPXXXXXXXXXXXXHAEYLFESYHMMLKQGNQEDALTAFIIG 70
           N++L  V++VY  DIK  Y             HA YLF+ Y   LK   +++ALTAFI+G
Sbjct: 6   NQILSLVREVYDVDIKCVYSQLRLKKLKTLLEHAAYLFDVYVRDLKNNQKKNALTAFIVG 65

Query: 71  SFYVYLIIPQSIQFHTRNKSYGIYVDLRKYYQDETSMTNVLLMV----TKKVDAILCKSR 126
            FY+YL+IP S+QF TRN  Y  Y  L+  YQDE  M+ VL +V    T  VD  L  S+
Sbjct: 66  GFYLYLVIPHSLQFQTRNNVYSSYAKLKNKYQDEQGMSYVLKLVKDESTIIVDQCLSDSK 125

Query: 127 DFDDTKITRKRAYSVPSQALANQLRSLTLNNTDG--LEQLP-EVSKE-SDTLT 175
               + + RKRAYS+P + L   + SL+++N     L ++P E+SK  +DTL 
Sbjct: 126 RISRS-MKRKRAYSLPLRPLPVHMASLSIHNQLDVPLREMPIEISKPINDTLV 177

>KAFR0D02160 Chr4 (432966..435506) [2541 bp, 846 aa] {ON} Anc_5.712
            YIL156W
          Length = 846

 Score =  375 bits (962), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 200/445 (44%), Positives = 273/445 (61%), Gaps = 32/445 (7%)

Query: 597  VPTIEQSSNVYVSLSITGLRNLGSTCYINSMLQCLFATRKFRDIFLSPKYHDYISKGYIH 656
            +P +  SSN+YV LSI+GLRNLG+TCYINSMLQCLFAT  FR++FLS +Y +YI  G   
Sbjct: 430  LPHLPHSSNLYVQLSISGLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEYI--GTKV 487

Query: 657  RAQISRSFHMLFKKMYMNGGCSVVPSGFLKACNSMRPDFKIPNXXX-XXXXXXXXXXXXX 715
               +S SFH+LF+KMY+NGGC+V+P  FLK CN +RPD +IP+                 
Sbjct: 488  DPHLSNSFHILFRKMYLNGGCAVIPVLFLKTCNFLRPDLRIPDVQQDTQEFLILLLDQLH 547

Query: 716  XXXXSDPEQVANDYPQLLLHDDDNLQVD-GKEYDKWFEDSISKNGLSPIDSIFQGQMENC 774
                S+ +++ +++P L+ +D D++ V+   EY KWF +S+   GLS I  IFQGQ+EN 
Sbjct: 548  NELKSNQDRLVSEHPDLIEYDTDSMDVENANEYKKWFAESLENEGLSLIHEIFQGQLENS 607

Query: 775  LQCQRCGHSSYNYSTFYVLSLAIPTPGTSTFGKTKKVL-LEDCINLFTSDEVLSGENAWD 833
            L+CQRC ++S NYS F  LSL+IP        K +K++ LEDCI+LF  +E+L+GENAW+
Sbjct: 608  LECQRCNYTSTNYSNFCTLSLSIPNKRR----KFRKLVDLEDCISLFIENEMLTGENAWN 663

Query: 834  CPRCGTSMSGSGPGEGKAKKKRKFLLPHDHVXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 893
            CP+C +S + +       +K R F     H                              
Sbjct: 664  CPKCSSSSNNN----TSKRKSRGFFKFSKH------------------KNRSHNDLTFSE 701

Query: 894  XXXXXMPGSEKWKSKKLTTIKTFNFITMPPILVIHLSRF-FYDLTKKNSTVITYPLILNI 952
                      K+  KKL T K+ +FI +P +L+IHLSRF    L  KN+T I YP IL I
Sbjct: 702  YNHNSSSDDVKFSKKKLVTRKSTSFIKLPNLLIIHLSRFSMSGLLDKNNTDIAYPAILTI 761

Query: 953  VLKNNEVAKYRLYGIVNHFGNLISGHYTSLVNKDLKHEIRHGQQKWYYFDDEVVKQDNNH 1012
             LKN E  +++LYG+VNHFGNL +GHYTSL+NK+  H++   +QKW+YFDDE VKQ  N+
Sbjct: 762  TLKNKEKCRFKLYGVVNHFGNLNNGHYTSLINKEPSHDLNPQRQKWFYFDDETVKQQFNY 821

Query: 1013 GDFDAGIASVSSSDVYVLFYERIYD 1037
             D D  +  +SSSDVYVLFYE+I +
Sbjct: 822  FDLDKNVNRISSSDVYVLFYEKIIE 846

 Score = 88.2 bits (217), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 54/158 (34%), Positives = 87/158 (55%), Gaps = 9/158 (5%)

Query: 320 LSRLQKQYVISCEELMDILQS-DERNNVLLVDLRISKRFHNNHIVAPNLINIDPRDLWDV 378
           L  L ++  I+  EL  IL +  +R  +L++DLR+S+ F+   I +PNLI  DP +LW+ 
Sbjct: 206 LKHLYEECFITPHELFSILSNPSDRLKILIIDLRLSRYFNLQTIRSPNLIKFDPIELWNN 265

Query: 379 DRKVPISSDVELEKKMGSYQTFQSRSKFKYIVYYTDMKTFLNID-FDYRLVFFQLLYASS 437
             + P+     L     S   FQ    F YI+ Y+D +T    + F+Y   FF+LL +SS
Sbjct: 266 RDQTPVLHRTSL----FSNPLFQKIDLFSYIIIYSDNETTTAFESFEYNFSFFKLLMSSS 321

Query: 438 STRLRSPPKALLGDYEQWKTFIGQYAKHHDIVTGDYLF 475
              ++  P  LLG +E+W+  I  Y++ + I T +Y+F
Sbjct: 322 ---MKVTPNFLLGGFEKWEQLISSYSEQYGIETSNYIF 356

 Score = 74.7 bits (182), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 65/193 (33%), Positives = 91/193 (47%), Gaps = 43/193 (22%)

Query: 10  SNELLQFVQDVYAQDIKHYYPXXXXXXXXXXXXHAEYLFESYHMMLKQGNQEDALTAFII 69
           S+EL + V  +Y   IK  Y             + E LFE +     +GN  D+L +FII
Sbjct: 13  SDELTKLVVSIYNSKIKPIYKQLLTLRPIDLLEYTEQLFEYF----LKGNT-DSLDSFII 67

Query: 70  GSFYVYLIIPQS-IQFHTRNKSY-GIYVDLRKYYQDETSMTNVLLMVTKKVDAILCKSRD 127
           G FY+ L+IP S     + N  Y  IY DL+KYY+ + +++++L ++  + + IL +S D
Sbjct: 68  GYFYISLVIPTSHAMIKSSNNDYIAIYQDLKKYYESQPNLSDLLFIIRSESENIL-QSFD 126

Query: 128 FDDTKITRKRAYSVPSQALANQLRSLTLNNTDGLEQLPEVSKESDTLTNYADDYTTIWSA 187
            D        A S  SQ                         E D   N AD  TTIW A
Sbjct: 127 VD--------APSSHSQ------------------------HEED---NTADSSTTIWQA 151

Query: 188 PKLEPDDQLKLAL 200
           P LEP+DQLKLA+
Sbjct: 152 PFLEPNDQLKLAI 164

>KAFR0H00150 Chr8 (14149..16119) [1971 bp, 656 aa] {ON} Anc_5.712
            YIL156W possible pseudogene; NNN added to avoid internal
            stop codon
          Length = 656

 Score =  357 bits (917), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 211/494 (42%), Positives = 278/494 (56%), Gaps = 43/494 (8%)

Query: 566  TVSH--AHRHRYLSHSKRSQHQHYSPISHQYI--------SVPTIEQSSNVYVSLSITGL 615
            T+SH  ++  R LS  KRS       +S            +VP I+ + N+   LS+ GL
Sbjct: 181  TLSHVPSNPQRTLSTPKRSSTLMTESLSFVLARPAEIKKHTVPIIDATDNIPKMLSLVGL 240

Query: 616  RNLGSTCYINSMLQCLFATRKFRDIFLSPK-YHDYISKGYIHRAQISRSFHMLFKKMYMN 674
            RN G+TCYINSM+QCLF T+  RD+F+S   Y D+I K      +IS  F  L   MY N
Sbjct: 241  RNQGNTCYINSMVQCLFGTKVLRDLFISEXXYKDFIKKD--AETKISEPFARLLLTMYEN 298

Query: 675  GGCSVVPSGFLKACNSMRPDFKIP-NXXXXXXXXXXXXXXXXXXXXSDPEQVANDYPQLL 733
            GG SV+P  FL+  + +RPD  IP +                       + ++N+Y    
Sbjct: 299  GGTSVIPKNFLQQFSLLRPDLNIPKDQQDTQEFLVILLDILHDELVYTDDLISNNY---- 354

Query: 734  LHDDDNLQVDGKEYDKWFEDSISKNGLSPIDSIFQGQMENCLQCQRCGHSSYNYSTFYVL 793
            + DD NL   GKEY  W ++++  NG SPID IFQGQ+ENCLQCQRCG++SYNYS FY+L
Sbjct: 355  VSDDINL---GKEYMPWLQNNLKANGKSPIDLIFQGQIENCLQCQRCGNTSYNYSMFYML 411

Query: 794  SLAIPTPGTSTFGKTKKVLLEDCINLFTSDEVLSGENAWDCPRCGTSM-----SGSGPGE 848
            SLAIP           +V LEDCIN FTSDE+L+GENAW+CP+C  +          P  
Sbjct: 412  SLAIPKIAKE--NSKNRVKLEDCINFFTSDEILTGENAWNCPKCCPTTIETYDEADSPAT 469

Query: 849  GKAKKKRKFLLPHDHVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPGSEKWKSK 908
             + + K K + P +                                         K+K++
Sbjct: 470  VENRVKNKSINPLNFFKLHKVLSPSSGNHHRHHHHHHHHKSDGKN--------KNKYKNE 521

Query: 909  KLTTIKTFNFITMPPILVIHLSRFFYDLTKKNSTVITYPLILNIVLKNN-EVAKYRLYGI 967
            KL T+K  NFI +PPILVIHLSRF+Y+ TKKN+ VITYPLILNI++KNN +V KY+LYG+
Sbjct: 522  KLITLKQLNFIKLPPILVIHLSRFYYNSTKKNNAVITYPLILNIIMKNNIDVVKYKLYGL 581

Query: 968  VNHFGNLISGHYTSLVNKDLKHEIRHGQQKWYYFDDEVVKQDNNHG------DFDAGIAS 1021
            +NH G L  GHYTS+VNKDL H +   +Q+WY FDDEV+K+ N++        F+     
Sbjct: 582  INHQGGLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKKLNSNNTINKKESFNIEKDE 641

Query: 1022 VSSSDVYVLFYERI 1035
              SS VYVLFYERI
Sbjct: 642  FDSSKVYVLFYERI 655

 Score = 78.6 bits (192), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 45/134 (33%), Positives = 71/134 (52%), Gaps = 1/134 (0%)

Query: 11  NELLQFVQDVYAQDIKHYYPXXXXXXXXXXXXHAEYLFESYHMMLK-QGNQEDALTAFII 69
           ++L   V  ++  DIK YY             H  YL + + +    +  +  A  AF+ 
Sbjct: 28  DDLPSLVDSIFQHDIKDYYTKLRLERLNDLLDHTTYLLDLFKVYTSHKSRKRQATLAFVN 87

Query: 70  GSFYVYLIIPQSIQFHTRNKSYGIYVDLRKYYQDETSMTNVLLMVTKKVDAILCKSRDFD 129
           GSFY++LIIP  +QF T+NK +  Y DL+  Y+ + SM N+L  V +K  +IL +     
Sbjct: 88  GSFYLFLIIPYCVQFQTKNKLFTRYKDLKIDYEGQISMKNILDTVKEKSVSILEQDLSGI 147

Query: 130 DTKITRKRAYSVPS 143
           + +I +KRAY+ PS
Sbjct: 148 NRRILKKRAYTEPS 161

>Skud_9.12 Chr9 (25211..28402) [3192 bp, 1064 aa] {ON} YIL156W
           (REAL)
          Length = 1064

 Score =  348 bits (892), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 210/492 (42%), Positives = 275/492 (55%), Gaps = 54/492 (10%)

Query: 5   YTPEYSNELLQFVQDVYAQDIKHYYPXXXXXXXXXXXXHAEYLFESYHMMLKQGNQEDAL 64
           +TPEYSNELL+ VQD+Y +DIKHYYP            H EYL+E Y   ++     DAL
Sbjct: 8   FTPEYSNELLRRVQDLYHEDIKHYYPQLKLEKLLDLLEHTEYLYELYLDSMRHNRPNDAL 67

Query: 65  TAFIIGSFYVYLIIPQSIQFHTRNKSYGIYVDLRKYYQDETSMTNVLLMVTKKVDAILCK 124
           TAFIIG +YV+LIIPQS+QF TRNKSY IY DL+K Y++E +MTNV+LMV K++  +L +
Sbjct: 68  TAFIIGCYYVFLIIPQSLQFQTRNKSYSIYTDLKKMYENEMNMTNVVLMVKKEIGVVLDE 127

Query: 125 SRDFD---DTKITRKRAYSVPSQALANQLRSLTLNNTDGLEQLPEVS-KESDTLTNYADD 180
           S       + +IT+KRA+SVP+  L+ Q+ SL+L N        + S  E D     A+ 
Sbjct: 128 SVKHAVGIEHRITKKRAFSVPANDLSGQVASLSLENAGPHGHGFKASFTEED-----AEQ 182

Query: 181 YTTIWSAPKLEPDDQLKLALNPPXXXXXXXXXXXXFVMDQHSKKFSIGESSSDEFEPIPT 240
            + +W+AP LEP+DQLKLAL P                         G  +S    P   
Sbjct: 183 SSPVWTAPNLEPNDQLKLALLPEVIPTPIYPES--------------GRKTSSPVRPSVL 228

Query: 241 QEALPMDHATPSEISQRTRHHSIVSSNDTGKSRKDSVESVANIYVQNVDRYNTHRKDSYH 300
            E +P +                    D G S      S   I    VDR  THRKDSYH
Sbjct: 229 LEDVPYN------------------CYDGGASSASLNPSFGEI---TVDRSITHRKDSYH 267

Query: 301 SVYM-----LNEDDD----TNEYDFFQNLSRLQKQYVISCEELMDIL-QSDERNNVLLVD 350
           S+YM     L ED+D        +F Q+L  LQKQ +I+  EL  IL  S ER  +LL+D
Sbjct: 268 SIYMVDSDTLKEDNDDLLNVETDEFIQSLDILQKQSIITAPELFSILSNSIEREKILLID 327

Query: 351 LRISKRFHNNHIVAPNLINIDPRDLWDVDRKVPISSDVELEKKMGSYQTFQSRSKFKYIV 410
           LRI +R   NHIVAPNL+ IDP  LWD     P+  D  LE  +   + F +R KF+Y+V
Sbjct: 328 LRIPRRSEINHIVAPNLVKIDPNLLWDRKTNTPVYQDDILEHLLEENEIFINRDKFEYVV 387

Query: 411 YYTDMKTFLNIDFDYRLVFFQLLYASSSTRLRSPPKALLGDYEQWKTFIGQYAKHHDIVT 470
           YYTD+KTF+ ++FDY  +FF L+  S  T L S P ALLG YE+WK  +  YA+ +D+  
Sbjct: 388 YYTDVKTFMYMNFDYVFIFFYLMLTSQKTHLTSVPTALLGGYEKWKKTLHTYAQEYDVSI 447

Query: 471 GDYLFRPYASSA 482
            DYL+RPY+  A
Sbjct: 448 EDYLYRPYSQKA 459

 Score =  313 bits (801), Expect = 6e-90,   Method: Compositional matrix adjust.
 Identities = 158/297 (53%), Positives = 200/297 (67%), Gaps = 16/297 (5%)

Query: 558 QPPMPQVTTVSHAHRH-RYLSHSKRSQ--HQHYSPISH-----QYISVPTIEQSSNVYVS 609
           +PP+P    V     +   +   KR Q  H+HY          +  ++PTIEQSSNVYVS
Sbjct: 538 KPPIPAKQHVKKQQLNSNEIIQRKRQQQKHRHYGQQLLQPQPQRAYNIPTIEQSSNVYVS 597

Query: 610 LSITGLRNLGSTCYINSMLQCLFATRKFRDIFLSPKYHDYIS--KGY--IHRAQISRSFH 665
           LSITGLRNLG+TCYINSM+QCLFA + FR +F+S  Y +Y+   KG    H +++S S +
Sbjct: 598 LSITGLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYLQPPKGSRSAHSSKLSNSLN 657

Query: 666 MLFKKMYMNGGCSVVPSGFLKACNSMRPDFKIPNXXXXXXXXXXXXXXXXXXXXSDPEQV 725
           MLF KMY+NGGCSVVP+GFLK  N +RPD KIP+                    S+ + V
Sbjct: 658 MLFNKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQQHV 717

Query: 726 ANDYPQLLLHDDDNLQVDGKEYDKWFEDSISKNGLSPIDSIFQGQMENCLQCQRCGHSSY 785
           ANDYP LLL++ D L+V   EY  WF+ ++  NG+SPID IFQGQMEN LQC+RCG++++
Sbjct: 718 ANDYPNLLLYNADALKVSNNEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRCGYTTF 777

Query: 786 NYSTFYVLSLAIP--TPGTSTFGKT--KKVLLEDCINLFTSDEVLSGENAWDCPRCG 838
           NYSTFYVLSLAIP  +   S  G++  K+V LEDCIN+FT DEVLSGENAWDCPRCG
Sbjct: 778 NYSTFYVLSLAIPRRSMKLSKLGRSTEKRVKLEDCINMFTDDEVLSGENAWDCPRCG 834

 Score =  206 bits (523), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 98/133 (73%), Positives = 115/133 (86%), Gaps = 2/133 (1%)

Query: 905  WKSKKLTTIKTFNFITMPPILVIHLSRFFYDLTKKNSTVITYPLILNIVLKNNEVAKYRL 964
            +K+KKLTT+KT NF+T+P ILVIHLSRF+YDLTKKNSTVITYPLILNI+LKNNE  KYRL
Sbjct: 933  FKNKKLTTVKTINFVTLPKILVIHLSRFYYDLTKKNSTVITYPLILNIILKNNETMKYRL 992

Query: 965  YGIVNHFGNLISGHYTSLVNKDLKHEIRHGQQKWYYFDDEVVKQDNNHGDFDAGIASVSS 1024
            +G+VNH G L+SGHYTSLVNKDL+H +  G+ KWYYFDDEVVK DN HG  D  +  +SS
Sbjct: 993  FGVVNHTGTLVSGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADNKHGS-DKNL-KISS 1050

Query: 1025 SDVYVLFYERIYD 1037
            SDVYVLFYER++D
Sbjct: 1051 SDVYVLFYERVHD 1063

>Smik_9.13 Chr9 (25877..29059) [3183 bp, 1060 aa] {ON} YIL156W
           (REAL)
          Length = 1060

 Score =  345 bits (886), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 207/493 (41%), Positives = 280/493 (56%), Gaps = 52/493 (10%)

Query: 5   YTPEYSNELLQFVQDVYAQDIKHYYPXXXXXXXXXXXXHAEYLFESYHMMLKQGNQEDAL 64
           +TPEYS+ELL+ VQD+Y +DIKHYYP            H EYLFE Y   +  G   DAL
Sbjct: 8   FTPEYSDELLRRVQDLYHEDIKHYYPQLKLEKLLDLLEHTEYLFELYLDSMHHGRPNDAL 67

Query: 65  TAFIIGSFYVYLIIPQSIQFHTRNKSYGIYVDLRKYYQDETSMTNVLLMVTKKVDAILCK 124
           TAF+IG +YV+LIIPQS+QF TRNKSY IY DL+K Y++E +MTNV+LMV K++  +L +
Sbjct: 68  TAFVIGCYYVFLIIPQSLQFQTRNKSYSIYTDLKKMYENEMNMTNVVLMVKKEIGVVLDE 127

Query: 125 SRDF---DDTKITRKRAYSVPSQALANQLRSLTLNNTDGLEQLPEVSKESDTLTNYADDY 181
           S       + +I +KRA+SVP+  L+ Q+ SL+L+     +   +V    D +    D  
Sbjct: 128 SVKHVVGIEHRINKKRAFSVPANDLSGQVASLSLDTAGPQQHNIKVPLTEDDM----DQS 183

Query: 182 TTIWSAPKLEPDDQLKLALNPPXXXXXXXXXXXXFVMDQHSKKFSIGESSSDEFEPIPTQ 241
           + +W+AP LEP+DQLKLAL P                        I  S+ +E E   T 
Sbjct: 184 SPVWTAPNLEPNDQLKLALLPEV----------------------IPTSTFNEPERKSTS 221

Query: 242 EALPMDHATPSEISQRTRHHSIVSSNDTGKSRKDSVESVANIYVQNVDRYNTHRKDSYHS 301
            A P   +   E    T H +  S+       +D             DR  THRKDSYHS
Sbjct: 222 PARP---SVLLEDVPCTYHDNDASTASLNPPFRDIT----------ADRSVTHRKDSYHS 268

Query: 302 VYMLNED---DDTNEY------DFFQNLSRLQKQYVISCEELMDILQSD-ERNNVLLVDL 351
           VYM++ D   +D +E+       F Q+L  LQKQ +I+  EL  IL +  ER  VLL+DL
Sbjct: 269 VYMVDSDNLKEDNDEFLNVENDGFIQSLDILQKQSIITAPELFSILSNRVEREKVLLIDL 328

Query: 352 RISKRFHNNHIVAPNLINIDPRDLWDVDRKVPISSDVELEKKMGSYQTFQSRSKFKYIVY 411
           RI +R   NHIVAPNL+ +DP  LWD     P+  D  LE  +   + F +R KF YIVY
Sbjct: 329 RIPQRSAVNHIVAPNLVKVDPNLLWDKKTNTPVYQDDILEHLLKENENFANRDKFDYIVY 388

Query: 412 YTDMKTFLNIDFDYRLVFFQLLYASSSTRLRSPPKALLGDYEQWKTFIGQYAKHHDIVTG 471
           Y+D+KTF+ I+FDY  +FF L+  S  T L + P ALLG YE+WK  +  YA+ + I   
Sbjct: 389 YSDVKTFMTINFDYVFIFFYLMLTSQKTPLTTVPTALLGGYEKWKKTLHSYAQEYHISVE 448

Query: 472 DYLFRPYASSAKS 484
           DYL+RPY+  A++
Sbjct: 449 DYLYRPYSQKARA 461

 Score =  317 bits (811), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 156/294 (53%), Positives = 197/294 (67%), Gaps = 13/294 (4%)

Query: 558 QPPMPQVTTVSHAHRHRYLSHSKRSQHQHYS-----PISHQYISVPTIEQSSNVYVSLSI 612
           +PP+P    V     +      ++ Q QHY      P+  +  S+PTIE++ NVYVSLSI
Sbjct: 538 KPPIPAKQHVKKKQSNSNEIIQRKRQQQHYGQQLLQPLPPKDYSIPTIERNPNVYVSLSI 597

Query: 613 TGLRNLGSTCYINSMLQCLFATRKFRDIFLSPKYHDYI----SKGYIHRAQISRSFHMLF 668
           TGLRNLG+TCYINSM+QCLFA + FR +F+S  Y +Y+    S    H  ++S S  MLF
Sbjct: 598 TGLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLASNRPHHSPKLSNSLSMLF 657

Query: 669 KKMYMNGGCSVVPSGFLKACNSMRPDFKIPNXXXXXXXXXXXXXXXXXXXXSDPEQVAND 728
            KMY+NGGCSVVP+GFLK  N +RPD KIP+                    S+ + VAND
Sbjct: 658 NKMYLNGGCSVVPTGFLKVINQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQQHVAND 717

Query: 729 YPQLLLHDDDNLQVDGKEYDKWFEDSISKNGLSPIDSIFQGQMENCLQCQRCGHSSYNYS 788
           YP LLL++ D L+V   EY  WF+ ++  NG+SPID IFQGQMEN LQC+RCG++++NYS
Sbjct: 718 YPNLLLYNADVLKVSNNEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRCGYTTFNYS 777

Query: 789 TFYVLSLAIPTPGT--STFGKT--KKVLLEDCINLFTSDEVLSGENAWDCPRCG 838
           TFYVLSLAIPT     S  G++  K+V LEDCIN+FTSDEVLSGENAWDCPRCG
Sbjct: 778 TFYVLSLAIPTRSMKLSKLGRSTEKRVKLEDCINMFTSDEVLSGENAWDCPRCG 831

 Score =  202 bits (513), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 96/133 (72%), Positives = 114/133 (85%), Gaps = 2/133 (1%)

Query: 905  WKSKKLTTIKTFNFITMPPILVIHLSRFFYDLTKKNSTVITYPLILNIVLKNNEVAKYRL 964
            +K+KK+TT+KT NF+T+P ILVIHLSRF+YDLTKKN+TVITYPLILNI+LKNN+  KYRL
Sbjct: 930  FKNKKMTTVKTINFVTLPKILVIHLSRFYYDLTKKNNTVITYPLILNIILKNNDTMKYRL 989

Query: 965  YGIVNHFGNLISGHYTSLVNKDLKHEIRHGQQKWYYFDDEVVKQDNNHGDFDAGIASVSS 1024
            +G+VNH G LISGHYTSLVNKDL+H +  G+ KWYYFDDEVVK D  HG  D  +  +SS
Sbjct: 990  FGVVNHTGTLISGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADKKHGS-DKNL-KISS 1047

Query: 1025 SDVYVLFYERIYD 1037
            SDVYVLFYER+YD
Sbjct: 1048 SDVYVLFYERVYD 1060

>Suva_9.30 Chr9 (41061..42434,42912..44726) [3189 bp, 1062 aa] {ON}
           YIL156W (REAL)
          Length = 1062

 Score =  337 bits (865), Expect = 9e-99,   Method: Compositional matrix adjust.
 Identities = 203/489 (41%), Positives = 274/489 (56%), Gaps = 54/489 (11%)

Query: 4   SYTPEYSNELLQFVQDVYAQDIKHYYPXXXXXXXXXXXXHAEYLFESYHMMLKQGNQEDA 63
           S+TPEYSNELL+ V+D+Y +DIKHYYP            H EYLFE Y   ++     DA
Sbjct: 7   SFTPEYSNELLRRVRDLYHEDIKHYYPQLKLEKLLDLLEHTEYLFELYLDSMRHERPNDA 66

Query: 64  LTAFIIGSFYVYLIIPQSIQFHTRNKSYGIYVDLRKYYQDETSMTNVLLMVTKKVDAIL- 122
           LTAF+IG +YV+LIIPQS+QF TRNKSY IY DL+K Y++E +MTNV+LMV K++  +L 
Sbjct: 67  LTAFVIGCYYVFLIIPQSLQFQTRNKSYSIYSDLKKMYENEMNMTNVVLMVKKEIGVVLD 126

Query: 123 --CKSRDFDDTKITRKRAYSVPSQALANQLRSLTLNNTDGLEQLPEVSKESDTLTNYADD 180
              K     + +IT+KRA+SVP   L++QL SL+L+       L + S   +     AD 
Sbjct: 127 DSVKHVVGIEHRITKKRAFSVPGIDLSDQLASLSLDAAGPRGHLHKTSSTEED----ADQ 182

Query: 181 YTTIWSAPKLEPDDQLKLALNPPXXXXXXXXXXXXFVMDQHSKKFSIGESSSDEFEPIPT 240
            + +W+AP LEP+DQLKLAL P                                 E IPT
Sbjct: 183 SSPVWTAPNLEPNDQLKLALLP---------------------------------EVIPT 209

Query: 241 QEALPMDHATPSEISQRTRHHSI-VSSNDTGKSRKDSVESVANIYVQNVDRYNTHRKDSY 299
                    T + + Q      +  + ND   +   S +    I     DR  THRKDSY
Sbjct: 210 PAFPESGRKTSTPVRQSVLLEDVPYTHNDNDGTSASSDQPFGEI---TADRSVTHRKDSY 266

Query: 300 HSVYMLNEDDDTNEYD---------FFQNLSRLQKQYVISCEELMDILQS-DERNNVLLV 349
           HSVYM++ D   ++ D         F Q+L  LQKQ +I+  EL  IL +  E   +LL+
Sbjct: 267 HSVYMVDSDTFKSDNDDLLDVETDGFIQSLEILQKQSIITAPELFTILSNQSESEKLLLI 326

Query: 350 DLRISKRFHNNHIVAPNLINIDPRDLWDVDRKVPISSDVELEKKMGSYQTFQSRSKFKYI 409
           DLRI +R   N+IVAPNL+ IDP  LWD     P+  D  LE+ +   + F +R KF+Y+
Sbjct: 327 DLRIPQRSALNNIVAPNLVKIDPNLLWDKKTNKPVYQDDILEQLLEGNEHFINRDKFQYV 386

Query: 410 VYYTDMKTFLNIDFDYRLVFFQLLYASSSTRLRSPPKALLGDYEQWKTFIGQYAKHHDIV 469
           V Y+D+KTF+ ++FDY  +FF LL  S  TRL + P ALLG YE+WK  +  YA+ + I 
Sbjct: 387 VCYSDVKTFMTMNFDYSFIFFYLLLTSQKTRLATVPTALLGGYEKWKKTLHTYAQQYHIS 446

Query: 470 TGDYLFRPY 478
             DYL+RPY
Sbjct: 447 IDDYLYRPY 455

 Score =  315 bits (807), Expect = 7e-91,   Method: Compositional matrix adjust.
 Identities = 151/249 (60%), Positives = 183/249 (73%), Gaps = 7/249 (2%)

Query: 597 VPTIEQSSNVYVSLSITGLRNLGSTCYINSMLQCLFATRKFRDIFLSPKYHDYI--SKG- 653
           +PTIEQSSN YVSLSITGLRNLG+TCYINSM+QCLFA + FR +F+S KY  Y+  S+G 
Sbjct: 586 IPTIEQSSNAYVSLSITGLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQSRGN 645

Query: 654 YIHRAQISRSFHMLFKKMYMNGGCSVVPSGFLKACNSMRPDFKIPNXXXXXXXXXXXXXX 713
            +H  ++S S +MLF KMY+NGGCSVVP+GFLK  N +RPD KIP+              
Sbjct: 646 RLHSPRLSNSLNMLFDKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLD 705

Query: 714 XXXXXXSDPEQVANDYPQLLLHDDDNLQVDGKEYDKWFEDSISKNGLSPIDSIFQGQMEN 773
                 S+   VANDYP LLL+D D L+V  KEY  WF+ ++  NG+SPID IFQGQMEN
Sbjct: 706 RLHDELSNQPHVANDYPNLLLYDADGLKVSNKEYKHWFDKNVIGNGISPIDDIFQGQMEN 765

Query: 774 CLQCQRCGHSSYNYSTFYVLSLAIP--TPGTSTFGK--TKKVLLEDCINLFTSDEVLSGE 829
            LQC+RCG++++NYSTFYVLSLAIP  +   S  G+   K+V LEDCIN+FTSDEVLSGE
Sbjct: 766 SLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRPNEKRVKLEDCINMFTSDEVLSGE 825

Query: 830 NAWDCPRCG 838
           NAWDCPRCG
Sbjct: 826 NAWDCPRCG 834

 Score =  199 bits (506), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 95/133 (71%), Positives = 113/133 (84%), Gaps = 2/133 (1%)

Query: 905  WKSKKLTTIKTFNFITMPPILVIHLSRFFYDLTKKNSTVITYPLILNIVLKNNEVAKYRL 964
            +K+KKLTT+KT NF+T+P ILVIHLSRF+YDLTKKN+TVITYPLILNI+LKNN+  KYRL
Sbjct: 932  FKNKKLTTVKTINFVTLPKILVIHLSRFYYDLTKKNNTVITYPLILNIILKNNDTMKYRL 991

Query: 965  YGIVNHFGNLISGHYTSLVNKDLKHEIRHGQQKWYYFDDEVVKQDNNHGDFDAGIASVSS 1024
            +G+VNH G LISGHYTSLVNKDL+H +  G+ KWYYFDDEVVK D  HG  D  +  +SS
Sbjct: 992  FGVVNHTGTLISGHYTSLVNKDLEHNVDIGRSKWYYFDDEVVKADKKHGS-DKSLK-ISS 1049

Query: 1025 SDVYVLFYERIYD 1037
            SD YVLFYER++D
Sbjct: 1050 SDAYVLFYERVHD 1062

>YIL156W Chr9 (48091..51306) [3216 bp, 1071 aa] {ON}
           UBP7Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 1071

 Score =  332 bits (851), Expect = 8e-97,   Method: Compositional matrix adjust.
 Identities = 212/494 (42%), Positives = 279/494 (56%), Gaps = 56/494 (11%)

Query: 5   YTPEYSNELLQFVQDVYAQDIKHYYPXXXXXXXXXXXXHAEYLFESYHMMLKQGNQEDAL 64
           +TPEYSNELL+ VQD+Y +DIKHYYP            H EYLFE Y   +      DAL
Sbjct: 17  FTPEYSNELLRRVQDLYHEDIKHYYPQLKLEKLLDLLEHTEYLFELYLDSIHHDRPNDAL 76

Query: 65  TAFIIGSFYVYLIIPQSIQFHTRNKSYGIYVDLRKYYQDETSMTNVLLMVTKKVDAILCK 124
           TAFIIG +YV+LIIPQS+QF TRNKSY IY DL+K Y++E +MTNV+LMV K++  +L +
Sbjct: 77  TAFIIGCYYVFLIIPQSLQFQTRNKSYSIYTDLKKMYENEMNMTNVVLMVKKEIGVVLDE 136

Query: 125 SRDFD---DTKITRKRAYSVPSQALANQLRSLTLNNTDGLEQLPEVSKESDTLT-NYADD 180
           S       + +IT+KRA+SVP+  L+ Q+ SL+L+        P+      T T + A+ 
Sbjct: 137 SVKHGAGIEHRITKKRAFSVPADDLSGQVASLSLDTA-----APQDHGLKGTFTEDDAEQ 191

Query: 181 YTTIWSAPKLEPDDQLKLALNPPXXXXXXXXXXXXFVMDQHSKKFSIGESSSDEFEPIPT 240
            + +W+AP LEP+DQLKLAL P                 +  +K S+    S   E +P 
Sbjct: 192 SSPVWTAPNLEPNDQLKLALLPEVIPTP--------AFREPERKTSVPVRPSVLLEDVP- 242

Query: 241 QEALPMDHATPSEISQRTRHHSIVSSNDTGKSRKDSVESVANIYVQ-NVDRYNTHRKDSY 299
                                SI   +DT      S  S+   + +   DR  THRKDSY
Sbjct: 243 ---------------------SIYHEDDT------SFASLNPPFREITADRSVTHRKDSY 275

Query: 300 HSVYM-----LNEDDD----TNEYDFFQNLSRLQKQYVISCEELMDILQSD-ERNNVLLV 349
           HSVYM     L ED+D         F Q+L  LQKQ +I+  EL  IL +  ER  VLL+
Sbjct: 276 HSVYMVDSGNLKEDNDDLFNVENDGFIQSLDILQKQSIITAPELFSILSNRVEREKVLLI 335

Query: 350 DLRISKRFHNNHIVAPNLINIDPRDLWDVDRKVPISSDVELEKKMGSYQTFQSRSKFKYI 409
           DLRI +R   NHIVAPNL+N+DP  LWD     PI  D  LE  +   + F +R+KF YI
Sbjct: 336 DLRIPQRSAINHIVAPNLVNVDPNLLWDKQTNTPIYKDDILEHLLKENENFINRNKFDYI 395

Query: 410 VYYTDMKTFLNIDFDYRLVFFQLLYASSSTRLRSPPKALLGDYEQWKTFIGQYAKHHDIV 469
           VYYTD+KTF+ I+FDY  +FF L+  S  T L + P  LLG YE+WK  +  YA+ + I 
Sbjct: 396 VYYTDVKTFMTINFDYAFIFFYLMLTSQKTPLTTVPTTLLGGYEKWKKTLHSYAQEYHIS 455

Query: 470 TGDYLFRPYASSAK 483
             DYL+RPY+  A+
Sbjct: 456 IEDYLYRPYSQKAR 469

 Score =  313 bits (803), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 150/257 (58%), Positives = 185/257 (71%), Gaps = 8/257 (3%)

Query: 596 SVPTIEQSSNVYVSLSITGLRNLGSTCYINSMLQCLFATRKFRDIFLSPKYHDYI----S 651
           ++PTIE+S NVYVSLSITGLRNLG+TCYINSM+QCLFA + FR +F+S KY  Y+    S
Sbjct: 592 NIPTIERSPNVYVSLSITGLRNLGNTCYINSMIQCLFAAKTFRTLFISSKYKSYLQPIRS 651

Query: 652 KGYIHRAQISRSFHMLFKKMYMNGGCSVVPSGFLKACNSMRPDFKIPNXXXXXXXXXXXX 711
            G  +  ++S S  MLF KMY+NGGCSVVP+GFLK  N +RPD KIP+            
Sbjct: 652 NGSHYSPKLSNSLSMLFNKMYLNGGCSVVPTGFLKVINQLRPDLKIPDDQQDTQEFLMIL 711

Query: 712 XXXXXXXXSDPEQVANDYPQLLLHDDDNLQVDGKEYDKWFEDSISKNGLSPIDSIFQGQM 771
                   SD + VANDYP LLL++ D L+V   EY  WF+ ++  NG+SPID IFQGQM
Sbjct: 712 LDRLHDELSDQQHVANDYPNLLLYNADALKVSNNEYKHWFDKNVIGNGISPIDDIFQGQM 771

Query: 772 ENCLQCQRCGHSSYNYSTFYVLSLAIP--TPGTSTFGKT--KKVLLEDCINLFTSDEVLS 827
           EN LQC+RCG++++NYSTFYVLSLAIP  +   S  G++  K+V LEDCIN+FTSDEVLS
Sbjct: 772 ENSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRSTEKRVKLEDCINMFTSDEVLS 831

Query: 828 GENAWDCPRCGTSMSGS 844
           GENAWDCPRCG + S S
Sbjct: 832 GENAWDCPRCGPTASVS 848

 Score =  202 bits (515), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 96/137 (70%), Positives = 115/137 (83%), Gaps = 2/137 (1%)

Query: 901  GSEKWKSKKLTTIKTFNFITMPPILVIHLSRFFYDLTKKNSTVITYPLILNIVLKNNEVA 960
             S  +K+KKLTT+KT NF+T+P ILVIHLSRF+YDLTKKN+TV+TYPLILNI+LKNN+  
Sbjct: 937  NSSDYKNKKLTTVKTINFVTLPKILVIHLSRFYYDLTKKNNTVVTYPLILNIILKNNDTM 996

Query: 961  KYRLYGIVNHFGNLISGHYTSLVNKDLKHEIRHGQQKWYYFDDEVVKQDNNHGDFDAGIA 1020
            KY+L+G+VNH G LISGHYTSLVNKDL+H +  G+ KWYYFDDEVVK D  HG  D  + 
Sbjct: 997  KYKLFGVVNHTGTLISGHYTSLVNKDLEHNVNIGRSKWYYFDDEVVKADRKHGS-DKNL- 1054

Query: 1021 SVSSSDVYVLFYERIYD 1037
             +SSSDVYVLFYER+YD
Sbjct: 1055 KISSSDVYVLFYERVYD 1071

>CAGL0G02563g Chr7 complement(235498..237393) [1896 bp, 631 aa] {ON}
            weakly similar to uniprot|P36026 Saccharomyces cerevisiae
            YKR098c UBP11 ubiquitin C-terminal hydrolase
          Length = 631

 Score =  313 bits (803), Expect = 5e-94,   Method: Compositional matrix adjust.
 Identities = 165/454 (36%), Positives = 248/454 (54%), Gaps = 12/454 (2%)

Query: 588  SPI-----SHQYISVPTIEQSSNVYVSLSITGLRNLGSTCYINSMLQCLFATRKFRDIFL 642
            SPI     S QY ++P I  +      LS+ G+RN+G+TCY+NSMLQCLF + +FRD+FL
Sbjct: 184  SPIDIDHDSKQY-TLPIIINAITEEQKLSVFGIRNMGNTCYMNSMLQCLFGSTQFRDLFL 242

Query: 643  SPKYHDYISKGYIHRAQISRSFHMLFKKMYMNGGCSVVPSGFLKACNSMRPDFKIPNXXX 702
            + K+  + ++       I+    +LFKKMY NGGC+++P  F++ C  +RPDFKIP+   
Sbjct: 243  TDKFEMFKAETNSESLSIANDLSLLFKKMYQNGGCAIIPKSFMETCKRLRPDFKIPHCQQ 302

Query: 703  XXXXXXXXXXXXXXXXXSDPEQVANDYPQLLLHDDDNLQVDGKEYDKWFEDSISKNGLSP 762
                             ++      D   +    ++      K Y +W+ + IS+N LSP
Sbjct: 303  DTQEFLMFVLERLRVELANTSATVKDRSLIASRSNNRYLKKNKNYLRWYNEMISRNNLSP 362

Query: 763  IDSIFQGQMENCLQCQRCGHSSYNYSTFYVLSLAIPTPGTSTFGKTKKVLLEDCINLFTS 822
            ID +F+G +E+ L C+ C  S+  +S+FY+LSL IP   +S F K+K + LEDCINLFT 
Sbjct: 363  IDLLFRGDVESKLICKHCNESASTFSSFYILSLNIPKEKSSLFFKSKTIRLEDCINLFTR 422

Query: 823  DEVLSGENAWDCPRCGTSMSGSGPGEGKAKKKRKFLLPHDHVXXXXXXXXXXXXXXXXXX 882
             E+L+GEN+W CP C T    +     K  +++     H ++                  
Sbjct: 423  KEILTGENSWACPSCETKARYNVIDNDKTYQQK-----HTNIGKHSKFPRFFSHIEAGKT 477

Query: 883  XXXXXXXXXXXXXXXXMPGSEKWK-SKKLTTIKTFNFITMPPILVIHLSRFFYDLTKKNS 941
                            +   ++ +  KK  TI + +F+++PPILVIHLSRF YD++KKN+
Sbjct: 478  ERNSGANKFSQLKYDNLENEQRHRQQKKSETILSVSFVSLPPILVIHLSRFCYDISKKNT 537

Query: 942  TVITYPLILNIVLKNNEVAKYRLYGIVNHFGNLISGHYTSLVNKDLKHEIRHGQQKWYYF 1001
            + I+YP+ L +   +N    YRLYG +NH G+   GHYT+LVNK+  H      QKW  F
Sbjct: 538  SNISYPMSLTVETLDNSSVTYRLYGTINHIGSPRGGHYTALVNKEKNHFTDLELQKWVEF 597

Query: 1002 DDEVVKQDNNHGDFDAGIASVSSSDVYVLFYERI 1035
            DD++V    +       I S++++D YVLFYERI
Sbjct: 598  DDDLVFNRTDFFKSKTEINSITNNDAYVLFYERI 631

 Score = 39.3 bits (90), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 21/89 (23%), Positives = 35/89 (39%)

Query: 13  LLQFVQDVYAQDIKHYYPXXXXXXXXXXXXHAEYLFESYHMMLKQGNQEDALTAFIIGSF 72
           L   V  V+   IK  Y              A    +    + ++   E +   +  G F
Sbjct: 13  LKSLVSQVFETSIKKQYWVLTLCKVSQLLGQAAKYLDKTETLGQEKLLESSYMNYAAGCF 72

Query: 73  YVYLIIPQSIQFHTRNKSYGIYVDLRKYY 101
           Y+YL++P + QF   +  YG Y+ L+  Y
Sbjct: 73  YIYLLVPNANQFQLEDTEYGTYLQLKNNY 101

>KNAG0L02200 Chr12 complement(394140..397625) [3486 bp, 1161 aa]
           {ON} Anc_5.712 YIL156W
          Length = 1161

 Score =  323 bits (829), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 153/271 (56%), Positives = 199/271 (73%), Gaps = 9/271 (3%)

Query: 576 LSHSKRSQHQHYSPIS---HQYISVPTIEQSSNVYVSLSITGLRNLGSTCYINSMLQCLF 632
           ++ +KR Q + +   +   H+  S+PTIEQ+ N+YVSLSITGLRNLG+TCYINSM+QCLF
Sbjct: 651 VAPTKRIQQEPFRSATNGLHETYSIPTIEQNPNIYVSLSITGLRNLGNTCYINSMIQCLF 710

Query: 633 ATRKFRDIFLSPKYHDYIS----KGYIHRAQ--ISRSFHMLFKKMYMNGGCSVVPSGFLK 686
           AT+ FR++F+S KY +++     K   + +Q  ISR+F++LFKKMY+NGGCSVVP  FLK
Sbjct: 711 ATKSFRNLFISMKYKEFLKEVAPKPGANGSQPVISRTFYILFKKMYLNGGCSVVPISFLK 770

Query: 687 ACNSMRPDFKIPNXXXXXXXXXXXXXXXXXXXXSDPEQVANDYPQLLLHDDDNLQVDGKE 746
           +C+ +RPDFKIP+                    S+ + V N+YP L+L+D+  L V  KE
Sbjct: 771 SCSLLRPDFKIPDDQQDTTEFLMLILDRLHDELSNQDAVVNEYPDLILYDEKKLNVQNKE 830

Query: 747 YDKWFEDSISKNGLSPIDSIFQGQMENCLQCQRCGHSSYNYSTFYVLSLAIPTPGTSTFG 806
           Y KWF+ S+  NGLSPID IFQGQMEN L CQRCGHSS+NYSTFYVLSLAIP   +STF 
Sbjct: 831 YKKWFDKSVIGNGLSPIDDIFQGQMENSLHCQRCGHSSFNYSTFYVLSLAIPKATSSTFS 890

Query: 807 KTKKVLLEDCINLFTSDEVLSGENAWDCPRC 837
           ++K+V LE+C+N++TSDEVLSGENAWDCP C
Sbjct: 891 RSKRVSLEECLNMYTSDEVLSGENAWDCPNC 921

 Score =  274 bits (700), Expect = 5e-76,   Method: Compositional matrix adjust.
 Identities = 185/539 (34%), Positives = 267/539 (49%), Gaps = 74/539 (13%)

Query: 5   YTPEYSNELLQFVQDVYAQDIKHYYPXXXXXXXXXXXXHAEYLFESYHMMLKQGNQEDAL 64
           +TPE S+EL Q V  VY  DI    P            H E+L+E Y   L +    DAL
Sbjct: 14  FTPELSDELWQRVVKVYTDDIGTALPQLRLQRLIDLLEHTEWLYELYLSCLGKDQNMDAL 73

Query: 65  TAFIIGSFYVYLIIPQSIQFHTRNKSYGIYVDLRKYYQDETSMTNVLLMVTKKVDAILCK 124
            +FI G FYVYL++PQSIQFHTRN+++ +Y D+R  Y+ + +MTNVLLMV ++V  +L  
Sbjct: 74  GSFINGCFYVYLVMPQSIQFHTRNRAHTVYSDVRALYESQVNMTNVLLMVKEEVQVVLES 133

Query: 125 SRDFD--DTKITRKRAYSVPSQA-LANQLRSLTLNN---TDG---------LEQLPE--- 166
             D    + +I R RAYSVP +A +   L  LTL +   T G         L QLP    
Sbjct: 134 QWDSASLNERIPRNRAYSVPDEARVVQNLDKLTLQSPTETRGGRPRSQKKQLLQLPRPGN 193

Query: 167 VSKESDT----------------LTNYADDYTTIWSAPKLEPDDQLKLALN----PPXXX 206
           V   SD+                 ++  D  + +W AP+LEP+DQLKLA      PP   
Sbjct: 194 VPVHSDSEFIAEQGISLHGDDSGWSDLDDQSSPLWRAPQLEPNDQLKLAAEVHDLPPGAI 253

Query: 207 XXXX---------------XXXXXFVMDQHSKKFSIGESSSDEFEPIPTQEALPMDHATP 251
                                   + +  HS                 + ++      TP
Sbjct: 254 SRGSDADEEEDVDDLEIGYEEMGIYGLAHHSVAPPQHAPPPVPL----SSQSPITSGGTP 309

Query: 252 SEIS----QRTRHHSIVSSNDTGKSRKDSVESVANIYVQNVDRYNTHRKDSYHSVYMLNE 307
           + I     +R R H++       ++         +      DR  THRK+SYHSVYML E
Sbjct: 310 AAIDDLMMRRRRTHTMTQMTPAAQTVPPGGAHDRSFKDFTPDRSLTHRKNSYHSVYMLEE 369

Query: 308 D---------DDTNEYDFFQNLSRLQKQYVISCEELMDILQSDERN-NVLLVDLRISKRF 357
                     D++N Y   Q+L RLQKQ +I+  EL  IL +++++  +LL+DLR+  R+
Sbjct: 370 SESSQGNLYYDESNAY--IQSLERLQKQSIITAPELFSILSNEQQSKQLLLIDLRLDYRY 427

Query: 358 HNNHIVAPNLINIDPRDLWDVDRKVPISSDVELEKKMGSYQTFQSRSKFKYIVYYTDMKT 417
           + + I+APN ++IDP+ LW+ +   P+    ELE K+ +   F  R +F Y+VY++DMKT
Sbjct: 428 NTSKIIAPNTVHIDPKMLWNSNSGAPMYEITELESKLNN-PLFNRRDEFDYVVYFSDMKT 486

Query: 418 FLNIDFDYRLVFFQLLYASSSTRLRSPPKALLGDYEQWKTFIGQYAKHHDIVTGDYLFR 476
           F+ ++FDY   FF LL  +    L+  P  LLG YE+WK  I +Y K ++I   DYL R
Sbjct: 487 FMKLNFDYHFTFFYLLNTARGKPLKCVPTVLLGGYEKWKKVILEYGKQYNICVTDYLVR 545

 Score =  205 bits (521), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 94/133 (70%), Positives = 110/133 (82%)

Query: 903  EKWKSKKLTTIKTFNFITMPPILVIHLSRFFYDLTKKNSTVITYPLILNIVLKNNEVAKY 962
            ++WKSKKL TIKT NFI MP  L+IHLSRF+YDLTKKNST++TYPLILNIVLK+NEV KY
Sbjct: 1029 KQWKSKKLFTIKTLNFIRMPRTLIIHLSRFYYDLTKKNSTIVTYPLILNIVLKSNEVVKY 1088

Query: 963  RLYGIVNHFGNLISGHYTSLVNKDLKHEIRHGQQKWYYFDDEVVKQDNNHGDFDAGIASV 1022
            +LYG+VNH GNLISGHYTS+V+K L H +      WYYFDDEVVK++  HGD   G+  +
Sbjct: 1089 KLYGVVNHTGNLISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVVKRETRHGDVKHGVMKI 1148

Query: 1023 SSSDVYVLFYERI 1035
            SSSDVYVLFYERI
Sbjct: 1149 SSSDVYVLFYERI 1161

>TBLA0E01760 Chr5 complement(430209..433847) [3639 bp, 1212 aa] {ON}
           Anc_5.712 YIL156W
          Length = 1212

 Score =  323 bits (829), Expect = 5e-93,   Method: Compositional matrix adjust.
 Identities = 160/316 (50%), Positives = 205/316 (64%), Gaps = 15/316 (4%)

Query: 539 PPLPPKSAINLHYSVATGMQPPMPQVTTVSHAHRHRYLSHSKRSQHQHYSPISHQYISVP 598
           PPLPPK  INLH        P +P + +      H   +H +           H++ S+P
Sbjct: 694 PPLPPK--INLH------GNPSLPPIHSPLENQVHSLDTHKQNGA-------IHRHFSIP 738

Query: 599 TIEQSSNVYVSLSITGLRNLGSTCYINSMLQCLFATRKFRDIFLSPKYHDYISKGYIHRA 658
            +E+S N YVSLSITGLRNLG+TCYINSMLQCLFAT +FR+IFLS KY  Y+        
Sbjct: 739 ILEKSENDYVSLSITGLRNLGNTCYINSMLQCLFATTEFRNIFLSHKYEKYMDHDIPTNQ 798

Query: 659 QISRSFHMLFKKMYMNGGCSVVPSGFLKACNSMRPDFKIPNXXXXXXXXXXXXXXXXXXX 718
           ++S+SF+MLFKKMYMNGGCSVVP+GFLK CN +RPD +IP+                   
Sbjct: 799 RLSKSFNMLFKKMYMNGGCSVVPTGFLKTCNILRPDLRIPDDQQDTQEFLMLILDRLHDE 858

Query: 719 XSDPEQVANDYPQLLLHDDDNLQVDGKEYDKWFEDSISKNGLSPIDSIFQGQMENCLQCQ 778
            S+  +V  DYP L+ +D D+++V   +Y KW+ +S+  NGLSPID +FQGQ E+ L CQ
Sbjct: 859 LSNQHEVKLDYPDLVDYDVDDMEVQPGQYIKWYNESVKSNGLSPIDHVFQGQTEDGLVCQ 918

Query: 779 RCGHSSYNYSTFYVLSLAIPTPGTSTFGKTKKVLLEDCINLFTSDEVLSGENAWDCPRCG 838
           RCG SS+ YSTFY+LSLAIP   T+ FGK K+V LEDCI +FT+DE+LS ENAWDCPRCG
Sbjct: 919 RCGCSSFTYSTFYILSLAIPKASTNAFGKIKRVNLEDCIKMFTNDEILSDENAWDCPRCG 978

Query: 839 TSMSGSGPGEGKAKKK 854
           ++     P     +KK
Sbjct: 979 SAAPKQEPIHRHREKK 994

 Score =  195 bits (495), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 90/135 (66%), Positives = 110/135 (81%)

Query: 901  GSEKWKSKKLTTIKTFNFITMPPILVIHLSRFFYDLTKKNSTVITYPLILNIVLKNNEVA 960
            G  +  S K+ TIK+ NF+  P ILVIHLSRF+YDLTKKN+TVITYPL LNI LKN EVA
Sbjct: 1077 GRVRHYSGKMVTIKSVNFVKAPRILVIHLSRFYYDLTKKNNTVITYPLHLNISLKNGEVA 1136

Query: 961  KYRLYGIVNHFGNLISGHYTSLVNKDLKHEIRHGQQKWYYFDDEVVKQDNNHGDFDAGIA 1020
            +Y+LYG+VNH G L+SGHYTSLVNKD  HE+   +QKW+YFDDE+VK++ NHGD + G+ 
Sbjct: 1137 RYKLYGLVNHTGTLVSGHYTSLVNKDTDHELGSEKQKWFYFDDEIVKEEKNHGDIEGGVT 1196

Query: 1021 SVSSSDVYVLFYERI 1035
            S+SSS VYVLFY+RI
Sbjct: 1197 SISSSHVYVLFYQRI 1211

 Score =  172 bits (436), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 89/206 (43%), Positives = 129/206 (62%), Gaps = 9/206 (4%)

Query: 288 VDRYNTHRKDSYHSVYMLN---EDDDTNEYD----FFQNLSRLQKQYVISCEELMDILQS 340
           VDR  THRKDSYHSVYM N   ED++ + YD    + ++L  +QKQ VI+C EL  +L +
Sbjct: 446 VDRSVTHRKDSYHSVYMFNDSNEDNNNHGYDETSEYIESLEHIQKQDVITCPELFSLLSN 505

Query: 341 D-ERNNVLLVDLRISKRFHNNHIVAPNLINIDPRDLWDVDRKVPISSDVELEKKMGSYQT 399
           + ER  VLL+DLR  +RF  NHIVAPN++ ++P+ LWD     P+ +  +LE+ + +   
Sbjct: 506 NVEREKVLLIDLRFPERFVKNHIVAPNILQLNPKLLWDDTTNTPVYTAEKLEQIINN-PL 564

Query: 400 FQSRSKFKYIVYYTDMKTFLNIDFDYRLVFFQLLYASSSTRLRSPPKALLGDYEQWKTFI 459
           F  R  FKY+VYY+DMKT++N+ FDY    F LL   +S  ++S P +LLG YE+W   I
Sbjct: 565 FSKRDTFKYVVYYSDMKTYMNMTFDYLFTLFYLLVTCTSKPVKSLPTSLLGGYEKWYKVI 624

Query: 460 GQYAKHHDIVTGDYLFRPYASSAKSQ 485
             Y   + I   DY++R  A ++  +
Sbjct: 625 NSYVNQYSITMNDYVYRKDAGASAGR 650

 Score =  127 bits (318), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 69/152 (45%), Positives = 100/152 (65%), Gaps = 10/152 (6%)

Query: 4   SYTPEYSNELLQFVQDVYAQDIKHYYPXXXXXXXXXXXXHAEYLFESYHMMLKQGNQEDA 63
           +YTPEYS+ELLQ VQ++Y  + K +YP            H+ +LFE+Y   L+  + +DA
Sbjct: 9   NYTPEYSDELLQCVQEIYNNEFKTHYPQLKLEKLIDLLDHSSFLFETYTKSLRDSHFDDA 68

Query: 64  LTAFIIGSFYVYLIIPQSIQFHTRNKSYGIYVDLRKYYQDETSMTNVLLMVTKKVDAIL- 122
           L+AFI+GSFY+Y IIPQS QF T+N+ Y +Y +L+  Y+DE +MTNVL MV  ++  IL 
Sbjct: 69  LSAFIVGSFYMYFIIPQSTQFLTKNRHYRMYHELKNLYEDELNMTNVLSMVKTEITKILD 128

Query: 123 --CKSRD------FDDTK-ITRKRAYSVPSQA 145
              KS++      F D+K I R+RA+SVP+ +
Sbjct: 129 SNYKSQNESSNNLFVDSKFIRRERAFSVPNAS 160

>Kpol_304.6 s304 (18386..20071) [1686 bp, 562 aa] {ON}
           (18386..20071) [1686 nt, 562 aa]
          Length = 562

 Score =  293 bits (749), Expect = 4e-87,   Method: Compositional matrix adjust.
 Identities = 193/491 (39%), Positives = 260/491 (52%), Gaps = 54/491 (10%)

Query: 3   CSYTPEYSNELLQFVQDVYAQDIKHYYPXXXXXXXXXXXXHAEYLFESYHMMLKQGNQED 62
            ++TPEYS EL + VQD+Y  DIK   P            H  YL E++H  L  G  +D
Sbjct: 9   STFTPEYSTELQERVQDIYQNDIKPLLPQLRLSKLIDLLEHTAYLLEAFHHFLPSGRYDD 68

Query: 63  ALTAFIIGSFYVYLIIPQSIQFHTRNKSYGIYVDLRKYYQDETSMTNVLLMVTKKVDAIL 122
           AL+A+I+G +Y+YLIIPQS QF T+NKSY +Y D +  YQ+E +MTNV  MV  +VD+IL
Sbjct: 69  ALSAYIVGCYYLYLIIPQSTQFQTKNKSYSMYNDWKILYQNEANMTNVCSMVRNEVDSIL 128

Query: 123 CKS-RDFDDTK--ITRKRAYSVPSQALA--NQLRSLTLNNTDGLEQLP-EVSKESDTLTN 176
            KS ++ + TK  I R RA+SV        N +            Q P  ++K  D+L  
Sbjct: 129 DKSYQEPEPTKRVIPRGRAFSVKDDTPKDYNTIEFPIRERKSSTTQRPLSMAKPYDSLPM 188

Query: 177 YADDYTTIWSAPKLEPDDQLKLALNPPXXX--XXXXXXXXXFVMDQHSKKFSIGESSSDE 234
             DD T +W+AP L P+DQLKLAL  P               ++D     F+I       
Sbjct: 189 ELDDSTPLWTAPSLNPNDQLKLALEQPELTLDEQLSDKTQHNLIDDKYNNFTI------- 241

Query: 235 FEPIPTQEALPMDHATPSEISQRTRHHSIVSSNDTGKSRKDSVESVANIYVQNVDRYNTH 294
             P+P Q  LP                  V   D    +K     +  IY   VDR  TH
Sbjct: 242 --PLPHQIPLP------------------VKVTDFNHDKK-----IQKIYP--VDRSETH 274

Query: 295 RKDSYHSVYMLNE--------DDDTNEYDFFQNLSRLQKQYVISCEELMDILQS-DERNN 345
           RKDSYHSVYM N+        +D+ N Y   Q L RLQKQ VI+C EL  IL     +++
Sbjct: 275 RKDSYHSVYMDNDNSAGYVRKNDEANNY--IQTLERLQKQNVITCPELFSILSDPTTKDD 332

Query: 346 VLLVDLRISKRFHNNHIVAPNLINIDPRDLWDVDRKVPISSDVELEKKMGSYQTFQSRSK 405
           +LL+ L + +R  +N+IVA N INIDP  LWD +   PIS D +LEK +   Q F  R  
Sbjct: 333 ILLIYLGLPERTKSNYIVAKNTINIDPNVLWDFENNCPISEDTKLEKILND-QLFNIRKS 391

Query: 406 FKYIVYYTDMKTFLNIDFDYRLVFFQLLYASSSTRLRSPPKALLGDYEQWKTFIGQYAKH 465
           F Y+VYYTD+KT++ I+FDY    F LL +S ++ L++ P +LLG  E+WK  I  Y   
Sbjct: 392 FAYVVYYTDLKTYMKINFDYNFTLFYLLTSSRTSVLKTFPTSLLGGLEKWKKVIRTYYHE 451

Query: 466 HDIVTGDYLFR 476
           + I   +YL +
Sbjct: 452 NGINALNYLHK 462

>TBLA0F03610 Chr6 (890140..893574) [3435 bp, 1144 aa] {ON} Anc_8.188
           YDR069C
          Length = 1144

 Score = 96.3 bits (238), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 81/278 (29%), Positives = 114/278 (41%), Gaps = 70/278 (25%)

Query: 599 TIEQSSNVYV-SLSI---TGLRNLGSTCYINSMLQCLFATRKFRDIFLSPKY--HDYISK 652
           TI QSSN Y   L +    GL N+G++CY+N ++QCL    +   +FL+  Y  H  I+ 
Sbjct: 717 TISQSSNGYTPDLDLDFKVGLENMGNSCYLNCIIQCLLNNHELTKMFLNNSYEKHININS 776

Query: 653 GYIHRAQISRSFHMLFKKMYMNGGCS-----------VVPSGFLKACNSMRPDFKIPNXX 701
               +  +++SF  L   MY NG  S           V P  F  AC S+   FK  N  
Sbjct: 777 KLGSKGILAKSFARLVHSMYQNGTLSIKNHSNKKNPPVQPITFKTACGSINSLFKGSN-- 834

Query: 702 XXXXXXXXXXXXXXXXXXSDPEQVANDYPQLL---LHDDDN-------LQVDGKEYDKWF 751
                                +Q   ++ Q L   LH+D N       L+    E ++  
Sbjct: 835 ---------------------QQDCQEFCQFLLDGLHEDLNQCGANPPLKELSTEAERMR 873

Query: 752 E------------DSISKNGLSPIDSIFQGQMENCLQCQRCGHSSYNYSTFYVLSLAIPT 799
           E            +       S I  ++QGQ  + L+CQ CG +S  Y TF VLS+ +P 
Sbjct: 874 EKLSLRIASSIEWERFLTTDFSVIIDLYQGQYASQLKCQVCGTTSTTYQTFSVLSVPVP- 932

Query: 800 PGTSTFGKTKKVLLEDCINLFTSDEVLSGENAWDCPRC 837
                  K K + L DC N FT  E L  +  W C  C
Sbjct: 933 -------KNKSIHLLDCFNEFTKTEFLGKDELWSCTEC 963

 Score = 62.0 bits (149), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 41/121 (33%), Positives = 58/121 (47%), Gaps = 29/121 (23%)

Query: 908  KKLTTIKTFNFITMPPILVIHLSRFFYDLTKKNSTVITYPLILNI--------------- 952
            KK  + KT     +P  L+IHL R F ++  KN+  + YPLIL++               
Sbjct: 965  KKQPSTKTLTITRLPKNLIIHLKR-FDNMLHKNNVFVKYPLILDLTNYWANDFDGKLPPG 1023

Query: 953  ----VLKNNEVA--KYRLYGIVNHFGNLISGHYTSLVNKDLKHEIRHGQQKWYYFDDEVV 1006
                +    ++   KY L G+  H G+L  GHYT+ VNK LK+        WYYFDD V 
Sbjct: 1024 VTEELPARGQIPPFKYELSGVALHMGSLYGGHYTAYVNKGLKN-------GWYYFDDTVY 1076

Query: 1007 K 1007
            +
Sbjct: 1077 R 1077

 Score = 42.7 bits (99), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 51/93 (54%), Gaps = 15/93 (16%)

Query: 329 ISCEELMDILQSDERNNVLLVDLRISKRFHNNHIVAPNLINIDPRDL------WDVDRKV 382
           I+   L  ILQ+D  ++ LL+D+R    F  NHI + ++I I+P          D++RK 
Sbjct: 180 ITSSVLATILQTDP-DSTLLIDVRTRHDFELNHIKSNSIICIEPISFKNNYSDVDIERKS 238

Query: 383 PISS-DVELEKKMGSYQTFQSRSKFKYIVYYTD 414
            I+S + E+E        F++R  +K+I+ YTD
Sbjct: 239 LITSPNSEIE-------IFKNRENYKFIILYTD 264

>KNAG0D01930 Chr4 (324705..327665) [2961 bp, 986 aa] {ON} Anc_8.188
           YDR069C
          Length = 986

 Score = 91.7 bits (226), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 70/258 (27%), Positives = 104/258 (40%), Gaps = 61/258 (23%)

Query: 612 ITGLRNLGSTCYINSMLQCLFATRKFRDIFLSPKYHDYIS--KGYIHRAQISRSFHMLFK 669
           + GL N+G++CY+N ++QCL    +   IFL   +  Y++       +  ++R F  L  
Sbjct: 619 MVGLENMGNSCYLNCIIQCLLGNNELIKIFLDNSFEKYVNLNSKLGSKGVLARYFSRLIH 678

Query: 670 KMYMN------GG--CSVVPSGFLKACNSMRPDFKIPNXXXXXXXXXXXXXXXXXXXXSD 721
            MY N      GG    V P+ F  AC S+   FK                         
Sbjct: 679 TMYNNARTIKHGGKHAPVKPAQFKMACGSVNSAFK-----------------------GG 715

Query: 722 PEQVANDYPQLLL---HDDDNLQVDGKEYDKWFEDSIS-------------------KNG 759
            +Q   ++ Q LL   H+D N     K   +  E++ +                      
Sbjct: 716 SQQDCQEFCQFLLDGLHEDLNQCGGNKRLAELTEEAENLREKLSLRIASSIEWERFLTTD 775

Query: 760 LSPIDSIFQGQMENCLQCQRCGHSSYNYSTFYVLSLAIPTPGTSTFGKTKKVLLEDCINL 819
            S I  +FQGQ  + LQC+ CG +S  Y  F VLS+ +P+   S      K  + DC + 
Sbjct: 776 FSVIGDLFQGQYASRLQCKTCGKTSTTYQPFSVLSIPVPSKHIS------KCSIIDCFDE 829

Query: 820 FTSDEVLSGENAWDCPRC 837
           FT  E L  +  W CPRC
Sbjct: 830 FTKVENLEVDEQWSCPRC 847

 Score = 72.8 bits (177), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 54/159 (33%), Positives = 78/159 (49%), Gaps = 41/159 (25%)

Query: 903  EKW-----KSKKLTTIKTFNFITMPPILVIHLSRFFYDLTKKNSTVITYPLILNIV---- 953
            E+W     KSK+ +T K      +P  L+IHL RF   L K N+ ++ YP  L++     
Sbjct: 840  EQWSCPRCKSKQPST-KKLTITRLPRNLIIHLKRFDNRLNK-NNILVQYPFTLDLTTFWA 897

Query: 954  --------LKNNEVA--------KYRLYGIVNHFGNLISGHYTSLVNKDLKHEIRHGQQK 997
                    L  +E+          Y+LYG+  HFG+L  GHYT+ V+K +K+        
Sbjct: 898  NDFDGKLPLNVSELPTRGQKPPFNYKLYGVACHFGSLYGGHYTAYVDKGIKN-------G 950

Query: 998  WYYFDDEVVKQDNNHGDFDAGIASVSSSDVYVLFYERIY 1036
            WYYFDD   +   N       +  ++SS  YVLFY+RIY
Sbjct: 951  WYYFDDTSCRPIKN------SMEPITSS-AYVLFYKRIY 982

 Score = 39.3 bits (90), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 44/92 (47%), Gaps = 12/92 (13%)

Query: 329 ISCEELMDILQSDERNNVLLVDLRISKRFHNNHIVAPNLINIDPRDLWDVDRKVPISSDV 388
           I  ++L +IL+  + + VL +D+R    F+  H   PN+I I+P             SD 
Sbjct: 177 IFLDQLDEILRDHDSSQVLFIDVRTRLDFNKGHFKVPNIICIEPVSFKSS------YSDH 230

Query: 389 ELEKKMGSYQT------FQSRSKFKYIVYYTD 414
           +LEKK     T      F  R +F +IV Y++
Sbjct: 231 DLEKKSMITSTNDEIVLFHRRQEFAFIVLYSN 262

>Smik_4.307 Chr4 complement(551719..554508) [2790 bp, 929 aa] {ON}
           YDR069C (REAL)
          Length = 929

 Score = 91.7 bits (226), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 68/237 (28%), Positives = 101/237 (42%), Gaps = 25/237 (10%)

Query: 614 GLRNLGSTCYINSMLQCLFATRKFRDIFLSPKYHDYI-------SKGYIHRAQISRSFHM 666
           GL NLG++CY+N ++QC+  T +   IFL   Y  +I       SKG + +   +R  HM
Sbjct: 566 GLENLGNSCYMNCIIQCILGTHELTQIFLDDSYAKHININSKLGSKGILAKY-FARLVHM 624

Query: 667 LFKKMY-MNGGCSVVPSGFLKACNSMRPDFKIPNXXXXXXXXXXXXXXXXXXXXSDPEQV 725
           ++K+    +   S+ P  F  AC S+   FK                        D  Q 
Sbjct: 625 MYKEQVDSSKKISISPIKFKLACGSVNSLFK----TASQQDCQEFCQFLLDGLHEDLNQC 680

Query: 726 ANDYPQLLLHDD-----DNLQVDGKEYDKWFEDSISKNGLSPIDSIFQGQMENCLQCQRC 780
            ++ P   L  +     + L +      +W  +       S I  +FQGQ  + L+C+ C
Sbjct: 681 GSNPPLKELSQEAEARREKLSLRIASSIEW--ERFLTTDFSVIVDLFQGQYASRLRCKVC 738

Query: 781 GHSSYNYSTFYVLSLAIPTPGTSTFGKTKKVLLEDCINLFTSDEVLSGENAWDCPRC 837
            H+S  Y  F VLS+ IP   +       K+ +EDC   FT  E L  E  W CP C
Sbjct: 739 NHTSTTYQPFTVLSIPIPKKNSQN-----KITIEDCFKEFTKCENLEVEEQWLCPHC 790

 Score = 67.4 bits (163), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 46/147 (31%), Positives = 66/147 (44%), Gaps = 37/147 (25%)

Query: 912  TIKTFNFITMPPILVIHLSRFFYDLTKKNSTVITYPLILNIV--------------LKNN 957
            + K      +P  L++HL RF  +   KN+  + YP +L++               + ++
Sbjct: 796  STKQLTVTRLPRNLIVHLKRF-DNFLNKNNDFVRYPFLLDLTPFWANDFDGVFPPGVNDD 854

Query: 958  EVA--------KYRLYGIVNHFGNLISGHYTSLVNKDLKHEIRHGQQKWYYFDDEVVKQD 1009
            E+         KY LYG+  HFG L  GHYT+ V K LK       + W YFDD   K  
Sbjct: 855  ELPIRGQIPPFKYELYGVACHFGTLYGGHYTAYVKKGLK-------KGWLYFDDTKYKPV 907

Query: 1010 NNHGDFDAGIASVSSSDVYVLFYERIY 1036
             N  D         +S+ YVLFY R+Y
Sbjct: 908  KNQTD-------AINSNAYVLFYHRVY 927

 Score = 40.0 bits (92), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 43/75 (57%), Gaps = 12/75 (16%)

Query: 346 VLLVDLRISKRFHNNHIVAPNLINIDPRDL------WDVDRKVPISSDVELEKKMGSYQT 399
            LL+D+R    F+ +HI + N+I ++P          D++RK  I+S  + E K+     
Sbjct: 209 TLLIDIRSRLEFNKSHIDSKNIICLEPISFKMSYSDHDLERKSLITSPND-EIKL----- 262

Query: 400 FQSRSKFKYIVYYTD 414
           FQSR+ FK+IV YTD
Sbjct: 263 FQSRNLFKFIVLYTD 277

>YER144C Chr5 complement(457806..460223) [2418 bp, 805 aa] {ON}
           UBP5Putative ubiquitin-specific protease, closest
           paralog of Doa4p but has no functional overlap;
           concentrates at the bud neck
          Length = 805

 Score = 90.9 bits (224), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 84/308 (27%), Positives = 123/308 (39%), Gaps = 71/308 (23%)

Query: 567 VSHAHRHRYLSHSKRSQHQHYSPISHQYISVP--TIEQSSNVYVSLSITGLRNLGSTCYI 624
           +  A  H YL  +         P+  Q +S    TI  +S V     I GL N+G+ CY+
Sbjct: 398 IRAAQAHAYLPPASNVFSPRIPPLPQQNLSSSRQTILNNSQVLDLDLIVGLENIGNCCYM 457

Query: 625 NSMLQCLFATRKFRDIFLSPKYHDYI----SKGYIHRAQISRSFHMLFKKMYMNGGCS-- 678
           N +LQCL  T     +FL   Y ++I    S+G   +  ++++F +L   M+ +G  +  
Sbjct: 458 NCILQCLVGTHDLVRMFLDNTYLNFINFDSSRG--SKGLLAKNFAILVNNMHRHGAFTPP 515

Query: 679 ------VVPSGFLKACNSMRPDFKIPNXXXXXXXXXXXXXXXXXXXXSDPEQVANDYPQL 732
                 V    F K C  + P +                           +Q   ++ Q 
Sbjct: 516 NVRTIPVQTIQFKKICGHINPMYS-----------------------DSMQQDCQEFCQF 552

Query: 733 LL---HDDDNLQVDGKEYDKWFED---------SISKNG-----------LSPIDSIFQG 769
           LL   H+D N Q   K++ K   D         SI K              S I  +FQG
Sbjct: 553 LLDGLHEDLN-QNGSKKHLKQLSDEEERMREKMSIRKASALEWERFLLTDFSAIIDLFQG 611

Query: 770 QMENCLQCQRCGHSSYNYSTFYVLSLAIPTPGTSTFGKTKKVLLEDCINLFTSDEVLSGE 829
           Q  + LQCQ C H+S  Y TF VLS+ +P        + K   + DC   FT  E L  +
Sbjct: 612 QYASRLQCQVCEHTSTTYQTFSVLSVPVP--------RVKTCNILDCFREFTKCERLGVD 663

Query: 830 NAWDCPRC 837
             W CP+C
Sbjct: 664 EQWSCPKC 671

 Score = 63.2 bits (152), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 47/157 (29%), Positives = 70/157 (44%), Gaps = 38/157 (24%)

Query: 903  EKWKS----KKLTTIKTFNFITMPPILVIHLSRFFYDLTKKNSTVITYPLILNI------ 952
            E+W      KK  + K      +P  L+I+L RF   + K N+  + YP  L++      
Sbjct: 664  EQWSCPKCLKKQPSTKQLKITRLPKKLIINLKRFDNQMNK-NNVFVQYPYSLDLTPYWAR 722

Query: 953  -----VLKNNEVA--------KYRLYGIVNHFGNLISGHYTSLVNKDLKHEIRHGQQKWY 999
                  + N ++         +YRLYG+  H G+L  GHYTS V K  K       + WY
Sbjct: 723  DFNHEAIVNEDIPTRGQVPPFRYRLYGVACHSGSLYGGHYTSYVYKGPK-------KGWY 775

Query: 1000 YFDDEVVKQDNNHGDFDAGIASVSSSDVYVLFYERIY 1036
            +FDD + +      +F        +   YVLFYERI+
Sbjct: 776  FFDDSLYRPITFSTEF-------ITPSAYVLFYERIF 805

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/119 (27%), Positives = 49/119 (41%), Gaps = 2/119 (1%)

Query: 346 VLLVDLRISKRFHNNHIVAPNLINIDPRDLWDVDRKVPISSDVELEKKMGSYQTFQSRSK 405
           +LL+D+R    F   HI   N+I IDP    D      I S   +         F +R K
Sbjct: 163 LLLIDVRPRSEFVRAHIKCKNIICIDPASFKDSFTDQQIESVSLITSPHSDITFFSNRDK 222

Query: 406 FKYIVYYTDMKTFLNIDFDYRLVFFQLLYASSSTRLRSPPKALL--GDYEQWKTFIGQY 462
           FK+I+ YTD +   N       +  ++L  +S  +  S  K L+    +  W    G Y
Sbjct: 223 FKFIILYTDTQLHNNFQQRQTRILAKILSQNSVIKPLSGTKILILENGFSNWVKLGGAY 281

>TPHA0C02770 Chr3 (604690..607602) [2913 bp, 970 aa] {ON} Anc_8.188
           YDR069C
          Length = 970

 Score = 90.9 bits (224), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 74/257 (28%), Positives = 108/257 (42%), Gaps = 65/257 (25%)

Query: 614 GLRNLGSTCYINSMLQCLFATRKFRDIFLSPKYHDYIS--KGYIHRAQISRSFHMLFKKM 671
           GL N+G++CY+N ++QCL ++ +F  IFL+  Y  +I+       +  ++R+F  L   M
Sbjct: 609 GLENMGNSCYLNCIIQCLLSSHEFTRIFLNNSYEKHINLKSKLGSKGVLARNFARLINTM 668

Query: 672 YMNG--------GCSVVPSGFLKACNSMRPDFKIPNXXXXXXXXXXXXXXXXXXXXSDPE 723
           Y  G           V P+ F  AC S+   F+                       SD +
Sbjct: 669 YTEGSEQSKNDRNGPVKPAQFKLACGSINSIFR-----------------------SDLQ 705

Query: 724 QVANDYPQLLL---HDDDNLQVDG----KEYDKWFEDSISKNGLSPIDSI---------- 766
           Q + ++ Q LL   H+D N Q       KE     E    K  L    SI          
Sbjct: 706 QDSQEFCQFLLDGLHEDLN-QCGANPPLKELSPNAEKMREKLSLRIASSIEWERYLTTDF 764

Query: 767 ------FQGQMENCLQCQRCGHSSYNYSTFYVLSLAIPTPGTSTFGKTKKVLLEDCINLF 820
                 FQGQ  + L+C+ CG +S  Y  F VLS+ +P       GK+  ++  DC N F
Sbjct: 765 SVIVDQFQGQYASQLRCKVCGGTSTTYQAFSVLSVPVPR------GKSCNII--DCFNEF 816

Query: 821 TSDEVLSGENAWDCPRC 837
           T  E L  +  W CP C
Sbjct: 817 TKVENLETDELWACPHC 833

 Score = 60.5 bits (145), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 44/150 (29%), Positives = 67/150 (44%), Gaps = 37/150 (24%)

Query: 908  KKLTTIKTFNFITMPPILVIHLSRFFYDLTKKNSTVITYPLILNIV--LKNNEVAK---- 961
            KK  + K      +P  L+IHL RF  ++  KN+  + YP +L++     N+   +    
Sbjct: 835  KKQPSTKKLTITRLPRNLIIHLKRF-DNMLNKNNIFVKYPFLLDLTPYWANDFDGRLPPG 893

Query: 962  ---------------YRLYGIVNHFGNLISGHYTSLVNKDLKHEIRHGQQKWYYFDDEVV 1006
                           Y+L  +  HFG+L  GHYTS V+K        G+  W YFDD  +
Sbjct: 894  VTEELPTRGQIPPFNYKLNAVAAHFGSLYGGHYTSYVDK--------GKFGWRYFDDTKI 945

Query: 1007 KQDNNHGDFDAGIASVSSSDVYVLFYERIY 1036
            +   N  +         +S+ YVLFY R+Y
Sbjct: 946  RPLKNSYE-------CITSNAYVLFYHRVY 968

 Score = 37.7 bits (86), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 29/101 (28%), Positives = 44/101 (43%), Gaps = 12/101 (11%)

Query: 346 VLLVDLRISKRFHNNHIVAPNLINIDPRDLWDVDRKVPISSDVELEKK------MGSYQT 399
           +L++D+R    F  +HI   N+I I+P    +        +D+EL+KK          +T
Sbjct: 200 LLVIDVRPRMEFEESHIKCKNIICIEPVSFNES------FTDLELQKKSMITSPSDEVKT 253

Query: 400 FQSRSKFKYIVYYTDMKTFLNIDFDYRLVFFQLLYASSSTR 440
           F  +  F YIV  TD           +LV   LL   S T+
Sbjct: 254 FAKKDTFNYIVICTDTDEKKQFYLHQQLVLLDLLMNKSFTK 294

>Suva_2.228 Chr2 complement(385322..388105) [2784 bp, 927 aa] {ON}
           YDR069C (REAL)
          Length = 927

 Score = 90.5 bits (223), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 68/238 (28%), Positives = 102/238 (42%), Gaps = 25/238 (10%)

Query: 613 TGLRNLGSTCYINSMLQCLFATRKFRDIFLSPKYHDYI-------SKGYIHRAQISRSFH 665
            GL NLG++CY+N ++QC+  T +   IFL   Y  +I       SKG + +   +R  H
Sbjct: 563 VGLENLGNSCYMNCIIQCILGTHELTQIFLDDSYAKHININSKLGSKGILAKY-FARLVH 621

Query: 666 MLFKKMYMNGGC-SVVPSGFLKACNSMRPDFKIPNXXXXXXXXXXXXXXXXXXXXSDPEQ 724
           M++KK   +    S+ P  F  AC S+   FK  +                     D  Q
Sbjct: 622 MMYKKQVDSSKKDSISPIKFKLACGSVNSLFKTASQQDCQEFCQFLLDGLH----EDLNQ 677

Query: 725 VANDYPQLLLHDD-----DNLQVDGKEYDKWFEDSISKNGLSPIDSIFQGQMENCLQCQR 779
             ++ P   L  +     + L +      +W  +       S I  +FQGQ  + L+C+ 
Sbjct: 678 CGSNPPLKELSQEAETRRERLSLRIASSIEW--ERFLTTDFSVIVDLFQGQYASRLKCKT 735

Query: 780 CGHSSYNYSTFYVLSLAIPTPGTSTFGKTKKVLLEDCINLFTSDEVLSGENAWDCPRC 837
           C H+S  Y  F VLS+ IP   +       K+ +EDC   FT  E L  +  W CP C
Sbjct: 736 CNHTSTTYQPFTVLSIPIPKKNSQN-----KITIEDCFKEFTKCENLEIDEQWLCPHC 788

 Score = 69.7 bits (169), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 50/160 (31%), Positives = 71/160 (44%), Gaps = 41/160 (25%)

Query: 903  EKWKS----KKLTTIKTFNFITMPPILVIHLSRFFYDLTKKNSTVITYPLILNIV----- 953
            E+W      K+  + K      +P  L+IHL RF  +L  KN+  + YP +L++      
Sbjct: 781  EQWLCPHCEKRQPSTKQLTITRLPRNLIIHLKRF-DNLLNKNNDFVKYPFLLDLTPFWAN 839

Query: 954  ---------LKNNEVA--------KYRLYGIVNHFGNLISGHYTSLVNKDLKHEIRHGQQ 996
                     + ++E+         KY LYG+  HFG L  GHYTS V K L        +
Sbjct: 840  DFDGVFPPGVNDDELPIRGQIPPFKYELYGVACHFGTLYGGHYTSYVKKGL-------SR 892

Query: 997  KWYYFDDEVVKQDNNHGDFDAGIASVSSSDVYVLFYERIY 1036
             W YFDD   +   N  D         +S+ YVLFY R+Y
Sbjct: 893  GWLYFDDTKYRPAKNQTD-------AINSNAYVLFYHRVY 925

 Score = 37.4 bits (85), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 39/75 (52%), Gaps = 12/75 (16%)

Query: 346 VLLVDLRISKRFHNNHIVAPNLINIDPRDLWDVDRKVPISSDVELEKKM------GSYQT 399
            LL+D+R    F  +HI   N+I ++P     +  K   S D +LEKK          + 
Sbjct: 209 TLLIDIRSRLEFKKSHIDFKNIICLEP-----ISFKTSYS-DRDLEKKSLITSPNDEIKL 262

Query: 400 FQSRSKFKYIVYYTD 414
           FQSR+ FK+I+ YTD
Sbjct: 263 FQSRNLFKFIILYTD 277

>Skud_4.323 Chr4 complement(560596..563376) [2781 bp, 926 aa] {ON}
           YDR069C (REAL)
          Length = 926

 Score = 89.7 bits (221), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 67/238 (28%), Positives = 101/238 (42%), Gaps = 25/238 (10%)

Query: 613 TGLRNLGSTCYINSMLQCLFATRKFRDIFLSPKYHDYI-------SKGYIHRAQISRSFH 665
            GL NLG++CY+N ++QC+  T +   IFL   Y  +I       SKG + +   +R  H
Sbjct: 562 VGLENLGNSCYMNCIIQCILGTHELTQIFLDDSYAKHININSKLGSKGILAKY-FARLVH 620

Query: 666 MLFKKMY-MNGGCSVVPSGFLKACNSMRPDFKIPNXXXXXXXXXXXXXXXXXXXXSDPEQ 724
           M++K+    +   S+ P  F  AC S+   FK                        D  Q
Sbjct: 621 MMYKEQVDASKKISISPIKFKLACGSVNSLFK----TASQQDCQEFCQFLLDGLHEDLNQ 676

Query: 725 VANDYPQLLLHDD-----DNLQVDGKEYDKWFEDSISKNGLSPIDSIFQGQMENCLQCQR 779
             ++ P   L  +     + L +      +W  +       S I  +FQGQ  + L+C+ 
Sbjct: 677 CGSNPPLKELSQEAEARREKLSLRIASSIEW--ERFLTTDFSVIVDLFQGQYASRLKCKI 734

Query: 780 CGHSSYNYSTFYVLSLAIPTPGTSTFGKTKKVLLEDCINLFTSDEVLSGENAWDCPRC 837
           CGH+S  Y  F VLS+ IP           ++ +EDC   FT  E L  +  W CP C
Sbjct: 735 CGHTSTTYQPFTVLSIPIPRKVPQN-----EITIEDCFKEFTKCENLEVDEQWLCPHC 787

 Score = 72.8 bits (177), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 51/160 (31%), Positives = 74/160 (46%), Gaps = 41/160 (25%)

Query: 903  EKWKS----KKLTTIKTFNFITMPPILVIHLSRFFYDLTKKNSTVITYPLILNIV----- 953
            E+W      K+  + K      +P  L+IHL RF  +L  KN+  + YP +L++      
Sbjct: 780  EQWLCPHCKKRQPSTKQLTVTRLPRNLIIHLKRF-DNLLNKNNDFVKYPFLLDLTPFWAN 838

Query: 954  ---------LKNNEVA--------KYRLYGIVNHFGNLISGHYTSLVNKDLKHEIRHGQQ 996
                     + ++E+         KY LYG+  HFG L  GHYT+ V K L+       +
Sbjct: 839  DFDGVFPPGVNDDELPVRGQIPPFKYELYGVACHFGTLYGGHYTAYVKKGLR-------K 891

Query: 997  KWYYFDDEVVKQDNNHGDFDAGIASVSSSDVYVLFYERIY 1036
             W YFDD   K   N  D       V++S+ YVLFY R+Y
Sbjct: 892  GWLYFDDTKFKPVKNKTD-------VTNSNAYVLFYHRVY 924

 Score = 40.8 bits (94), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 41/75 (54%), Gaps = 12/75 (16%)

Query: 346 VLLVDLRISKRFHNNHIVAPNLINIDPRDLWDVDRKVPISSDVELEKKM------GSYQT 399
            LL+D+R    F  +HI + N+I ++P     +  K+   SD +LEKK          + 
Sbjct: 209 TLLIDIRSRLEFDKSHIASKNIICLEP-----ISFKISY-SDHDLEKKSLITSPNNEIKL 262

Query: 400 FQSRSKFKYIVYYTD 414
           FQSR+ FK+I+ YTD
Sbjct: 263 FQSRNLFKFIILYTD 277

>TDEL0B04220 Chr2 (747864..750341) [2478 bp, 825 aa] {ON} Anc_8.188
           YDR069C
          Length = 825

 Score = 89.4 bits (220), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 74/267 (27%), Positives = 104/267 (38%), Gaps = 64/267 (23%)

Query: 603 SSNVYVSLSITGLRNLGSTCYINSMLQCLFATRKFRDIFLSPKYHDYISKG--YIHRAQI 660
           S+N Y      GL N+G++CYIN ++QCL  T +  +IFL+  Y  +I+       +  +
Sbjct: 453 SANKYDLDFAVGLENMGNSCYINCIVQCLLGTHELTNIFLNKSYERHINMNSRLGSKGVL 512

Query: 661 SRSFHMLFKKMYMNG-------GCSVVPSGFLKACNSMRPDFKIPNXXXXXXXXXXXXXX 713
           ++ F  L   MY N        G  V P  F  AC ++   F+                 
Sbjct: 513 AKYFAKLTHSMYQNASHKLNEKGKPVQPMEFKMACGTINSLFR----------------- 555

Query: 714 XXXXXXSDPEQVANDYPQLLL---HDDDNLQVDGKEYDKWFEDSISK------------- 757
                    +Q   ++ Q LL   H+D N Q  G    K   D   K             
Sbjct: 556 ------ESGQQDCQEFCQFLLDGLHEDLN-QCGGNPPLKELSDEAEKMREKLSLRIASSI 608

Query: 758 -------NGLSPIDSIFQGQMENCLQCQRCGHSSYNYSTFYVLSLAIPTPGTSTFGKTKK 810
                     S I  +FQGQ  + L+CQ CG +S  Y  F VLS+ +P          K 
Sbjct: 609 EWERFLTTDFSVIVDLFQGQYASQLRCQVCGLTSTTYQPFSVLSVPVP--------HAKS 660

Query: 811 VLLEDCINLFTSDEVLSGENAWDCPRC 837
             + DC   FT  E L  +  W CPRC
Sbjct: 661 CNIIDCFKEFTKVEKLETDEQWSCPRC 687

 Score = 63.9 bits (154), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 46/159 (28%), Positives = 66/159 (41%), Gaps = 40/159 (25%)

Query: 903  EKWKS----KKLTTIKTFNFITMPPILVIHLSRFFYDLTKKNSTVITYPLILNIV----- 953
            E+W      KK  + K      +P  L+IHL RF  ++  KN+  + YP  L++      
Sbjct: 680  EQWSCPRCKKKQPSTKKLTITRLPRNLIIHLKRF-DNMMNKNNVFVKYPFTLDLTPYWAN 738

Query: 954  ----------------LKNNEVAKYRLYGIVNHFGNLISGHYTSLVNKDLKHEIRHGQQK 997
                               +    Y+LYGI +H G+L  GHYTS V+K  K       + 
Sbjct: 739  DFDGRLPPGVTEELPTRGQSPPFNYKLYGIASHVGSLYGGHYTSYVDKGPK-------RG 791

Query: 998  WYYFDDEVVKQDNNHGDFDAGIASVSSSDVYVLFYERIY 1036
            W YFDD   +   N            + + YVLFY R+Y
Sbjct: 792  WCYFDDTSFRPVRN-------ATECITPNAYVLFYHRVY 823

 Score = 38.5 bits (88), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 30/92 (32%), Positives = 47/92 (51%), Gaps = 13/92 (14%)

Query: 328 VISCEELMDILQSDERNNVLLVDLRISKRFHNNHIVAPNLINIDPRDL------WDVDRK 381
            IS   L  ++ S   ++ LL+DLR    F   HI A N+I I+P          ++++K
Sbjct: 161 TISSSHLQQLIDS-HNDSTLLIDLRQRGEFSKLHINAKNVICIEPISFKAQYTDLEIEKK 219

Query: 382 VPISSDVELEKKMGSYQTFQSRSKFKYIVYYT 413
             I+S  E   ++G    F++R  FK+IV YT
Sbjct: 220 SLITSPKE---EIG---LFRARDTFKFIVLYT 245

>AFR007W Chr6 (448632..451178) [2547 bp, 848 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR069C (DOA4) and
           YER144C (UBP5)
          Length = 848

 Score = 89.0 bits (219), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 78/281 (27%), Positives = 120/281 (42%), Gaps = 72/281 (25%)

Query: 596 SVPTIEQSSNVYVSLS----ITGLRNLGSTCYINSMLQCLFATRKFRDIFLSPKYHDYI- 650
           S+ T+ Q  N+ V++S      GL N G++CY++ ++QCL  T++   +FL+  Y ++I 
Sbjct: 468 SIKTLGQQ-NLTVAVSNLNFSVGLVNCGNSCYMSCIIQCLLGTQELCTMFLNNSYQNHIN 526

Query: 651 ------SKGYIHRAQISRSFHMLF------KKMYMNGGCSVVPSGFLKACNSMRPDFKIP 698
                 SKG + R   S+  H ++      +K   N   +V+P+ F  AC S+   FK  
Sbjct: 527 LNSRLGSKGLLARY-FSQLIHQMYQYGKDIRKKMGNEKTAVIPTQFKIACGSINSSFK-- 583

Query: 699 NXXXXXXXXXXXXXXXXXXXXSDPEQVANDYPQLLL---HDDDN-------LQVDGKEYD 748
                                 + +Q   ++ Q LL   H+D N       L+   +E +
Sbjct: 584 ---------------------DNTQQDCQEFCQFLLDGLHEDLNQCGNNPPLKELSEEAE 622

Query: 749 KWFE------------DSISKNGLSPIDSIFQGQMENCLQCQRCGHSSYNYSTFYVLSLA 796
           K  E            +       S I  +FQGQ  + LQC+ C  +S  Y  F VLS+ 
Sbjct: 623 KMREMMPMRLASAIEWERYLTTDFSVIVDLFQGQYASQLQCKVCQRTSTTYQPFSVLSVP 682

Query: 797 IPTPGTSTFGKTKKVLLEDCINLFTSDEVLSGENAWDCPRC 837
           +P+  T T        L DC   FT  E L  E  W CP C
Sbjct: 683 VPSTRTCT--------LTDCFTEFTKIETLEQEEQWSCPSC 715

 Score = 54.7 bits (130), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 39/130 (30%), Positives = 58/130 (44%), Gaps = 32/130 (24%)

Query: 903  EKWKS----KKLTTIKTFNFITMPPILVIHLSRFFYDLTKKNSTVITYPLILNIV----- 953
            E+W      K+  + K      +P  L+IHL RF  ++  KN+  ++YP +L++      
Sbjct: 708  EQWSCPSCKKRQPSTKKITITRLPRNLIIHLKRF-DNMLNKNNVFVSYPSVLDLTAFWAN 766

Query: 954  -----LKNNEVA----------KYRLYGIVNHFGNLISGHYTSLVNKDLKHEIRHGQQKW 998
                 + NN V            Y+LYGI  H G L +GHYT+ VNK            W
Sbjct: 767  DYDKKVTNNNVELPSRGQVPPFNYQLYGIACHDGTLRAGHYTAYVNKG-------AVLGW 819

Query: 999  YYFDDEVVKQ 1008
             Y+DD   +Q
Sbjct: 820  CYYDDTNWRQ 829

 Score = 36.2 bits (82), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 31/68 (45%)

Query: 346 VLLVDLRISKRFHNNHIVAPNLINIDPRDLWDVDRKVPISSDVELEKKMGSYQTFQSRSK 405
           VLLVD+R    F   HI + ++I I+P    +    + +     +         FQ R K
Sbjct: 176 VLLVDVRPRLDFMRCHIKSSSIICIEPVSFKESYTDIDLGKKSMITSPDAEIALFQDRDK 235

Query: 406 FKYIVYYT 413
           F YIV YT
Sbjct: 236 FDYIVVYT 243

>KAFR0C02590 Chr3 complement(503330..506266) [2937 bp, 978 aa] {ON}
           Anc_8.188 YDR069C
          Length = 978

 Score = 88.6 bits (218), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 68/245 (27%), Positives = 105/245 (42%), Gaps = 28/245 (11%)

Query: 612 ITGLRNLGSTCYINSMLQCLFATRKFRDIFLSPKYHDYI--SKGYIHRAQISRSFHMLFK 669
           I GL N+G++CY+N ++QC+  T     IFL+  Y  +I  S     +  ++++F  L  
Sbjct: 604 IVGLENMGNSCYMNCIIQCILGTHDLIKIFLNNSYEKHINLSSRLGSKGVLAKNFARLIH 663

Query: 670 KMYMNGGCSVV------------PSGFLKACNSMRPDFKIPNXXXXXXXXXXXXXXXXXX 717
            MYM+   S +            P  F  AC S+   F+                     
Sbjct: 664 TMYMHAVPSTINKHTEKKIVPVKPYQFKLACGSINSLFR----DSQQQDSQEFCQFLLDG 719

Query: 718 XXSDPEQVANDYP--QLLLHDD---DNLQVDGKEYDKWFEDSISKNGLSPIDSIFQGQME 772
              D  Q   + P  +L L  +   +NL +      +W  +       S I  +FQGQ  
Sbjct: 720 LHEDLNQCGGNPPLKELSLEAERLRENLSLRIASSIEW--ERYLTTDFSVIVDLFQGQYA 777

Query: 773 NCLQCQRCGHSSYNYSTFYVLSLAIPTPGTSTFGKTKKVLLEDCINLFTSDEVLSGENAW 832
           + L+C+ C H+S  Y +F VLS+ +P        +T+K+ L DC N FT  E L  +  W
Sbjct: 778 SRLECKVCHHTSTTYQSFSVLSVPLPKKFDP---QTRKIDLIDCFNEFTKIENLEVDEQW 834

Query: 833 DCPRC 837
            CP C
Sbjct: 835 SCPTC 839

 Score = 69.3 bits (168), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 51/159 (32%), Positives = 72/159 (45%), Gaps = 40/159 (25%)

Query: 903  EKWKS----KKLTTIKTFNFITMPPILVIHLSRFFYDLTKKNSTVITYPLILNIV----- 953
            E+W      KK  + K      +P  L+IHL RF  ++  KN++ I YP  L++      
Sbjct: 832  EQWSCPTCKKKQPSTKKLTITRLPRNLIIHLKRF-DNMLNKNNSFIDYPFNLDLTEFWAD 890

Query: 954  ---------LKNNEVAK-------YRLYGIVNHFGNLISGHYTSLVNKDLKHEIRHGQQK 997
                     + N   A+       YRLYG+  HFG+L  GHYT+ V+K + +        
Sbjct: 891  DFDGNLPPGVSNELPARGQIKPFNYRLYGVACHFGSLYGGHYTAYVDKGIGN-------G 943

Query: 998  WYYFDDEVVKQDNNHGDFDAGIASVSSSDVYVLFYERIY 1036
            WYYFDD   +   N  +         SS  YVLFY R+Y
Sbjct: 944  WYYFDDTTYRPLKNDKE-------PISSSAYVLFYTRVY 975

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 34/117 (29%), Positives = 60/117 (51%), Gaps = 15/117 (12%)

Query: 307 EDDDTNEY--DFFQNLSRLQKQYVISCEELMDILQSDERNNVLLVDLRISKRFHNNHIVA 364
           ++ D N+Y  D  +NL        IS  +L ++++ +  +++L++D+R    F  +HI +
Sbjct: 162 KNSDYNKYRNDIIKNLHLPSNGSFISTIQLNELMR-NFNDSLLIIDIRSRSEFIKSHIKS 220

Query: 365 PNLINIDPRDLWDVDRKVPISSDVELEKKM------GSYQTFQSRSKFKYIVYYTDM 415
            N+I I+P    D        SD ELE+K          + F +R  FK+IV YT++
Sbjct: 221 KNIICIEPISFKDS------YSDYELERKSIITSPNNEIRLFNNRQSFKFIVLYTEI 271

>YDR069C Chr4 complement(584939..587719) [2781 bp, 926 aa] {ON}
           DOA4Ubiquitin isopeptidase, required for recycling
           ubiquitin from proteasome-bound ubiquitinated
           intermediates, acts at the late endosome/prevacuolar
           compartment to recover ubiquitin from ubiquitinated
           membrane proteins en route to the vacuole
          Length = 926

 Score = 88.2 bits (217), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 67/239 (28%), Positives = 102/239 (42%), Gaps = 27/239 (11%)

Query: 613 TGLRNLGSTCYINSMLQCLFATRKFRDIFLSPKYHDYI-------SKGYIHRAQISRSFH 665
            GL NLG++CY+N ++QC+  T +   IFL   Y  +I       SKG + +   +R  H
Sbjct: 562 VGLENLGNSCYMNCIIQCILGTHELTQIFLDDSYAKHININSKLGSKGILAKY-FARLVH 620

Query: 666 MLFKKMYMNGG--CSVVPSGFLKACNSMRPDFKIPNXXXXXXXXXXXXXXXXXXXXSDPE 723
           M++K+  ++G    S+ P  F  AC S+   FK                        D  
Sbjct: 621 MMYKEQ-VDGSKKISISPIKFKLACGSVNSLFK----TASQQDCQEFCQFLLDGLHEDLN 675

Query: 724 QVANDYPQLLLHDD-----DNLQVDGKEYDKWFEDSISKNGLSPIDSIFQGQMENCLQCQ 778
           Q  ++ P   L  +     + L +      +W  +       S I  +FQGQ  + L+C+
Sbjct: 676 QCGSNPPLKELSQEAEARREKLSLRIASSIEW--ERFLTTDFSVIVDLFQGQYASRLKCK 733

Query: 779 RCGHSSYNYSTFYVLSLAIPTPGTSTFGKTKKVLLEDCINLFTSDEVLSGENAWDCPRC 837
            C H+S  Y  F VLS+ IP   +        + +EDC   FT  E L  +  W CP C
Sbjct: 734 VCSHTSTTYQPFTVLSIPIPKKNSRN-----NITIEDCFREFTKCENLEVDEQWLCPHC 787

 Score = 70.9 bits (172), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 50/160 (31%), Positives = 72/160 (45%), Gaps = 41/160 (25%)

Query: 903  EKWKS----KKLTTIKTFNFITMPPILVIHLSRFFYDLTKKNSTVITYPLILNIV----- 953
            E+W      K+  + K      +P  L++HL RF  +L  KN+  + YP +L++      
Sbjct: 780  EQWLCPHCEKRQPSTKQLTITRLPRNLIVHLKRF-DNLLNKNNDFVIYPFLLDLTPFWAN 838

Query: 954  ---------LKNNEVA--------KYRLYGIVNHFGNLISGHYTSLVNKDLKHEIRHGQQ 996
                     + ++E+         KY LYG+  HFG L  GHYT+ V K LK       +
Sbjct: 839  DFDGVFPPGVNDDELPIRGQIPPFKYELYGVACHFGTLYGGHYTAYVKKGLK-------K 891

Query: 997  KWYYFDDEVVKQDNNHGDFDAGIASVSSSDVYVLFYERIY 1036
             W YFDD   K   N  D         +S+ YVLFY R+Y
Sbjct: 892  GWLYFDDTKYKPVKNKAD-------AINSNAYVLFYHRVY 924

 Score = 40.8 bits (94), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 43/79 (54%), Gaps = 12/79 (15%)

Query: 346 VLLVDLRISKRFHNNHIVAPNLINIDPRDLWDVDRKVPISSDVELEKKM------GSYQT 399
           +LL+D+R    F+ +HI   N+I ++P     +  K+   SD +LEKK          + 
Sbjct: 209 ILLIDIRSRLEFNKSHIDTKNIICLEP-----ISFKMSY-SDHDLEKKSLITSPNSEIKM 262

Query: 400 FQSRSKFKYIVYYTDMKTF 418
           FQSR+ FK+I+ YTD   +
Sbjct: 263 FQSRNLFKFIILYTDANEY 281

>CAGL0G05247g Chr7 complement(491024..493867) [2844 bp, 947 aa] {ON}
           similar to uniprot|P32571 Saccharomyces cerevisiae
           YDR069c DOA4 ubiquitin-specific protease
          Length = 947

 Score = 86.3 bits (212), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 70/238 (29%), Positives = 103/238 (43%), Gaps = 27/238 (11%)

Query: 614 GLRNLGSTCYINSMLQCLFATRKFRDIFLSPKYHDYI-------SKGYIHRAQISRSFHM 666
           GL N+G++CY+N +LQC+  T +   IFL+  Y  +I       SKG + R   +R  H+
Sbjct: 584 GLENMGNSCYMNCILQCIMGTNELSQIFLNNSYEKHININSKLGSKGVLARY-FARLAHI 642

Query: 667 LFKKMY--MNGGCSVVPSGFLKACNSMRPDFKIPNXXXXXXXXXXXXXXXXXXXXSDPEQ 724
           + +  Y        V P+ F  A  S+   F+  N                     D  Q
Sbjct: 643 MHQTSYDQEKKAAIVRPTQFRMAIASINSMFRNTNQQDCQEFCQFLLDGLH----EDLNQ 698

Query: 725 VANDYPQLLLHDDDN-----LQVDGKEYDKWFEDSISKNGLSPIDSIFQGQMENCLQCQR 779
             N+ P   L ++       L +      +W E  ++ N  S I  +FQGQ  + L+C  
Sbjct: 699 CGNNPPLKELSEEAEKKRELLSLRIASSIEW-ERFLTTN-FSVIIDLFQGQYASRLKCSV 756

Query: 780 CGHSSYNYSTFYVLSLAIPTPGTSTFGKTKKVLLEDCINLFTSDEVLSGENAWDCPRC 837
           C ++S  Y  F VLS+ +PT      G    V L DC N FT  E L  +  W+CP C
Sbjct: 757 CSNTSTTYQPFSVLSVPLPT------GTKSSVNLMDCFNEFTKCEKLEHDEYWNCPTC 808

 Score = 70.5 bits (171), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 51/154 (33%), Positives = 73/154 (47%), Gaps = 43/154 (27%)

Query: 908  KKLTTIKTFNFITMPPILVIHLSRFFYDLTKKNSTVITYPLILNIVL-----KNNEVA-- 960
            KK  + K      +P  L+IHL RF   + K N+ +I YP  L++       K++ +   
Sbjct: 810  KKQPSTKQLTITRLPRNLIIHLKRFDNRMNK-NTKLIDYPFNLDLTSFWANDKDDRLPPG 868

Query: 961  ---------------KYRLYGIVNHFGNLISGHYTSLVNKDLKHEIRHGQQKWYYFDDE- 1004
                           KY LY + NHFG+L  GHYTS VNK L        + WYYFDD+ 
Sbjct: 869  VSIDELPARGQIPPFKYSLYAVANHFGSLYGGHYTSYVNKGL-------SRGWYYFDDQN 921

Query: 1005 --VVKQDNNHGDFDAGIASVSSSDVYVLFYERIY 1036
              +VK+           + V +S+ YVLFY R++
Sbjct: 922  YRLVKK----------TSEVVNSNAYVLFYRRVH 945

>Kpol_1032.28 s1032 complement(57514..60162) [2649 bp, 882 aa] {ON}
           complement(57514..60162) [2649 nt, 883 aa]
          Length = 882

 Score = 84.7 bits (208), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 69/256 (26%), Positives = 106/256 (41%), Gaps = 63/256 (24%)

Query: 614 GLRNLGSTCYINSMLQCLFATRKFRDIFLSPKYHDYIS--KGYIHRAQISRSFHMLFKKM 671
           GL N+G++CY+N ++QCL +T +   IFL+  Y  +I+       +  +++ F  L   M
Sbjct: 520 GLENMGNSCYMNCIIQCLLSTHELSQIFLNNSYEKHINLNSKLGSKGVLAKYFARLVHTM 579

Query: 672 YMNGGCS--------VVPSGFLKACNSMRPDFKIPNXXXXXXXXXXXXXXXXXXXXSDPE 723
           Y  G           + P  F  AC S+   FK                        + +
Sbjct: 580 YREGSFKRPLEKNKPIQPIQFKMACGSINSLFK-----------------------DNTQ 616

Query: 724 QVANDYPQLLL---HDDDN----------LQVDGKEYDKWFEDSISKN---------GLS 761
           Q + ++ Q LL   H+D N          L  D ++  +     I+ +           S
Sbjct: 617 QDSQEFCQFLLDGLHEDLNQCGANPPLKELSEDAEKMREKLSMRIASSIEWERFLTTDFS 676

Query: 762 PIDSIFQGQMENCLQCQRCGHSSYNYSTFYVLSLAIPTPGTSTFGKTKKVLLEDCINLFT 821
            I  +FQGQ  + L+C+ CG +S  Y TF VLS  +P P  S+        + DC N FT
Sbjct: 677 VIVDLFQGQYASQLKCKVCGCTSTTYQTFSVLS--VPVPHVSS------CHILDCFNEFT 728

Query: 822 SDEVLSGENAWDCPRC 837
             E L  +  W CP C
Sbjct: 729 KVEKLGTDELWSCPTC 744

 Score = 60.5 bits (145), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 41/150 (27%), Positives = 67/150 (44%), Gaps = 36/150 (24%)

Query: 908  KKLTTIKTFNFITMPPILVIHLSRFFYDLTKKNSTVITYPLILNI--------------- 952
            KK  + K      +P  L+IHL RF  ++  KN+  + YP +L++               
Sbjct: 746  KKQPSTKKLTITRLPRNLIIHLKRF-DNMMNKNNVFVKYPFLLDLTPYWANDFDGRLPPG 804

Query: 953  ----VLKNNEVA--KYRLYGIVNHFGNLISGHYTSLVNKDLKHEIRHGQQKWYYFDDEVV 1006
                +    +V   +Y+L  + +H G+L  GHYT+ VNK +        + W+YFDD   
Sbjct: 805  VTDELPTRGQVPPFRYKLNAVASHVGSLYGGHYTAYVNKGI-------NRGWHYFDDTSY 857

Query: 1007 KQDNNHGDFDAGIASVSSSDVYVLFYERIY 1036
            +   N  +         + + YVLFY R+Y
Sbjct: 858  RPIKNETE-------CITPNAYVLFYHRVY 880

 Score = 38.9 bits (89), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 32/115 (27%), Positives = 54/115 (46%), Gaps = 13/115 (11%)

Query: 329 ISCEELMDILQSDERNNVLLVDLRISKRFHNNHIVAPNLINIDPRDLWDVDRKVPISSDV 388
           IS  +L  ++Q  + +++LL+D+R    F + HI A ++I ++P    +        +D+
Sbjct: 170 ISAVQLNHLIQMYD-SSLLLIDVRPRAEFDSKHIKAKSVICVEPVSFKNS------FTDL 222

Query: 389 ELEKK------MGSYQTFQSRSKFKYIVYYTDMKTFLNIDFDYRLVFFQLLYASS 437
           E+EKK            FQ+R K+ YIV YT            +LV   +L   S
Sbjct: 223 EVEKKSLITSPQKEIALFQARDKYNYIVIYTQQSEKTQFYMHQQLVLLDILMNKS 277

>NDAI0A03680 Chr1 (837931..841281) [3351 bp, 1116 aa] {ON} 
          Length = 1116

 Score = 84.0 bits (206), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 72/267 (26%), Positives = 109/267 (40%), Gaps = 71/267 (26%)

Query: 612 ITGLRNLGSTCYINSMLQCLFATRKFRDIFLSPKYHDYI-------SKGYIHRAQISRSF 664
           I GL+N+G++CY+N ++QCL  T +   IFL+  +  YI       SKG + +  +S+  
Sbjct: 746 IIGLQNMGNSCYLNCIIQCLLGTHELTKIFLNYSFERYINLNSKLGSKGVLAK-NLSKLI 804

Query: 665 HMLF----------KKMYMNGGCSVVPSGFLKACNSMRPDFKIPNXXXXXXXXXXXXXXX 714
           H+++          K    +G   + P  F  AC S+   FK                  
Sbjct: 805 HLMYNHSTLKNNGDKTKKKSGNNFIKPIQFRMACGSINNLFK------------------ 846

Query: 715 XXXXXSDPEQVANDYPQLLL---HDDDN----------LQVDGKEYDKWFEDSISKN--- 758
                +  +Q   ++ Q LL   H+D N          L    +   +     I+ +   
Sbjct: 847 -----NCSQQDCQEFCQFLLDALHEDLNQCGSNPPLKELSTKAESMREKLSLRIASSIEW 901

Query: 759 ------GLSPIDSIFQGQMENCLQCQRCGHSSYNYSTFYVLSLAIPTPGTSTFGKTKKVL 812
                   S I  +FQGQ  + LQC+ C H+S  Y  F VLS+ IP        K K + 
Sbjct: 902 ERYLTTDFSVIVDLFQGQYASRLQCKTCIHTSTTYQPFSVLSVPIP--------KKKNLN 953

Query: 813 LEDCINLFTSDEVLSGENAWDCPRCGT 839
           L DC   FT  E L  +  W CP C +
Sbjct: 954 LLDCFKDFTKIENLEVDEQWFCPNCKS 980

 Score = 69.7 bits (169), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 59/160 (36%), Positives = 78/160 (48%), Gaps = 42/160 (26%)

Query: 903  EKW-----KSKKLTTIKTFNFITMPPILVIHLSRFFYDLTKKNSTVITYPLILNI----- 952
            E+W     KSK+ +T K      +P  L+IHL RF  +   KN+ +I YP IL++     
Sbjct: 971  EQWFCPNCKSKQPST-KKLTITRLPRNLIIHLKRF-DNNLNKNNNLIDYPFILDLTQFWA 1028

Query: 953  --------------VLKNNEVA--KYRLYGIVNHFGNLISGHYTSLVNKDLKHEIRHGQQ 996
                          + K  ++   KYRLYG   HFG+L  GHYT+ VNK     IR+G  
Sbjct: 1029 DDFDGELPPGVTDELPKRGQIPPFKYRLYGAALHFGSLYGGHYTAFVNKG----IRNG-- 1082

Query: 997  KWYYFDDEVVKQDNNHGDFDAGIASVSSSDVYVLFYERIY 1036
             WYYFDD   +   N  +         SS+ YVLFY RIY
Sbjct: 1083 -WYYFDDTNYRPIKNERE-------PISSNAYVLFYHRIY 1114

 Score = 33.9 bits (76), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 54/93 (58%), Gaps = 14/93 (15%)

Query: 328 VISCEELMDILQSDERNNVLLVDLRISKRFHNNHIVAPNLINIDPRDL------WDVDRK 381
           +IS + L ++ +S++ +++LL+D+R    F  NHI  PN+I I+P          D+ +K
Sbjct: 222 LISPQHLQELSRSNDDDDILLIDVRPRLNFVENHIDFPNIICIEPISFKPSYTDQDIQQK 281

Query: 382 VPISS-DVELEKKMGSYQTFQSRSKFKYIVYYT 413
             I+S D E+       + F+ R++FK+I+ YT
Sbjct: 282 SLITSPDNEI-------KLFEMRNQFKFIILYT 307

>Smik_5.309 Chr5 complement(462971..465388) [2418 bp, 805 aa] {ON}
           YER144C (REAL)
          Length = 805

 Score = 83.2 bits (204), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 77/266 (28%), Positives = 107/266 (40%), Gaps = 53/266 (19%)

Query: 599 TIEQSSNVYVSLSITGLRNLGSTCYINSMLQCLFATRKFRDIFLSPKYHDYI----SKGY 654
           TI  +S V     I GL N G+ CY+N +LQCL  T     +FL   Y ++I    SKG 
Sbjct: 432 TILNNSQVIDLDFIVGLENTGNCCYMNCILQCLVGTHDLVRMFLDNTYLNFINFDSSKG- 490

Query: 655 IHRAQISRSFHMLFKKMYMNGGCSVVPSGFLKACNSMRPDFKIPNXXXXXXXXXXXXXXX 714
             +  ++++F  L + M+ N       S F+   +   P   I                 
Sbjct: 491 -SKGLLAKNFATLVRNMHRN-------SAFMPVNSRTTPVQTI--------QFKKICGHI 534

Query: 715 XXXXXSDPEQVANDYPQLLL---HDDDNLQVDGKEYDKWFED---------SISK----- 757
                   +Q   ++ Q LL   H+D N Q  GKE+ K   +         +I K     
Sbjct: 535 NSIYSDSMQQDCQEFCQFLLDGLHEDLN-QNGGKEHLKQLTEEEEQKREKMTIRKASALE 593

Query: 758 ------NGLSPIDSIFQGQMENCLQCQRCGHSSYNYSTFYVLSLAIPTPGTSTFGKTKKV 811
                    S I  +FQGQ  + LQCQ C  +S  Y TF VLS+ +P   T         
Sbjct: 594 WERFLLTDFSAIIDLFQGQYASRLQCQACDRTSTTYQTFSVLSVPVPRITTCN------- 646

Query: 812 LLEDCINLFTSDEVLSGENAWDCPRC 837
            + DC   FT  E L  +  W CPRC
Sbjct: 647 -ILDCFREFTKCEKLGIDELWSCPRC 671

 Score = 64.3 bits (155), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 45/148 (30%), Positives = 69/148 (46%), Gaps = 34/148 (22%)

Query: 908  KKLTTIKTFNFITMPPILVIHLSRFFYDLTKKNSTVITYPLILNI-----------VLKN 956
            KK  + K      +P  L+I+L RF   + K N+  + YP  L++            + N
Sbjct: 673  KKQPSTKQLKITRLPKKLIINLKRFDNQMNK-NNVFVQYPYFLDLTPYWARDFNHEAIVN 731

Query: 957  NEVA--------KYRLYGIVNHFGNLISGHYTSLVNKDLKHEIRHGQQKWYYFDDEVVKQ 1008
             ++         +YRLYG+  H G+L  GHYTS V K  K       + WY+FDD + + 
Sbjct: 732  EDIPTRGQIPPFRYRLYGVACHSGSLYGGHYTSYVYKGPK-------KGWYFFDDSIYRP 784

Query: 1009 DNNHGDFDAGIASVSSSDVYVLFYERIY 1036
               + +F        + + YVLFYERI+
Sbjct: 785  IRFNDEF-------ITPNAYVLFYERIF 805

 Score = 39.3 bits (90), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 36/121 (29%), Positives = 56/121 (46%), Gaps = 21/121 (17%)

Query: 315 DFFQNLSRLQKQYVISCEELMDILQSDERNNVLLVDLRISKRFHNNHIVAPNLINIDP-- 372
           ++ +N  +L   + I   +L  +L     + +LL+D+R    F   HI   N+I I+P  
Sbjct: 133 NYIENYPKLLHLHTIDAGKLSSMLHF-HGDTLLLIDVRPRSDFTKAHIKCKNIICIEPVS 191

Query: 373 -------RDLWDVDRKVPISSDVELEKKMGSYQTFQSRSKFKYIVYYTDMKTFLNIDFDY 425
                  R L +V       SD++L         F +R+ FKYIV YTD +  L+ DF  
Sbjct: 192 FKDSFTDRQLENVSLITSSQSDIDL---------FSNRNMFKYIVLYTDAQ--LHGDFWQ 240

Query: 426 R 426
           R
Sbjct: 241 R 241

>CAGL0I06765g Chr9 (655806..658469) [2664 bp, 887 aa] {ON} similar
           to uniprot|P32571 Saccharomyces cerevisiae YDR069c DOA4
           ubiquitin-specific protease
          Length = 887

 Score = 82.4 bits (202), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 78/275 (28%), Positives = 112/275 (40%), Gaps = 32/275 (11%)

Query: 581 RSQHQHYSPISHQYI--SVPTIEQSSNVYVSLSIT-GLRNLGSTCYINSMLQCLFATRKF 637
           RS      PI    I  + P    S N  +  S T GL N+G++CYIN ++QC+FAT + 
Sbjct: 490 RSLEPQLPPIPSTLIRKNSPEKTLSCNQMMDTSFTVGLENMGNSCYINCIIQCIFATTEL 549

Query: 638 RDIFLSPKYHDYISK--GYIHRAQISRSFHMLFKKMYMNGGC--------SVVPSGFLKA 687
             IFL+  Y  +I+K      +  +S +F  L K MY             +V    F  A
Sbjct: 550 IKIFLNGTYAKHINKQSKLGSKGVLSHNFAKLLKDMYEENSSKKIGKKHGAVKTLQFKMA 609

Query: 688 CNSMRPDFKIPNXXXXXXXXXXXXXXXXXXXXSDPEQVANDYPQLLLHDD-----DNLQV 742
           C S+   FK                        D  Q   + P   L  +     +NL +
Sbjct: 610 CASVNSLFK----DASQQDCLEFCQFLLDGLHEDLNQCGANPPLKELSPEAEKMRENLSL 665

Query: 743 DGKEYDKWFEDSISKNGLSPIDSIFQGQMENCLQCQRCGHSSYNYSTFYVLSLAIPTPGT 802
                 +W  +       S I  +FQGQ  + L+C+ C  +S  Y  F VLS+ +P+   
Sbjct: 666 RVASSIEW--ERYLTTDFSIIVDLFQGQYASQLRCKVCNRTSTTYQAFSVLSVPVPS--- 720

Query: 803 STFGKTKKVLLEDCINLFTSDEVLSGENAWDCPRC 837
              GK+  +L  DC   FT  E L  +  W CP C
Sbjct: 721 ---GKSCGLL--DCFIEFTKTENLEVDEQWFCPSC 750

 Score = 65.5 bits (158), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 51/158 (32%), Positives = 67/158 (42%), Gaps = 40/158 (25%)

Query: 903  EKW----KSKKLTTIKTFNFITMPPILVIHLSRFFYDLTKKNSTVITYPLILNIV--LKN 956
            E+W      KK  + K      +P  L+IHL RF  ++  KN+  + YP IL++     N
Sbjct: 743  EQWFCPSCKKKQPSTKKLTITRLPRNLIIHLKRF-DNMMNKNNIFVRYPQILDLTPFWAN 801

Query: 957  NEVAK-------------------YRLYGIVNHFGNLISGHYTSLVNKDLKHEIRHGQQK 997
            +   K                   YRLYG   HFG L  GHYTS V+K         ++ 
Sbjct: 802  DSDGKLPPGITDEIPARGQVPPFNYRLYGAACHFGTLYGGHYTSYVDKG-------PEKG 854

Query: 998  WYYFDDEVVKQDNNHGDFDAGIASVSSSDVYVLFYERI 1035
            W YFDD V +      +F        S   YVLFY RI
Sbjct: 855  WIYFDDTVYRPVRFQNEF-------ISPSAYVLFYHRI 885

 Score = 54.7 bits (130), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 45/172 (26%), Positives = 82/172 (47%), Gaps = 12/172 (6%)

Query: 280 VANIYVQNVD-RYNTHRKDSYHSVYMLNE----DDDTNEYD---FFQNLSRLQKQYV--- 328
           + NI ++++D + N H  +S+  V + N+    + D  E D     Q++  +  +     
Sbjct: 130 IKNIIIKHMDTQENNHSVESHEQVKLSNKKLPVNRDAIEIDKDSILQDIRYINGKRSGSG 189

Query: 329 ISCEELMDILQSDERNNVLLVDLRISKRFHNNHIVAPNLINIDPRDLWDVDRKVPISSDV 388
           ISC EL+ +++  E +++LL+D+R    +  +HI   N+I I+P    +      I    
Sbjct: 190 ISCSELLSLMKMKE-DSLLLIDVRPKLEYDAHHIKTKNIICIEPISFKESYSDQQIEKTS 248

Query: 389 ELEKKMGSYQTFQSRSKFKYIVYYTDMKTFLNIDFDYRLVFFQLLYASSSTR 440
            +       Q FQ RS+F+YI+ YTD++   N  F       ++L   S  R
Sbjct: 249 MIPSPKHEIQLFQRRSEFQYIILYTDLEEKSNFYFQQLKSLLEILLQRSFLR 300

>Suva_5.272 Chr5 complement(429119..431485) [2367 bp, 788 aa] {ON}
           YER144C (REAL)
          Length = 788

 Score = 82.0 bits (201), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 74/282 (26%), Positives = 113/282 (40%), Gaps = 65/282 (23%)

Query: 589 PISHQYISVPTIEQSSNVYVSLSITGLRNLGSTCYINSMLQCLFATRKFRDIFLSPKYHD 648
           P  +  +S P I+ S+ ++    I GL N+G+ CY+N +LQCL  T     +FL   Y +
Sbjct: 405 PQQNLLVSKPPIQNSTQMFDLDFIVGLENMGNCCYMNCILQCLVGTHDLTRMFLDNTYLN 464

Query: 649 YISKGYIH--RAQISRSFHMLFKKMYMNGGCSVVPS--------GFLKACNSMRPDFKIP 698
           +I+   +   +  ++++F  L   M+ +G    + S         F K C  +   +   
Sbjct: 465 FINFDNMRGSKGLLAKNFANLVHTMHRHGAFKPLNSRITPVQTIQFKKTCGHINSIYS-- 522

Query: 699 NXXXXXXXXXXXXXXXXXXXXSDPEQVANDYPQLLL---HDDDNLQVDGKEYDKWFED-- 753
                                   +Q   ++ Q LL   H+D N Q  GK++ K   +  
Sbjct: 523 ---------------------DSMQQDCQEFCQFLLDGLHEDLN-QNGGKKHLKQLSEEE 560

Query: 754 -------SISKNG-----------LSPIDSIFQGQMENCLQCQRCGHSSYNYSTFYVLSL 795
                  SI K              S +  +FQGQ  + LQCQ C H+S  Y TF VLS+
Sbjct: 561 ERTRENMSIRKASALEWERFLLTDFSAVIDLFQGQYASRLQCQACEHTSTTYQTFSVLSV 620

Query: 796 AIPTPGTSTFGKTKKVLLEDCINLFTSDEVLSGENAWDCPRC 837
            +P   T          + DC   FT  E L     W C RC
Sbjct: 621 PVPRIMTCN--------VLDCFREFTKCEKLGIGEQWSCSRC 654

 Score = 65.9 bits (159), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 48/158 (30%), Positives = 71/158 (44%), Gaps = 38/158 (24%)

Query: 902  SEKWKS----KKLTTIKTFNFITMPPILVIHLSRFFYDLTKKNSTVITYPLILNIVLK-- 955
             E+W      KK  + K      +P  L+I+L RF   +  KN+  + YP  L++     
Sbjct: 646  GEQWSCSRCLKKQPSTKQLKITRLPKKLIINLKRFDNQM-HKNNVFVQYPCFLDLTPYWA 704

Query: 956  ---NNEVA--------------KYRLYGIVNHFGNLISGHYTSLVNKDLKHEIRHGQQKW 998
               N+E                +YRLYG+  H G+L  GHYTS V K         Q+ W
Sbjct: 705  RDFNHEAIIDEDIPTRGQIPPFRYRLYGVACHSGSLYGGHYTSYVYKG-------PQKGW 757

Query: 999  YYFDDEVVKQDNNHGDFDAGIASVSSSDVYVLFYERIY 1036
            Y+FDD + +    + +F        + + YVLFYERI+
Sbjct: 758  YFFDDTIYRLIRFNNEF-------ITPNAYVLFYERIF 788

 Score = 37.7 bits (86), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 42/85 (49%), Gaps = 12/85 (14%)

Query: 347 LLVDLRISKRFHNNHIVAPNLINIDPRDLWD-----VDRKVPISSDVELEKKMGSYQTFQ 401
           LLVD+R    F   HI   +++ IDP    D     +  +V +++  +LE ++     F 
Sbjct: 166 LLVDVRPRPEFIKAHIKCKHIMCIDPASFKDSYTDTLVERVSLAASPQLEIEL-----FS 220

Query: 402 SRSKFKYIVYYTDMKTFLNIDFDYR 426
            R+ FK IV YTD  T L  DF  R
Sbjct: 221 KRNTFKNIVLYTD--TQLQGDFQQR 243

>NDAI0C05900 Chr3 complement(1350639..1353119) [2481 bp, 826 aa]
           {ON} Anc_8.188 YDR069C
          Length = 826

 Score = 82.0 bits (201), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 88/353 (24%), Positives = 137/353 (38%), Gaps = 97/353 (27%)

Query: 531 QSIP-AVHLPPLPPKSAINLHYSVATGMQPPMPQVTTVSHAHRHRYLSHSKRSQHQHYSP 589
           Q IP  +H  PL  +S  N   +V  G + P+PQ+  +                   Y+P
Sbjct: 388 QVIPNLIHRAPLDTES--NNTQNVPMGFKNPIPQMYEIPK-----------------YNP 428

Query: 590 ISHQYISVPTIEQSSN---VYVSLSI---TGLRNLGSTCYINSMLQCLFATRKFRDIFLS 643
             +    +P +  ++N   +   L +   TGL N+ ++CY+N ++QCL +T     ++L+
Sbjct: 429 SVNSGPKLPLLPPTANPQQIVPKLDLDFTTGLENVKNSCYMNCVIQCLLSTHDLTKLYLT 488

Query: 644 PKYHDYI-------SKGYIHRAQISRSFHMLFKKMYMNGGCS---------VVPSGFLKA 687
             +   I       SKG++     S++F  L + MY               V P  F  A
Sbjct: 489 NAFLTQINVENKLGSKGFL-----SKNFANLIQTMYKKSAFQPYNPNFLHPVAPLEFKNA 543

Query: 688 CNSMRPDFKIPNXXXXXXXXXXXXXXXXXXXXSDPEQVANDYPQLLL---HDDDNLQVDG 744
           C  M   +                           EQ   ++ + LL   H+D N Q  G
Sbjct: 544 CGMMNSIY-----------------------AESTEQDCQEFCEFLLDGLHEDLN-QCSG 579

Query: 745 KEYDKWFE--------------------DSISKNGLSPIDSIFQGQMENCLQCQRCGHSS 784
               K                       +S      SPI ++FQGQ  + LQC  C H+S
Sbjct: 580 NPRPKELSANEAELRESLSMRIASEIEWESFLTTNFSPIINLFQGQYASRLQCLICQHTS 639

Query: 785 YNYSTFYVLSLAIPTPGTSTFGKTKKVLLEDCINLFTSDEVLSGENAWDCPRC 837
             Y  F +LS+ +P+   S  G+T  +L  DC   FT  E L  +  W CP+C
Sbjct: 640 TTYQPFSLLSIPVPSMVFSN-GQTCNIL--DCFKEFTKCERLDNDEKWFCPKC 689

 Score = 53.5 bits (127), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 47/161 (29%), Positives = 71/161 (44%), Gaps = 42/161 (26%)

Query: 903  EKW-----KSKKLTTIKTFNFITMPPILVIHLSRFFYDLTKKNSTVITYPLILNIV-LKN 956
            EKW     + K+++T K      +P  L+IH  RF  +   KN+  + YP  L++  L  
Sbjct: 682  EKWFCPKCRRKQIST-KQLKITRLPKNLIIHFKRF-DNFMNKNNIFVQYPYQLDLTSLWV 739

Query: 957  NEVA--------------------KYRLYGIVNHFGNLISGHYTSLVNKDLKHEIRHGQQ 996
            N+                      KY+L  +  H GNL SGHYT+ V+K L        +
Sbjct: 740  NDYDGKLPPNFNEPPPSRGQTPPFKYKLNAVSCHSGNLGSGHYTAYVDKGL-------YR 792

Query: 997  KWYYFDDEVVKQDNNHGDFDAGIASVSSSDVYVLFYERIYD 1037
             W+ FDD   +      +F        + D Y+LFY+RIY+
Sbjct: 793  GWFRFDDASYRPVKFGTEF-------LTPDAYLLFYQRIYE 826

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 51/109 (46%), Gaps = 1/109 (0%)

Query: 332 EELMDILQSDERNNVLLVDLRISKRFHNNHIVAPNLINIDPRDLWDVDRKVPISSDVELE 391
           E+L D+L S +RN +LL+D+R  K F   HI AP ++ I P         + I     L 
Sbjct: 172 EKLHDLLSSHKRN-LLLIDVRTRKEFDTLHIDAPIILPIGPLSFKSTFTDLQIEQTSLLT 230

Query: 392 KKMGSYQTFQSRSKFKYIVYYTDMKTFLNIDFDYRLVFFQLLYASSSTR 440
                   F+ R++F+YIV YT         +   +  F +L  ++S R
Sbjct: 231 STFQERNYFKKRNQFRYIVLYTKDDNDTTYYYTQVISLFNILTIAASKR 279

>KLLA0E10275g Chr5 (906675..909065) [2391 bp, 796 aa] {ON} similar
           to uniprot|P39944 Saccharomyces cerevisiae YER144C UBP5
           Putative ubiquitin-specific protease that does not
           associate with the proteasome
          Length = 796

 Score = 81.6 bits (200), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 68/259 (26%), Positives = 102/259 (39%), Gaps = 66/259 (25%)

Query: 614 GLRNLGSTCYINSMLQCLFATRKFRDIFLSPKY--HDYISKGYIHRAQISRSFHMLFKKM 671
           GL NLG++CY+N ++QCL    +   IFL+  Y  H  ++     +  ++  F  L +KM
Sbjct: 433 GLVNLGNSCYLNCIIQCLLGCHELSYIFLTNSYRKHVNVNSRLGSKGLLANYFSQLVQKM 492

Query: 672 YMNG-----------GCSVVPSGFLKACNSMRPDFKIPNXXXXXXXXXXXXXXXXXXXXS 720
           Y  G             +V P+ F  AC S+   FK                        
Sbjct: 493 YQQGKLQAYNNTNMESTAVHPTQFKLACGSINSLFK-----------------------G 529

Query: 721 DPEQVANDYPQLLL---HDDDN-------LQVDGKEYDKWFE------------DSISKN 758
             +Q   ++ Q LL   H+D N       L+    E +K  E            +     
Sbjct: 530 KQQQDCQEFCQFLLDGLHEDLNQCGTNPPLKELSPEAEKMRETMPMRIASAIEWERYLTT 589

Query: 759 GLSPIDSIFQGQMENCLQCQRCGHSSYNYSTFYVLSLAIPTPGTSTFGKTKKVLLEDCIN 818
             S I  +FQGQ  + L+C+ C H+S  Y  F VLS+ +P        + +   + DC  
Sbjct: 590 DFSVIVDLFQGQYASQLRCKICAHTSTTYQAFSVLSVPVP--------RARSCTIYDCFK 641

Query: 819 LFTSDEVLSGENAWDCPRC 837
            FT  E L  +  W CP C
Sbjct: 642 EFTKLETLEKDELWYCPYC 660

 Score = 52.0 bits (123), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 39/136 (28%), Positives = 62/136 (45%), Gaps = 37/136 (27%)

Query: 921  MPPILVIHLSRFFYDLTKKNSTVITYPLILNI-----------VLKNNEVA--------- 960
            +P  L+IHL RF  ++  KN+  + YP  L++           + K+N V+         
Sbjct: 675  LPNNLIIHLKRF-DNMMNKNNVFVNYPNELDLTGFWIDDYNGEMPKDNGVSLPLRGQKPP 733

Query: 961  -KYRLYGIVNHFGNLISGHYTSLVNKDLKHEIRHGQQKWYYFDDEVVKQDNNHGDFDAGI 1019
              YRL+ + +H G L  GHYTS V+K        G+  W  FDD   ++     ++    
Sbjct: 734  FNYRLFAVASHSGTLYGGHYTSFVDK--------GRVGWCSFDDVSWRKIRRKDEY---- 781

Query: 1020 ASVSSSDVYVLFYERI 1035
                + + YVLFY R+
Sbjct: 782  ---ITPNAYVLFYRRV 794

 Score = 39.7 bits (91), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 51/94 (54%), Gaps = 15/94 (15%)

Query: 329 ISCEELMDILQSD-ERNNVLLVDLRISKRFHNNHIVAPNLINIDPRDL------WDVDRK 381
           +S  +L  +++ D + + +LLVD+R    F++ HI   N+I I+P          D+ RK
Sbjct: 156 VSISQLHSLIRHDNDSSGILLVDIRPRMDFNDGHIKHNNVICIEPISFKESYTDSDILRK 215

Query: 382 VPI-SSDVELEKKMGSYQTFQSRSKFKYIVYYTD 414
             I +SD E++        F++R KF+ IV YTD
Sbjct: 216 SLITASDREVD-------LFKNRDKFRLIVLYTD 242

>Kwal_14.2008 s14 (571638..572912) [1275 bp, 424 aa] {ON} YDR069C
           (DOA4) - ubiquitin isopeptidase [contig 424] PARTIAL
          Length = 424

 Score = 80.5 bits (197), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 78/288 (27%), Positives = 112/288 (38%), Gaps = 75/288 (26%)

Query: 588 SPISHQYISVPTIEQSSNVYVSLSITGLRNLGSTCYINSMLQCLFATRKFRDIFLSPKYH 647
            P+ +  ++   +++  N+ V     GL NLG++CY+N ++QCL  TR+   IFL   Y 
Sbjct: 36  GPLQNHSMNSSLVKRGLNINV-----GLVNLGNSCYMNCIIQCLLGTRELVQIFLDDSYK 90

Query: 648 DYI-------SKG--------YIHRAQISRSFHMLFKKMYMNGGCSVVPSGFLKACNSMR 692
           +++       SKG         IH  Q         K    N   +V P  F  AC S+ 
Sbjct: 91  NHVNLNSRLGSKGVLAKYFSQLIHNMQQQAISASGRKSTSGNERNAVQPLHFKVACGSIN 150

Query: 693 PDFKIPNXXXXXXXXXXXXXXXXXXXXSDPEQVANDYPQLLL---HDDDNLQVDG----K 745
             FK                       +  +Q   ++ Q LL   H+D N Q  G    K
Sbjct: 151 SLFK-----------------------TTSQQDCQEFCQFLLDGLHEDLN-QCGGNPALK 186

Query: 746 EYDKWFEDSISK----------------NGLSPIDSIFQGQMENCLQCQRCGHSSYNYST 789
           E  +  E    K                   S I  +FQGQ  + L C+ CG +S  Y  
Sbjct: 187 ELSEEAEAIREKLCMRIASSIEWERYLTTDFSVIVDLFQGQYASQLMCKVCGRTSTTYQP 246

Query: 790 FYVLSLAIPTPGTSTFGKTKKVLLEDCINLFTSDEVLSGENAWDCPRC 837
           F VLS+ +P        +  +  L DC   FT  E L  +  W CPRC
Sbjct: 247 FSVLSVPVP--------RGARCNLLDCFEEFTKIETLEKDEQWSCPRC 286

 Score = 59.3 bits (142), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 46/158 (29%), Positives = 69/158 (43%), Gaps = 39/158 (24%)

Query: 903  EKWKSKKLT----TIKTFNFITMPPILVIHLSRFFYDLTKKNSTVITYPLILNIV--LKN 956
            E+W   +      + K      +P  L+IHL RF  +L  KN+  ++YP  L++     N
Sbjct: 279  EQWSCPRCKVKQPSTKKITITRLPRNLIIHLKRF-DNLLHKNNIFVSYPHTLDLTPFWAN 337

Query: 957  N-------EVAK-----------YRLYGIVNHFGNLISGHYTSLVNKDLKHEIRHGQQKW 998
            +        VA+           Y LY +  HFG L  GHYT+ VNK+ K+        W
Sbjct: 338  DFDGSLPKGVAELPTRGQTPPFHYNLYAVACHFGTLYGGHYTAYVNKEDKN-------GW 390

Query: 999  YYFDDEVVKQDNNHGDFDAGIASVSSSDVYVLFYERIY 1036
             YFDD   ++  +  +         ++  YVLFY R Y
Sbjct: 391  CYFDDTCWRKAKSEDE-------CITTSAYVLFYHRKY 421

>Ecym_6184 Chr6 (341652..344207) [2556 bp, 851 aa] {ON} similar to
           Ashbya gossypii AFR007W
          Length = 851

 Score = 81.3 bits (199), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 60/244 (24%), Positives = 101/244 (41%), Gaps = 37/244 (15%)

Query: 614 GLRNLGSTCYINSMLQCLFATRKFRDIFLSPKYHDYIS--KGYIHRAQISRSFHMLFKKM 671
           GL N G++CY++ ++QCL  T++   +FL+  Y ++I+       +  ++R F  L  +M
Sbjct: 487 GLVNCGNSCYMSCIIQCLLGTQELCTMFLNNSYQNHINLNSRLGSKGVLARYFSQLIHQM 546

Query: 672 YMNGG----------CSVVPSGFLKACNSMRPDFKIPNXXXXXXXXXXXXXXXXXXXXSD 721
           Y  G            +V+P+ F  AC S+   F+                        D
Sbjct: 547 YQQGKDIRKTSGTEKTAVLPAQFKIACGSINALFR----DRSQQDCQEFCQFLLDGLHED 602

Query: 722 PEQVANDYPQLLLHDDDNLQ--------VDGKEYDKWFEDSISKNGLSPIDSIFQGQMEN 773
             Q  N+ P   L +                 E++++          S I  +FQGQ  +
Sbjct: 603 LNQCGNNPPLKELSEKAEKMREMMPMRIASSIEWERYL-----TTDFSVIVDLFQGQYAS 657

Query: 774 CLQCQRCGHSSYNYSTFYVLSLAIPTPGTSTFGKTKKVLLEDCINLFTSDEVLSGENAWD 833
            L+C+ CG +S  Y  F VLS+ +P+        +++  + DC   FT  E L  +  W 
Sbjct: 658 QLRCKVCGRTSTTYQPFSVLSVPVPS--------SRQCTIIDCFTEFTKVETLDLDEQWS 709

Query: 834 CPRC 837
           CP C
Sbjct: 710 CPDC 713

 Score = 65.1 bits (157), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 47/159 (29%), Positives = 70/159 (44%), Gaps = 40/159 (25%)

Query: 903  EKWKS----KKLTTIKTFNFITMPPILVIHLSRFFYDLTKKNSTVITYPLILNI------ 952
            E+W      K+  + K      +P  L+IHL RF  ++  KN+  ++Y  +LN+      
Sbjct: 706  EQWSCPDCKKRQPSTKKITITRLPRNLIIHLKRF-DNMLNKNNVFVSYSAVLNLTSFWAN 764

Query: 953  -----VLKNNEVA----------KYRLYGIVNHFGNLISGHYTSLVNKDLKHEIRHGQQK 997
                 V+ NN V            Y+LYG+  H G L  GHYT+ VNK            
Sbjct: 765  DYDKKVMNNNNVELPSRGQVPPFNYQLYGVACHTGTLYGGHYTAYVNKG-------ATLG 817

Query: 998  WYYFDDEVVKQDNNHGDFDAGIASVSSSDVYVLFYERIY 1036
            W Y+DD   +Q  +  ++        S + YVLFY RI+
Sbjct: 818  WCYYDDTNWRQIRSSNEY-------ISQNAYVLFYHRIH 849

 Score = 41.6 bits (96), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 33/114 (28%), Positives = 47/114 (41%), Gaps = 2/114 (1%)

Query: 346 VLLVDLRISKRFHNNHIVAPNLINIDPRDLWDVDRKVPISSDVELEKKMGSYQTFQSRSK 405
           VLL+D+R    F N HI   +LI I+P    D    + I+    +         FQ R K
Sbjct: 177 VLLIDIRPRVDFVNFHIKFESLICIEPVSFKDSHSDIDIAKKSMITSPDNEIALFQERDK 236

Query: 406 FKYIVYYTDMKTFLNIDFDYRLVFFQLLYASSSTRLRSPPKALL--GDYEQWKT 457
           F+YI+ YT      + +   + V   LL   S  +     K L   G +  W T
Sbjct: 237 FEYIILYTQGSEKNDYNIHQQEVLVDLLINRSFQKSLYNTKILTLDGGFSSWST 290

>ZYRO0G06798g Chr7 (544095..546728) [2634 bp, 877 aa] {ON} some
           similarities with uniprot|P32571 Saccharomyces
           cerevisiae YDR069C DOA4 Ubiquitin hydrolase required for
           recycling ubiquitin from proteasome-bound ubiquitinated
           intermediates acts at the late endosome/prevacuolar
           compartment to recover ubiquitin from ubiquitinated
           membrane proteins en route to the vacuole
          Length = 877

 Score = 81.3 bits (199), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 72/258 (27%), Positives = 102/258 (39%), Gaps = 68/258 (26%)

Query: 614 GLRNLGSTCYINSMLQCLFATRKFRDIFLSPKYHDYI-------SKGYI--HRAQISRSF 664
           GL N+G++CYIN ++QCL  T +  +IFL+  Y  +I       SKG +  H A++    
Sbjct: 516 GLENMGNSCYINCIIQCLLGTHELTNIFLNNSYERHINLNSKLGSKGVLAKHFARLIHQM 575

Query: 665 H--MLFKKMYMNGGCSVVPSGFLKACNSMRPDFKIPNXXXXXXXXXXXXXXXXXXXXSDP 722
           H    FKK   N   +V P  F  AC S+   F+                          
Sbjct: 576 HQSAAFKKSDKNK--AVRPYEFKMACGSINSLFR-----------------------ESG 610

Query: 723 EQVANDYPQLL---LHDDDNLQVDGKEYDKWFEDSISK--------------------NG 759
           +Q + ++ Q L   LH+D N Q  G    K   +   K                      
Sbjct: 611 QQDSQEFCQFLLDGLHEDLN-QCGGNPPLKELSEEAEKMRERLSMRIASSIEWERYLTRD 669

Query: 760 LSPIDSIFQGQMENCLQCQRCGHSSYNYSTFYVLSLAIPTPGTSTFGKTKKVLLEDCINL 819
            S I  +FQGQ  + L+C+ C H+S  Y  F +L+  +P          K   L DC   
Sbjct: 670 FSVIVDLFQGQYASQLRCKVCNHTSTTYQPFSILAAPVP--------HAKSCYLLDCFKE 721

Query: 820 FTSDEVLSGENAWDCPRC 837
           FT  E L  +  W CP C
Sbjct: 722 FTKLEQLEKDEEWLCPYC 739

 Score = 67.0 bits (162), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 48/159 (30%), Positives = 72/159 (45%), Gaps = 40/159 (25%)

Query: 903  EKWKS----KKLTTIKTFNFITMPPILVIHLSRFFYDLTKKNSTVITYPLILNI------ 952
            E+W      KK  + K      +P  L+IHL RF  +L  KN+ ++ YP  L++      
Sbjct: 732  EEWLCPYCKKKQPSTKKLTITRLPRNLIIHLKRF-DNLLNKNNVLVNYPFFLDLTPFWAN 790

Query: 953  -------------VLKNNEVA--KYRLYGIVNHFGNLISGHYTSLVNKDLKHEIRHGQQK 997
                         +    +VA  KY+LY + +H G+L  GHYT+ V+K L        + 
Sbjct: 791  DFDGRLPPGVTDELPSRGQVAPFKYKLYAVASHSGSLYGGHYTAYVDKGL-------NKG 843

Query: 998  WYYFDDEVVKQDNNHGDFDAGIASVSSSDVYVLFYERIY 1036
            WYYFDD   +      +         +S+ YVLFY R+Y
Sbjct: 844  WYYFDDTGYRPMRTPTE-------CITSNAYVLFYHRVY 875

 Score = 51.6 bits (122), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 35/98 (35%), Positives = 52/98 (53%), Gaps = 13/98 (13%)

Query: 323 LQKQYVISCEELMDILQSDERNNVLLVDLRISKRFHNNHIVAPNLINIDPRDLWDVDRKV 382
           L+    IS +EL  +L+SD+RN +LLVD+R    F   HI A N+I I+P          
Sbjct: 148 LKTGGFISAKELEFLLKSDDRN-ILLVDVRQRSEFEETHIKASNVICIEPISFKSS---- 202

Query: 383 PISSDVELEKKMG------SYQTFQSRSKFKYIVYYTD 414
              +D+ELEKK            F+ R++F +++ YTD
Sbjct: 203 --YTDLELEKKSMITSPNVEIDIFKRRNEFTFVILYTD 238

>KLTH0H07678g Chr8 (677217..679802) [2586 bp, 861 aa] {ON} similar
           to uniprot|P32571 Saccharomyces cerevisiae YDR069C DOA4
           Ubiquitin hydrolase required for recycling ubiquitin
           from proteasome-bound ubiquitinated intermediates acts
           at the late endosome/prevacuolar compartment to recover
           ubiquitin from ubiquitinated membrane proteins en route
           to the vacuole
          Length = 861

 Score = 81.3 bits (199), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 78/284 (27%), Positives = 115/284 (40%), Gaps = 75/284 (26%)

Query: 591 SHQYISVPTIEQSSNVYVSLSITGLRNLGSTCYINSMLQCLFATRKFRDIFLSPKYHDYI 650
           ++Q  S P   +++N  V     GL NLG++CY+N ++QCL  T +   IFL   Y +++
Sbjct: 478 NYQNGSKPLTRRNTNFTV-----GLTNLGNSCYMNCIIQCLLGTHELTQIFLDDSYKNHV 532

Query: 651 -------SKGYIHRAQISRSFHMLFKKMY-----MNGG--CSVVPSGFLKACNSMRPDFK 696
                  SKG + +   S+  H + ++        N G   +V P  F  AC S+   F+
Sbjct: 533 NLNSKLGSKGVLAKY-FSQLIHTMQQQAASASTKQNSGDKTAVQPLHFKVACGSINSLFR 591

Query: 697 IPNXXXXXXXXXXXXXXXXXXXXSDPEQVANDYPQLLL---HDDDNLQVDG----KEYDK 749
                                  S  +Q   ++ Q LL   H+D N Q  G    KE  +
Sbjct: 592 -----------------------SSSQQDCQEFCQFLLDGLHEDLN-QCGGNPALKELSE 627

Query: 750 WFEDSISK----------------NGLSPIDSIFQGQMENCLQCQRCGHSSYNYSTFYVL 793
             E    K                   S I  +FQGQ  + L C+ CG +S  Y  F VL
Sbjct: 628 EAEGIREKLCMRIASSIEWERYLTTDFSVIVDLFQGQYASQLTCKVCGRTSTTYQPFSVL 687

Query: 794 SLAIPTPGTSTFGKTKKVLLEDCINLFTSDEVLSGENAWDCPRC 837
           S+ +P+          K  + DC   FT  E L  +  W CPRC
Sbjct: 688 SVPVPS--------GSKCDIIDCFKEFTKVETLEKDEQWSCPRC 723

 Score = 59.3 bits (142), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 49/160 (30%), Positives = 69/160 (43%), Gaps = 41/160 (25%)

Query: 903  EKW-----KSKKLTTIKTFNFITMPPILVIHLSRFFYDLTKKNSTVITYPLILNI----- 952
            E+W     K K+ +T K      +P  LVIHL R F +L  KN+  ++YP  L++     
Sbjct: 716  EQWSCPRCKCKQPST-KKITITRLPRNLVIHLKR-FDNLLHKNNIFVSYPHTLDLTPFWA 773

Query: 953  -------------VLKNNEVA--KYRLYGIVNHFGNLISGHYTSLVNKDLKHEIRHGQQK 997
                         +    +V    Y LY +  HFG L  GHYTS V+K  K         
Sbjct: 774  NDFDGRLPPGVAELPTRGQVPPFNYNLYAVACHFGTLYGGHYTSYVDKGDK-------AG 826

Query: 998  WYYFDDEVVKQDNNHGDFDAGIASVSSSDVYVLFYERIYD 1037
            W YFDD   ++  + G+         +   YVLFY R Y+
Sbjct: 827  WCYFDDTSWRKAKSQGE-------CITLSAYVLFYHRKYN 859

 Score = 45.4 bits (106), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 40/87 (45%), Gaps = 3/87 (3%)

Query: 328 VISCEELMDILQSDERNNVLLVDLRISKRFHNNHIVAPNLINIDPRDLWDVDRKVPISSD 387
            IS  EL  +L +    N LL+DLR   +F  +HI    ++ I+P    D      I+  
Sbjct: 163 AISPSELQSLLGA---QNALLIDLRPRIKFVESHIKTDKIMCIEPISFKDSYSDTEITRR 219

Query: 388 VELEKKMGSYQTFQSRSKFKYIVYYTD 414
             +       Q FQ R KF YIV YTD
Sbjct: 220 SLITSPNEEVQLFQERDKFDYIVIYTD 246

>Skud_5.281 Chr5 complement(448432..450903) [2472 bp, 823 aa] {ON}
           YER144C (REAL)
          Length = 823

 Score = 80.5 bits (197), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 75/279 (26%), Positives = 113/279 (40%), Gaps = 57/279 (20%)

Query: 589 PISHQYISVP--TIEQSSNVYVSLSITGLRNLGSTCYINSMLQCLFATRKFRDIFLSPKY 646
           P+  Q +S P   I  +S  +    I GL N+G+ CY+N +LQCL  T     +FL   Y
Sbjct: 438 PLPQQNLSPPKHAIFNNSQAFDLDFIVGLENMGNCCYMNCILQCLVGTHDLTRMFLDNTY 497

Query: 647 HDYISKGYIH--RAQISRSFHMLFKKMYMNGGCSVVPSGFLKACNSMRPDFKIPNXXXXX 704
            ++I+ G     +  +++++  L   M+ +G                   FK P+     
Sbjct: 498 LNFINFGNTRGSKGLLAKNYATLVHNMHRHGA------------------FKPPHSRTTP 539

Query: 705 XXXXXXXXXXXXXXX--SDP-EQVANDYPQLLL---HDDDNLQVDGKEYDKWFED----- 753
                            SD  +Q   ++ Q LL   H+D N Q  GK++ K   +     
Sbjct: 540 VQTLQFKKVCGHINSIYSDSMQQDCQEFCQFLLDGLHEDLN-QNGGKKHLKQLSEQEERM 598

Query: 754 ----SISKNG-----------LSPIDSIFQGQMENCLQCQRCGHSSYNYSTFYVLSLAIP 798
               SI K              S I  +FQGQ  + LQCQ C H+S  Y TF VLS+ +P
Sbjct: 599 RESMSIRKASALEWERFLLTDFSAIIDLFQGQYASRLQCQACEHTSTTYQTFSVLSVPVP 658

Query: 799 TPGTSTFGKTKKVLLEDCINLFTSDEVLSGENAWDCPRC 837
                   + +   + DC   FT  E L  +  W C +C
Sbjct: 659 --------RIRTCNILDCFREFTKCEKLGVDEQWSCSKC 689

 Score = 66.6 bits (161), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 48/157 (30%), Positives = 71/157 (45%), Gaps = 38/157 (24%)

Query: 903  EKWKS----KKLTTIKTFNFITMPPILVIHLSRFFYDLTKKNSTVITYPLILNIV----- 953
            E+W      KK  + K      +P  L+I+L RF   + K N+  + YP  L++      
Sbjct: 682  EQWSCSKCLKKQPSTKQLKITRLPKKLIINLKRFDNQMNK-NNVFVQYPCFLDLTPYWAR 740

Query: 954  ------LKNNEVA--------KYRLYGIVNHFGNLISGHYTSLVNKDLKHEIRHGQQKWY 999
                  + N ++         +YRLYG+  H G+L  GHYTS V K         Q+ WY
Sbjct: 741  DFNHESIVNEDIPTRGQIPPFRYRLYGVACHSGSLYGGHYTSYVYKG-------PQKGWY 793

Query: 1000 YFDDEVVKQDNNHGDFDAGIASVSSSDVYVLFYERIY 1036
            +FDD V      + +F        + + YVLFYERI+
Sbjct: 794  FFDDSVYCPIRFNDEF-------ITPNAYVLFYERIF 823

 Score = 38.5 bits (88), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 28/121 (23%), Positives = 46/121 (38%), Gaps = 2/121 (1%)

Query: 344 NNVLLVDLRISKRFHNNHIVAPNLINIDPRDLWDVDRKVPISSDVELEKKMGSYQTFQSR 403
            ++L++D+R    F   HI   N+I I+P    D      +               F +R
Sbjct: 177 GSILVIDIRPRSEFIKAHIKCKNIICIEPVSFKDSFTDQQVGKISLATSPQSEIDLFSNR 236

Query: 404 SKFKYIVYYTDMKTFLNIDFDYRLVFFQLLYASSSTRLRSPPKALL--GDYEQWKTFIGQ 461
             FKYIV YTD + + +       +  ++L   S  +     K L+    +  W    G 
Sbjct: 237 DTFKYIVLYTDTQLYGDFHQRQTRILTKILCQHSVLKPLGGTKVLILANGFSNWVKLGGA 296

Query: 462 Y 462
           Y
Sbjct: 297 Y 297

>NCAS0B04280 Chr2 (777104..779872) [2769 bp, 922 aa] {ON} Anc_8.188
          Length = 922

 Score = 79.3 bits (194), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 74/260 (28%), Positives = 106/260 (40%), Gaps = 67/260 (25%)

Query: 612 ITGLRNLGSTCYINSMLQCLFATRKFRDIFLSPKYHDYI-------SKGYIHRAQISRSF 664
           I GL+N+G++CY+N ++QCL  T +   IFL+  Y  +I       SKG + +   +R  
Sbjct: 558 IVGLQNIGNSCYLNCIIQCLLGTHELTKIFLNNFYERHINLNSKLGSKGVLAKY-FARLI 616

Query: 665 HMLFK----KMYMNGGCSVVPSGFLKACNSMRPDFKIPNXXXXXXXXXXXXXXXXXXXXS 720
           H++      K+  N    V P+ F  A  S+   FK                       +
Sbjct: 617 HLMHNHANPKLKNN---YVRPAQFKMAVGSVNTLFK-----------------------N 650

Query: 721 DPEQVANDYPQLLL---HDDDNLQVDGKEYDKWFEDSISKN------------------- 758
             +Q   ++ Q LL   H+D N Q       K    +  KN                   
Sbjct: 651 CSQQDCQEFCQFLLDGLHEDLN-QCGSNPPLKELSSAAEKNREKLSLRIASSIEWERFLT 709

Query: 759 -GLSPIDSIFQGQMENCLQCQRCGHSSYNYSTFYVLSLAIPTPGTSTFGKTKKVLLEDCI 817
              S I  +FQGQ  + LQC+ C H+S  Y  F VLS+ IP        K  KV + DC 
Sbjct: 710 TDFSVIVDLFQGQYASRLQCEVCKHTSTTYQPFSVLSVPIP-----RVPKGVKVNILDCF 764

Query: 818 NLFTSDEVLSGENAWDCPRC 837
             FT  E+L  +  W CP C
Sbjct: 765 KDFTKLELLDTDEQWLCPTC 784

 Score = 68.6 bits (166), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 52/151 (34%), Positives = 73/151 (48%), Gaps = 36/151 (23%)

Query: 908  KKLTTIKTFNFITMPPILVIHLSRFFYDLTKKNSTVITYPLILNI--------------- 952
            KK  + K      +P  L+IHL RF  +   KN+  I YP IL++               
Sbjct: 786  KKQRSTKKLTITRLPRNLIIHLKRF-DNNLNKNNNFIDYPFILDLTQFWVDDFDGKLPPG 844

Query: 953  ----VLKNNEVA--KYRLYGIVNHFGNLISGHYTSLVNKDLKHEIRHGQQKWYYFDDEVV 1006
                + K  ++   KY+LYG+ +HFG+L  GHYT+ V+K  KH        WYYFDD   
Sbjct: 845  VRDELPKRGQIPPFKYKLYGVASHFGSLYGGHYTAYVDKGPKH-------GWYYFDDTNY 897

Query: 1007 KQDNNHGDFDAGIASVSSSDVYVLFYERIYD 1037
            +   N  +       ++SS  Y+LFY RIYD
Sbjct: 898  RSIKNKNE------PITSS-AYLLFYHRIYD 921

 Score = 38.5 bits (88), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 36/135 (26%), Positives = 63/135 (46%), Gaps = 15/135 (11%)

Query: 310 DTNEYDFFQNLSRLQKQYVISCEELMDILQSDERN-NVLLVDLRISKRFHNNHIVAPNLI 368
           DT +    Q L  ++   +IS  +L  +L     N +VLL+D+R    F  +HI    +I
Sbjct: 146 DTRKAKGKQELFSMKNGSLISSYQLKQLLYGKNDNTSVLLIDIRPRLEFSKSHIKHEEII 205

Query: 369 NIDPRDLWD------VDRKVPISSDVELEKKMGSYQTFQSRSKFKYIVYYTDMKTFLNID 422
            ++P    D      V +K  I+S  E          F  R++F++I+ YT+ K      
Sbjct: 206 CVEPISFKDSYSDEEVAKKSLITSPNE------EIDLFNKRNEFEFIILYTNDKE--KAY 257

Query: 423 FDYRLVFFQLLYASS 437
           ++ ++VF ++L   S
Sbjct: 258 YNQQMVFLEILLTHS 272

>SAKL0H18986g Chr8 (1683752..1686433) [2682 bp, 893 aa] {ON} similar
           to uniprot|P32571 Saccharomyces cerevisiae YDR069C DOA4
           Ubiquitin hydrolase required for recycling ubiquitin
           from proteasome-bound ubiquitinated intermediates acts
           at the late endosome/prevacuolar compartment to recover
           ubiquitin from ubiquitinated membrane proteins en route
           to the vacuole
          Length = 893

 Score = 75.1 bits (183), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 66/265 (24%), Positives = 99/265 (37%), Gaps = 73/265 (27%)

Query: 614 GLRNLGSTCYINSMLQCLFATRKFRDIFLSPKYHDYI--SKGYIHRAQISRSFHMLFKKM 671
           GL NLG++CY+N ++QCL  T +   +FL+  Y ++I  +     +  +++ F  L   M
Sbjct: 524 GLVNLGNSCYMNCIIQCLLGTHELSQMFLNDSYKNHINFNSKLGSKGVLAKYFSQLVHNM 583

Query: 672 YMNGG----------------CSVVPSGFLKACNSMRPDFKIPNXXXXXXXXXXXXXXXX 715
           Y                     +V P  F  AC ++   F+                   
Sbjct: 584 YRQNTPTSSFSSKKKLSGDERNAVQPLNFKIACGTINSLFR------------------- 624

Query: 716 XXXXSDPEQVANDYPQLL---LHDDDNLQVDGKEYDKWFEDSISK--------------- 757
                  +Q   ++ Q L   LH+D N Q  G    K   +   K               
Sbjct: 625 ----DCSQQDCQEFCQFLLDGLHEDLN-QCGGNPRLKELSEEAEKIREKLSMRIASSIEW 679

Query: 758 -----NGLSPIDSIFQGQMENCLQCQRCGHSSYNYSTFYVLSLAIPTPGTSTFGKTKKVL 812
                   S I  +FQGQ  + L+CQ CG +S  Y  F VLS+ +P+         K   
Sbjct: 680 ERYLTTDFSVIVDLFQGQYASQLKCQVCGRTSTTYQPFSVLSVPLPS--------LKSCN 731

Query: 813 LEDCINLFTSDEVLSGENAWDCPRC 837
           + DC   FT  E L  +  W CP C
Sbjct: 732 ILDCFQEFTKVETLEKDEQWSCPDC 756

 Score = 60.5 bits (145), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 43/158 (27%), Positives = 70/158 (44%), Gaps = 39/158 (24%)

Query: 903  EKWKS----KKLTTIKTFNFITMPPILVIHLSRFFYDLTKKNSTVITYPLILNI------ 952
            E+W      K+  + K      +P  L+IHL R F ++  KN+  ++YP  L++      
Sbjct: 749  EQWSCPDCKKRQPSTKKITITRLPRNLIIHLKR-FDNMMNKNNVFVSYPHTLDLTPFWAN 807

Query: 953  ------------VLKNNEVA--KYRLYGIVNHFGNLISGHYTSLVNKDLKHEIRHGQQKW 998
                        +    +V    Y+LY + +H G L  GHYT+ V+K         Q+ W
Sbjct: 808  DFDGRLPPGVTELPTRGQVPPFSYKLYAVASHTGTLYGGHYTAYVHKG-------SQRGW 860

Query: 999  YYFDDEVVKQDNNHGDFDAGIASVSSSDVYVLFYERIY 1036
             YFDD   ++  +  +         +S+ YVLFY R+Y
Sbjct: 861  CYFDDTNWRRSRSDNE-------CITSNAYVLFYHRVY 891

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 45/86 (52%), Gaps = 3/86 (3%)

Query: 328 VISCEELMDILQSDERNNVLLVDLRISKRFHNNHIVAPNLINIDPRDLWDVDRKVPISSD 387
            I+C+ L +++ +   ++VLL+DLR    F  +HI +P++I I+P    D    + ++  
Sbjct: 161 TIACQHLQNLMAA---SSVLLIDLRPRMEFIKSHIKSPSVICIEPISFKDTYSDLDLAKK 217

Query: 388 VELEKKMGSYQTFQSRSKFKYIVYYT 413
             +       + F  R  F++IV YT
Sbjct: 218 SMITSPNCEIELFSKRDTFQFIVLYT 243

>KNAG0G01590 Chr7 complement(354369..356384) [2016 bp, 671 aa] {ON}
            Anc_8.188 YDR069C
          Length = 671

 Score = 63.2 bits (152), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 41/145 (28%), Positives = 68/145 (46%), Gaps = 26/145 (17%)

Query: 899  MPGSEKW-----KSKKLTTIKTFNFITMPPILVIHLSRFFYDLTKKNSTVITYPLILNIV 953
            + G ++W     K+K  +T+ T     +P +L+IH +RF  +L  K    + YP +L++ 
Sbjct: 542  LTGDDRWYCSTCKTKTHSTLGT-TITNVPEVLIIHFNRF-DNLLNKKECFVKYPYLLDLS 599

Query: 954  LKNNEVAK----YRLYGIVNHFGNLISGHYTSLVNKDLKHEIRHGQQKWYYFDDEVVKQD 1009
              N  + K    Y+L  +  H G L SGHYT+          ++ +  WY+FDD   K  
Sbjct: 600  QGNGLLGKCDVPYKLVAVACHTGTLFSGHYTAYC-------FKNSENGWYHFDDTQCKPV 652

Query: 1010 NNHGDFDAGIASVSSSDVYVLFYER 1034
            +N            S   Y+LFY++
Sbjct: 653  SN--------GECISQSAYLLFYQK 669

 Score = 57.0 bits (136), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 62/255 (24%), Positives = 99/255 (38%), Gaps = 69/255 (27%)

Query: 612 ITGLRNLGSTCYINSMLQCLFATRKFRDIFLSPKYHDYISKGYIHRAQISRSFHMLFKKM 671
           I G++N G+ CY+N ++QCL    +F + FL   Y   I+         SR  H   + +
Sbjct: 343 IKGIQNEGNCCYMNCIIQCLLCFPEFTNKFLDNAYLGTINVN-------SRLGH---QGL 392

Query: 672 YMNGGCSVVPSGFLKACNSMRPDFKIPNXXXXXXXXXXXXXXXXXXXXSDPEQVANDYPQ 731
            +     ++ + F  +  +++P   I                         EQ AN +P+
Sbjct: 393 VVKNWAKIIQAFFQVSQENIQPAVSITEFR---------------------EQWANLFPE 431

Query: 732 ---------------LL--LHDDDN----------LQVDGKEYDKWFEDSISKNGLSPID 764
                          LL  +H+D N          +QVD    + W  +   K   S I 
Sbjct: 432 YGKYQQHDCSEFCLRLLEEIHEDSNWGRPQNSDAAMQVDDYR-EAW--NLYRKGNSSYIV 488

Query: 765 SIFQGQMENCLQCQRCGHSSYNYSTFYVLSLAIPTPGTSTFGKTKKVLLEDCINLFTSDE 824
             F+GQ+++ L CQ C   S NY  F +L+L IP              + DC+       
Sbjct: 489 DTFKGQIKSQLTCQVCQTQSNNYEPFSILNLPIPL--------VSMCHIYDCMKELFKVH 540

Query: 825 VLSGENAWDCPRCGT 839
           VL+G++ W C  C T
Sbjct: 541 VLTGDDRWYCSTCKT 555

>Skud_2.38 Chr2 complement(77293..79539) [2247 bp, 748 aa] {ON}
            YBL067C (REAL)
          Length = 748

 Score = 60.5 bits (145), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 48/124 (38%), Positives = 59/124 (47%), Gaps = 17/124 (13%)

Query: 921  MPPILVIHLSRFFYDLTKKNSTV-----ITYPLILNIVLK-NNEVA-KYRLYGIVNHFGN 973
            +P  L +HL RF Y   K+N  +     I YPL LN+    N+EV  KY L GIV H G 
Sbjct: 557  LPDTLALHLKRFKYS-EKQNCNIKLFNDIHYPLTLNVCSSINSEVCQKYELSGIVVHMGG 615

Query: 974  LIS-GHYTSLVNKDLKHEIRHGQQKWYYFDDEVVKQDNNHGDFDAGIASVSSSDVYVLFY 1032
                GHY SL     KHEI      W  FDDE V+        +    S + +  YVLFY
Sbjct: 616  GPQHGHYVSLC----KHEIF----GWLLFDDETVEAVKEEAVLEFTGESPNMATAYVLFY 667

Query: 1033 ERIY 1036
            +  Y
Sbjct: 668  KTKY 671

 Score = 35.8 bits (81), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 19/31 (61%)

Query: 612 ITGLRNLGSTCYINSMLQCLFATRKFRDIFL 642
           + G  N G+TCY NS+LQCL+     R+  L
Sbjct: 140 VFGYENFGNTCYCNSVLQCLYNLSSVRENIL 170

>Smik_2.49 Chr2 complement(87575..89812) [2238 bp, 745 aa] {ON}
            YBL067C (REAL)
          Length = 745

 Score = 59.7 bits (143), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 44/123 (35%), Positives = 58/123 (47%), Gaps = 17/123 (13%)

Query: 921  MPPILVIHLSRFFYDLTKKNSTV-----ITYPLILNIVLK-NNEVA-KYRLYGIVNHFGN 973
            +P  L +HL RF Y   K+N  +     I YPL LN+    N+EV  KY L GIV H G 
Sbjct: 555  LPDTLTLHLKRFKYS-EKQNCNIKLFNNIHYPLTLNVCSSINSEVCQKYELAGIVVHMGG 613

Query: 974  LIS-GHYTSLVNKDLKHEIRHGQQKWYYFDDEVVKQDNNHGDFDAGIASVSSSDVYVLFY 1032
                GHY SL         +H +  W  FDDE V+        +    S + +  YVLFY
Sbjct: 614  GPQHGHYVSLC--------KHQKFGWLLFDDETVEAVKEETVLEFTGESANMATAYVLFY 665

Query: 1033 ERI 1035
            + +
Sbjct: 666  KAV 668

 Score = 35.8 bits (81), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 19/31 (61%)

Query: 612 ITGLRNLGSTCYINSMLQCLFATRKFRDIFL 642
           + G  N G+TCY NS+LQCL+     R+  L
Sbjct: 139 VFGYENFGNTCYCNSVLQCLYNLSPLRENIL 169

>ZYRO0C17908g Chr3 complement(1393864..1397478) [3615 bp, 1204 aa]
           {ON} similar to uniprot|P39538 Saccharomyces cerevisiae
           YJL197W UBP12 Ubiquitin-specific protease present in the
           nucleus and cytoplasm that cleaves ubiquitin from
           ubiquitinated proteins
          Length = 1204

 Score = 59.7 bits (143), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 58/206 (28%), Positives = 87/206 (42%), Gaps = 20/206 (9%)

Query: 609 SLSITGLRNLGSTCYINSMLQCLFATRKFRDIFLSPKYHDYIS-------KGYIHRAQIS 661
           S  ITGL NLG+TCY+NS LQCL    + RD FL   + D I+       +GY+ RA  S
Sbjct: 289 SSGITGLYNLGNTCYMNSALQCLVHIPELRDYFLYNCFEDEINCNNPLGYQGYVARA-FS 347

Query: 662 RSFHMLFKKMYMNGGCSVVPS----GF---LKACNSMRPDFKIPNXXXXXXXXXXXXXXX 714
                LF    ++ G ++ P+    GF   +   NSM   +   +               
Sbjct: 348 GLVQNLFGCKTLSSGSTLTPAYSPTGFKSTIGHFNSMFSGYMQQDSQEFITFLLDGLHED 407

Query: 715 XXXXXSDPEQVANDYPQLLLHDDDN-LQVDGKEYDKWFEDSISKNGLSPIDSIFQGQMEN 773
                  P     + P L   DD N   V  +  +  ++  + +N  S I  +F G  E+
Sbjct: 408 LNRIVDKP---YIEKPSLSPEDDSNDFNVIKRLAEDTWKLHLQRND-SVITDLFVGLYES 463

Query: 774 CLQCQRCGHSSYNYSTFYVLSLAIPT 799
            LQC  C + S  +  +  L+L +P 
Sbjct: 464 TLQCPECNNVSITFDPYNDLTLPLPV 489

 Score = 41.2 bits (95), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 42/130 (32%), Positives = 59/130 (45%), Gaps = 25/130 (19%)

Query: 914  KTFNFITMPPILVIHLSRF--FYDLTKKNSTVITYPLI---LNIVLKNNEVAKYRLYGIV 968
            K       P +L+IHL RF      + K   V+ +P+    ++  L N    +  +Y +V
Sbjct: 914  KQIQLWDTPDVLLIHLKRFENLRSFSDKIDEVVHFPITGLDMSPYLVNKGDPRGTIYDLV 973

Query: 969  ---NHFGNLISGHYTSLV-NKDLKHEIRHGQQKWYYFDDEVVKQDNNHGDFDAGIASVSS 1024
               NH+G L  GHYT+   N D          KWYYFDD  V +       + GIAS + 
Sbjct: 974  AVDNHYGGLGGGHYTAYAKNVD--------DSKWYYFDDSRVTETTP----ERGIASSA- 1020

Query: 1025 SDVYVLFYER 1034
               Y+LFY R
Sbjct: 1021 ---YLLFYVR 1027

 Score = 38.5 bits (88), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 20/31 (64%)

Query: 807 KTKKVLLEDCINLFTSDEVLSGENAWDCPRC 837
           + KK+ L DC+ LF+  EVL   ++W CP C
Sbjct: 876 EEKKITLHDCLKLFSKREVLGMNDSWYCPSC 906

>Suva_2.50 Chr2 complement(90700..92952) [2253 bp, 750 aa] {ON}
            YBL067C (REAL)
          Length = 750

 Score = 59.3 bits (142), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 44/124 (35%), Positives = 60/124 (48%), Gaps = 17/124 (13%)

Query: 921  MPPILVIHLSRFFYDLTKKNSTV-----ITYPLILNIVLK-NNEVA-KYRLYGIVNHFGN 973
            +P  L +HL RF Y   K+N  +     I YPL LN+    N+EV  KY+L GIV H G 
Sbjct: 558  LPDTLALHLKRFKYS-EKQNCNIKLFNNIRYPLTLNVCSSINSEVCQKYQLAGIVVHMGG 616

Query: 974  LIS-GHYTSLVNKDLKHEIRHGQQKWYYFDDEVVKQDNNHGDFDAGIASVSSSDVYVLFY 1032
                GHY SL         +H +  W  FDDE V+        +    S + +  YVLFY
Sbjct: 617  GPQHGHYVSLC--------KHEKFGWLLFDDETVEAVKEETVLEFTGESPNMATAYVLFY 668

Query: 1033 ERIY 1036
            + ++
Sbjct: 669  KAMH 672

 Score = 36.6 bits (83), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 19/31 (61%)

Query: 612 ITGLRNLGSTCYINSMLQCLFATRKFRDIFL 642
           + G  N G+TCY NS+LQCL+     R+  L
Sbjct: 140 VFGYENFGNTCYCNSVLQCLYNLSSLRENIL 170

>NCAS0A03910 Chr1 (791578..793965) [2388 bp, 795 aa] {ON} Anc_8.188
          Length = 795

 Score = 58.9 bits (141), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 60/243 (24%), Positives = 95/243 (39%), Gaps = 30/243 (12%)

Query: 612 ITGLRNLGSTCYINSMLQCLFATRKFRDIFLSPKYHDYI-------SKGYI--HRAQISR 662
           I GL N+ ++CY+N ++QCL +  +   I L+  +  +I       SKG I  H A++ +
Sbjct: 428 IIGLENMSNSCYMNCIIQCLLSVPELIQICLNNSFLKHINMESKLGSKGVIMKHFAKLIQ 487

Query: 663 SFHMLFKKMYMNGGCS-----VVPSGFLKACNSMRPDFKIPNXXXXXXXXXXXXXXXXXX 717
             H       +  G S     V    F  AC S+   +                      
Sbjct: 488 DMH----SQQVKTGRSLFSYPVKTIDFKNACASVSSIYS----GSQQQDCQEFCEFLLDG 539

Query: 718 XXSDPEQVANDYPQLLLHDDDNLQVDG---KEYDKWFEDSISKNGLSPIDSIFQGQMENC 774
              D  Q   + P   L D +    +G   +       ++   N  S I  +F GQ  + 
Sbjct: 540 LHEDLNQCGGNPPARELTDQEERLREGLCMRVASSMAWENFLHNNFSLIIDLFAGQYGSQ 599

Query: 775 LQCQRCGHSSYNYSTFYVLSLAIPTPGTSTFGKTKKVLLEDCINLFTSDEVLSGENAWDC 834
           L+C  C ++S  Y  F +LS  +P P +S   +   +   DC   FT  E L  +  W C
Sbjct: 600 LRCCVCQYTSTTYQPFTLLS--VPVPLSSRVSRCSII---DCFQEFTKCERLDKDEEWFC 654

Query: 835 PRC 837
           P+C
Sbjct: 655 PQC 657

 Score = 56.6 bits (135), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 48/164 (29%), Positives = 69/164 (42%), Gaps = 47/164 (28%)

Query: 903  EKW----KSKKLTTIKTFNFITMPPILVIHLSRFFYDLTKKNSTVITYPLILNI------ 952
            E+W      +K  + K      +P  L+IH  RF  ++  KN+  I YP  L++      
Sbjct: 650  EEWFCPQCKRKQPSTKQLKITRLPKNLIIHFKRF-DNMMNKNNIFIQYPYELDLTPFWVN 708

Query: 953  --------------VLKNNEVA--KYRLYGIVNHFGNLISGHYTSLVNKDLKHEIRHGQQ 996
                          + K  +V   KY+L  +  H G L SGHYT+ VNK           
Sbjct: 709  DFNGELPLGMTNSLLTKGGQVGPFKYQLNAVACHMGTLGSGHYTAYVNKG-------PDV 761

Query: 997  KWYYFDD---EVVKQDNNHGDFDAGIASVSSSDVYVLFYERIYD 1037
             WYYFDD    +VK    + + DA          Y+LFY R+Y+
Sbjct: 762  GWYYFDDSSHRIVKIATEYMNPDA----------YLLFYHRVYN 795

 Score = 37.0 bits (84), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 27/88 (30%), Positives = 48/88 (54%), Gaps = 7/88 (7%)

Query: 329 ISCEELMDILQSDERNNVLLVDLRISKRFHNNHIVAPNLINIDP---RDLWDVDRKVPIS 385
           ++  +L  IL SD++ +VLL+D+R    F  +HI +  ++ +DP   +  + +D+   IS
Sbjct: 160 LTVPQLQTIL-SDQKISVLLIDVRKRYEFEFSHINSVAVLPLDPISFKPTYTIDQLEKIS 218

Query: 386 SDVELEKKMGSYQTFQSRSKFKYIVYYT 413
               +   M   Q FQ R+++  IV YT
Sbjct: 219 F---INSPMHELQLFQKRNEYDVIVLYT 243

>YBL067C Chr2 complement(93639..95882) [2244 bp, 747 aa] {ON}
            UBP13Putative ubiquitin carboxyl-terminal hydrolase,
            ubiquitin-specific protease that cleaves
            ubiquitin-protein fusions
          Length = 747

 Score = 58.5 bits (140), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 42/124 (33%), Positives = 57/124 (45%), Gaps = 17/124 (13%)

Query: 921  MPPILVIHLSRFFYDLTKKNSTV-----ITYPLILNIV--LKNNEVAKYRLYGIVNHFGN 973
            +P  L +HL RF Y   K+N  +     I YPL LN+   + +    KY L GIV H G 
Sbjct: 555  LPDTLTLHLKRFKYS-EKQNCNIKLFNNIHYPLTLNVCSSINSKVCQKYELAGIVVHMGG 613

Query: 974  LIS-GHYTSLVNKDLKHEIRHGQQKWYYFDDEVVKQDNNHGDFDAGIASVSSSDVYVLFY 1032
                GHY SL         +H +  W  FDDE V+        +    S + +  YVLFY
Sbjct: 614  GPQHGHYVSLC--------KHEKFGWLLFDDETVEAVKEETVLEFTGESPNMATAYVLFY 665

Query: 1033 ERIY 1036
            + +Y
Sbjct: 666  KAMY 669

 Score = 36.6 bits (83), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 19/31 (61%)

Query: 612 ITGLRNLGSTCYINSMLQCLFATRKFRDIFL 642
           + G  N G+TCY NS+LQCL+     R+  L
Sbjct: 139 VFGYENFGNTCYCNSVLQCLYNLSSLRENIL 169

>KNAG0C03580 Chr3 complement(699604..701934) [2331 bp, 776 aa] {ON}
            Anc_7.390 YBL067C
          Length = 776

 Score = 58.2 bits (139), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 47/124 (37%), Positives = 62/124 (50%), Gaps = 17/124 (13%)

Query: 920  TMPPILVIHLSRFFYDLTKKNSTV-----ITYPLILNIVLK-NNEVAK-YRLYGIVNHFG 972
            ++P  L +HL RF Y   +KN+ V     I YPLILN     ++ V+K YRL G+V H G
Sbjct: 563  SLPKTLSLHLKRFKYS-EEKNANVKLFNKIHYPLILNASSTFDSSVSKSYRLQGVVVHMG 621

Query: 973  NLIS-GHYTSLVNKDLKHEIRHGQQKWYYFDDEVVKQDNNHGDFDAGIASVSSSDVYVLF 1031
            N    GHY SL + +L          W  FDDE V+  +     D   +  S +  YVLF
Sbjct: 622  NGPHHGHYVSLCHTELF--------GWLLFDDETVESVDESYVLDFVGSHESPTTAYVLF 673

Query: 1032 YERI 1035
            Y  I
Sbjct: 674  YSEI 677

 Score = 37.4 bits (85), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 19/27 (70%)

Query: 612 ITGLRNLGSTCYINSMLQCLFATRKFR 638
           + G  N G+TCY NS+LQCL+   +FR
Sbjct: 160 VFGYENFGNTCYCNSVLQCLYHLPEFR 186

>Smik_10.37 Chr10 (61787..65530) [3744 bp, 1247 aa] {ON} YJL197W
           (REAL)
          Length = 1247

 Score = 58.2 bits (139), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 70/274 (25%), Positives = 106/274 (38%), Gaps = 25/274 (9%)

Query: 584 HQHYSPISHQYISVPTIEQSSNVYVSLSITGLRNLGSTCYINSMLQCLFATRKFRDIFLS 643
           H H++     Y +   +E +S        TGL NLG+TCY+NS LQCL    + RD FL 
Sbjct: 344 HHHWA---SNYFAYNKLEPASGT------TGLVNLGNTCYMNSALQCLVHIPQLRDYFLY 394

Query: 644 PKYHDYISK-------GYIHRA---QISRSFHMLFKKMYMNGGCSVVPSGFLKACNSMRP 693
             Y + I++       GY+ RA    I + F      M  NG  +  PS F         
Sbjct: 395 DGYENEINEENPLGYHGYVARAFSDLIQKIFQNRLSVMQRNG--AFPPSMFKSTVGHFNS 452

Query: 694 DFKIPNXXXXXXXXXXXXXXXXXXXXSDPEQVANDYPQLLLHDD-DNLQVDGKEYDKWFE 752
            F                           ++   + P L   DD D+  V  K  D  +E
Sbjct: 453 MFSGYMQQDSQEFLAFLLDSLHEDLNRIIKKEYIEKPSLSPGDDVDDWNVVKKLADDTWE 512

Query: 753 DSISKNGLSPIDSIFQGQMENCLQCQRCGHSSYNYSTFYVLSLAIPTPGTSTFGKTKKVL 812
             + +N  S I  +F G  ++ L C  C + S  +  +  ++L  P P  + + KT K+L
Sbjct: 513 MHLKRN-CSVITDLFVGMYKSTLYCPECKNVSITFDPYNDVTL--PLPVDTVWNKTVKIL 569

Query: 813 LEDCINLFTSDEVLSGENAWDCPRCGTSMSGSGP 846
             +   L    E+       D  +    +SG  P
Sbjct: 570 PMNSPPLLLDVELSKSSTFMDLKKYVGKISGLDP 603

 Score = 45.4 bits (106), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 44/130 (33%), Positives = 55/130 (42%), Gaps = 25/130 (19%)

Query: 914  KTFNFITMPPILVIHLSRFF--YDLTKKNSTVITYPLILNIVLKNNEVAK-------YRL 964
            K       P IL+IHL RF      + K    + +P I ++ L  N V K       Y L
Sbjct: 992  KQIQLWNTPDILLIHLKRFESQRSFSDKIDATVNFP-ITDLDLSKNVVYKDDPRGSIYDL 1050

Query: 965  YGIVNHFGNLISGHYTSLVNKDLKHEIRHGQQKWYYFDDEVVKQDNNHGDFDAGIASVSS 1024
            Y + NH+G L  GHYT+ V             KWYYFDD  V +        AG A    
Sbjct: 1051 YAVDNHYGGLGGGHYTAYVK-------NFANNKWYYFDDSRVTETVPENSI-AGSA---- 1098

Query: 1025 SDVYVLFYER 1034
               Y+LFY R
Sbjct: 1099 ---YLLFYIR 1105

 Score = 37.0 bits (84), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 20/32 (62%)

Query: 806 GKTKKVLLEDCINLFTSDEVLSGENAWDCPRC 837
            K + + L+DC+ LF+  E+L   ++W CP C
Sbjct: 953 AKERTITLDDCLQLFSKPEILGLSDSWYCPTC 984

>YJL197W Chr10 (63805..67569) [3765 bp, 1254 aa] {ON}
           UBP12Ubiquitin carboxyl-terminal hydrolase,
           ubiquitin-specific protease present in the nucleus and
           cytoplasm that cleaves ubiquitin from ubiquitinated
           proteins
          Length = 1254

 Score = 57.0 bits (136), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 64/245 (26%), Positives = 95/245 (38%), Gaps = 16/245 (6%)

Query: 613 TGLRNLGSTCYINSMLQCLFATRKFRDIFLSPKYHDYISK----GYIHRAQISRSFHMLF 668
           TGL NLG+TCY+NS LQCL    + RD FL   Y D I++    GY     ++R+F  L 
Sbjct: 364 TGLVNLGNTCYMNSALQCLVHIPQLRDYFLYDGYEDEINEENPLGY--HGYVARAFSDLV 421

Query: 669 KKMY------MNGGCSVVPSGFLKACNSMRPDFKIPNXXXXXXXXXXXXXXXXXXXXSDP 722
           +K++      M    +  PS F          F                           
Sbjct: 422 QKLFQNRMSIMQRNAAFPPSMFKSTIGHFNSMFSGYMQQDSQEFLAFLLDSLHEDLNRII 481

Query: 723 EQVANDYPQLLLHDDDN-LQVDGKEYDKWFEDSISKNGLSPIDSIFQGQMENCLQCQRCG 781
           ++   + P L   DD N   V  K  D  +E  + +N  S I  +F G  ++ L C  C 
Sbjct: 482 KKEYTEKPSLSPGDDVNDWNVVKKLADDTWEMHLKRN-CSVITDLFVGMYKSTLYCPECQ 540

Query: 782 HSSYNYSTFYVLSLAIPTPGTSTFGKTKKVLLEDCINLFTSDEVLSGENAWDCPRCGTSM 841
           + S  +  +  ++L  P P  + + KT K+   +   L    E+       D       M
Sbjct: 541 NVSITFDPYNDVTL--PLPVDTVWDKTIKIFPMNSPPLLLEVELSKSSTYMDLKNYVGKM 598

Query: 842 SGSGP 846
           SG  P
Sbjct: 599 SGLDP 603

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 43/130 (33%), Positives = 56/130 (43%), Gaps = 25/130 (19%)

Query: 914  KTFNFITMPPILVIHLSRFF--YDLTKKNSTVITYPLILNIVLKNNEVAK-------YRL 964
            K       P IL+IHL RF      + K    + +P I ++ L    V K       Y L
Sbjct: 996  KQIQLWNTPDILLIHLKRFESQRSFSDKIDATVNFP-ITDLDLSRYVVYKDDPRGLIYDL 1054

Query: 965  YGIVNHFGNLISGHYTSLVNKDLKHEIRHGQQKWYYFDDEVVKQDNNHGDFDAGIASVSS 1024
            Y + NH+G L  GHYT+ V             KWYYFDD  V +        A   S++ 
Sbjct: 1055 YAVDNHYGGLGGGHYTAYVK-------NFADNKWYYFDDSRVTE-------TAPENSIAG 1100

Query: 1025 SDVYVLFYER 1034
            S  Y+LFY R
Sbjct: 1101 S-AYLLFYIR 1109

 Score = 36.6 bits (83), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 20/32 (62%)

Query: 806 GKTKKVLLEDCINLFTSDEVLSGENAWDCPRC 837
            K + + L+DC+ LF+  E+L   ++W CP C
Sbjct: 957 AKERTITLDDCLQLFSKPEILGLTDSWYCPTC 988

>ZYRO0B03300g Chr2 (273903..276344) [2442 bp, 813 aa] {ON} similar to
            uniprot|P39967 Saccharomyces cerevisiae YER098W UBP9
            Ubiquitin-specific protease that cleaves
            ubiquitin-protein fusions
          Length = 813

 Score = 55.8 bits (133), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 43/123 (34%), Positives = 55/123 (44%), Gaps = 17/123 (13%)

Query: 921  MPPILVIHLSRFFYDLTKKNSTV-----ITYPLILNI--VLKNNEVAKYRLYGIVNHFGN 973
            +P  L +HL RF Y  TK NS +     + YPL L++     N+   KY L GIV H G 
Sbjct: 611  LPHTLALHLKRFKYSETK-NSNIKLFNKVHYPLTLDVCSTYSNSVCKKYELSGIVVHMGG 669

Query: 974  LIS-GHYTSLVNKDLKHEIRHGQQKWYYFDDEVVKQDNNHGDFDAGIASVSSSDVYVLFY 1032
                GHY SL   D           W  FDDE V+  +     D    S + +  YVLFY
Sbjct: 670  GPQHGHYVSLCKND--------NFGWLLFDDETVESVSEKTVLDFVGDSSTLTTAYVLFY 721

Query: 1033 ERI 1035
              +
Sbjct: 722  REL 724

 Score = 38.9 bits (89), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 19/27 (70%)

Query: 612 ITGLRNLGSTCYINSMLQCLFATRKFR 638
           + G  N G+TCY NS+LQCL+   +FR
Sbjct: 130 VFGFENFGNTCYCNSVLQCLYNMTEFR 156

>NCAS0D02390 Chr4 complement(451930..455565) [3636 bp, 1211 aa] {ON}
            Anc_5.18
          Length = 1211

 Score = 54.7 bits (130), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 33/101 (32%), Positives = 51/101 (50%), Gaps = 19/101 (18%)

Query: 918  FITMPPILVIHLSRFFYDLTKKNSTVIT----YPLILNI--------VLKNNEVAKYRLY 965
            F + PPIL + L RF YD        I     +P  +++        + +N E  KY L+
Sbjct: 388  FESFPPILHLQLKRFEYDFNYDQLIKINDRYEFPESIDVSPYMDKKALRENKESCKYTLH 447

Query: 966  GIVNHFGNLISGHYTSLVNKDLKHEIRHGQQKWYYFDDEVV 1006
            G++ H G++ +GHY +++  DL       Q +WY FDDE V
Sbjct: 448  GVLVHTGDISTGHYYAMIKPDL-------QDQWYRFDDEKV 481

 Score = 39.7 bits (91), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 20/28 (71%)

Query: 613 TGLRNLGSTCYINSMLQCLFATRKFRDI 640
            G RN G+TCY+NS+LQ  F T+ FR +
Sbjct: 207 VGFRNQGATCYLNSLLQSYFFTKYFRKL 234

>TDEL0C05640 Chr3 complement(1005536..1009072) [3537 bp, 1178 aa]
           {ON} Anc_1.137 YJL197W
          Length = 1178

 Score = 54.3 bits (129), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 33/95 (34%), Positives = 47/95 (49%), Gaps = 14/95 (14%)

Query: 609 SLSITGLRNLGSTCYINSMLQCLFATRKFRDIFLSPKYHDYISK----GYIHRAQISRSF 664
           S  ITGL NLG+TCY+NS LQCL    + RD FL   +   I+     GY  +  I+++F
Sbjct: 298 SQGITGLTNLGNTCYMNSALQCLVHIPELRDYFLYDGFTSEINSDNPLGY--QGNIAKAF 355

Query: 665 HMLFKKMYMNGGCSVVPSGF--------LKACNSM 691
            +L K ++     S     F        +  CN+M
Sbjct: 356 SLLVKSLFGASYGSASSQAFSPNNFKMIMGHCNTM 390

 Score = 49.3 bits (116), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 37/128 (28%), Positives = 58/128 (45%), Gaps = 24/128 (18%)

Query: 914  KTFNFITMPPILVIHLSRFF--YDLTKKNSTVITYP-----LILNIVLKNNEVAKYRLYG 966
            K     + P +L+IHL RF      + K    + +P     +  ++V ++   + Y L  
Sbjct: 904  KQIQLWSTPDVLLIHLKRFENQRSFSDKIDDTVHFPIKSLDMTEHLVHEDPRGSIYDLIA 963

Query: 967  IVNHFGNLISGHYTSLVNKDLKHEIRHGQQKWYYFDDEVVKQDNNHGDFDAGIASVSSSD 1026
            + NHFG L  GHYT+ V  +          KW+YFDD  V +           +S++ S 
Sbjct: 964  VDNHFGGLGGGHYTAYVKTN---------DKWFYFDDSRVTETKPE-------SSIAGS- 1006

Query: 1027 VYVLFYER 1034
             Y+LFY R
Sbjct: 1007 AYLLFYLR 1014

 Score = 37.7 bits (86), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 22/33 (66%), Gaps = 1/33 (3%)

Query: 806 GKTKKVL-LEDCINLFTSDEVLSGENAWDCPRC 837
           G+ K+ + L DC+ LF+  EVLS  ++W CP C
Sbjct: 864 GQEKRAISLHDCLKLFSKKEVLSMNDSWYCPTC 896

>Skud_10.22 Chr10 (38735..42502) [3768 bp, 1255 aa] {ON} YJL197W
           (REAL)
          Length = 1255

 Score = 54.3 bits (129), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 57/211 (27%), Positives = 83/211 (39%), Gaps = 16/211 (7%)

Query: 613 TGLRNLGSTCYINSMLQCLFATRKFRDIFLSPKYHDYISK-------GYIHRA---QISR 662
           TGL NLG+TCY+NS LQCL    + RD FL   Y   I++       GY+ RA    + +
Sbjct: 364 TGLVNLGNTCYMNSALQCLVHIPQLRDYFLYNGYESEINEENPLGYHGYVARAFSDLVQK 423

Query: 663 SFHMLFKKMYMNGGCSVVPSGFLKACNSMRPDFKIPNXXXXXXXXXXXXXXXXXXXXSDP 722
            FH     M  N   +  PS F          F                           
Sbjct: 424 LFHNKLSSMQRNA--AFPPSMFKSTVGHFNSMFSGYMQQDSQEFLAFLLDSLHEDLNRII 481

Query: 723 EQVANDYPQLLLHDDDN-LQVDGKEYDKWFEDSISKNGLSPIDSIFQGQMENCLQCQRCG 781
           ++   + P L   DD N   V  K  D  +E  + +N  S I  +F G  ++ L C  C 
Sbjct: 482 KKAYIEKPSLSPDDDVNDWNVVKKLADDTWEMHLKRN-CSVITDLFVGLYKSTLYCPECK 540

Query: 782 HSSYNYSTFYVLSLAIPTPGTSTFGKTKKVL 812
           + S  +  +  ++L  P P  + + KT K+ 
Sbjct: 541 NVSITFDPYNDVTL--PLPVDTVWSKTVKIF 569

 Score = 42.0 bits (97), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 40/129 (31%), Positives = 56/129 (43%), Gaps = 23/129 (17%)

Query: 914  KTFNFITMPPILVIHLSRFF--YDLTKKNSTVITYPLIL-----NIVLKNNEVAK-YRLY 965
            K       P IL++HL RF      + K    + +P+       ++V K++     Y LY
Sbjct: 998  KQIQLWNTPDILLVHLKRFESQRSFSDKIDATVNFPVTALDLSKHVVHKDDPRGSIYDLY 1057

Query: 966  GIVNHFGNLISGHYTSLVNKDLKHEIRHGQQKWYYFDDEVVKQDNNHGDFDAGIASVSSS 1025
             + NH+G L  GHYT+ V             KWYYFDD  V +            S+S S
Sbjct: 1058 AVDNHYGGLGGGHYTAYVKN-------FADSKWYYFDDSRVTETVPEN-------SISGS 1103

Query: 1026 DVYVLFYER 1034
              Y+LFY R
Sbjct: 1104 -AYLLFYIR 1111

 Score = 36.2 bits (82), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 20/32 (62%)

Query: 806 GKTKKVLLEDCINLFTSDEVLSGENAWDCPRC 837
            K + + L+DC+ LF+  E+L   ++W CP C
Sbjct: 959 AKERIITLDDCLQLFSKPEILGLNDSWYCPTC 990

>SAKL0C04246g Chr3 (412865..416758) [3894 bp, 1297 aa] {ON} similar to
            uniprot|P39538 Saccharomyces cerevisiae YJL197W UBP12
            Ubiquitin-specific protease present in the nucleus and
            cytoplasm that cleaves ubiquitin from ubiquitinated
            proteins
          Length = 1297

 Score = 54.3 bits (129), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 46/145 (31%), Positives = 60/145 (41%), Gaps = 33/145 (22%)

Query: 908  KKL-TTIKTFNFITMPPILVIHLSRF--FYDLTKKNSTVITYPLI--------------- 949
            KKL    +     + P IL++HL RF   Y  T K +  + +PL                
Sbjct: 960  KKLRQATRQIELWSTPEILLVHLKRFESHYSSTGKLNNTVHFPLTGLDMSPHLPCRDGDG 1019

Query: 950  LNIVLKNNEVAKYRLYGIVNHFGNLISGHYTSLVNKDLKHEIRHGQQKWYYFDDEVVKQD 1009
                        Y L  + NHFG L SGHYT+ V   +         KWY FDD  V++ 
Sbjct: 1020 DGDGDDGGRENVYDLIAVDNHFGGLGSGHYTAYVKNPV-------DDKWYLFDDSEVRE- 1071

Query: 1010 NNHGDFDAGIASVSSSDVYVLFYER 1034
                  DA   SV+SS  Y+LFY R
Sbjct: 1072 -----VDA--ESVASSFGYLLFYRR 1089

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/34 (58%), Positives = 23/34 (67%)

Query: 609 SLSITGLRNLGSTCYINSMLQCLFATRKFRDIFL 642
           S    GL NLGSTC+INS+LQCL    + RD FL
Sbjct: 347 SSGTMGLANLGSTCHINSVLQCLTHITELRDYFL 380

 Score = 40.0 bits (92), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 23/31 (74%)

Query: 807 KTKKVLLEDCINLFTSDEVLSGENAWDCPRC 837
           + ++  LEDC++LFT+ EVL+  ++W CP C
Sbjct: 929 QKQETTLEDCLDLFTAPEVLNTADSWYCPAC 959

>AFR627C Chr6 complement(1572814..1576677) [3864 bp, 1287 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL197W
           (UBP12)
          Length = 1287

 Score = 53.9 bits (128), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 59/224 (26%), Positives = 89/224 (39%), Gaps = 21/224 (9%)

Query: 604 SNVYV------SLSITGLRNLGSTCYINSMLQCLFATRKFRDIFLSPKYHDY--ISKGYI 655
           SN YV      S    GL NLG+TCY+NS LQCL    +F+D FL   Y     I     
Sbjct: 331 SNFYVYNQLLSSKGTIGLSNLGNTCYMNSALQCLLHIPEFKDYFLYNGYEKEVNIENPLG 390

Query: 656 HRAQISRSFHMLFKKMY---MNGGCSVVPSGFLKACNSMRPDFKIPNXXXXXXXXXXXXX 712
           H+  I+ +F  + + ++    +   S  P  F      +   F                 
Sbjct: 391 HKGHIAWAFASMVQALFGKRHSAATSYSPRNFKNTIGHLNSMFSGYQQQDSQEFLAFLLD 450

Query: 713 XXXXXXXSDPEQVANDYPQLLLHDDDNLQVDGKEYDKWFEDSISKNGL---SPIDSIFQG 769
                     E+   + P+L   DD     + K   K  +D+  K+ L   S I  +F G
Sbjct: 451 GLHEDLNRIIEKPYVEKPELTSTDD---TAEFKVIKKLADDTWGKHKLRNDSVITDLFVG 507

Query: 770 QMENCLQCQRCGHSSYNYSTFYVLSLAIPTPGTSTFGKTKKVLL 813
             ++ L C  C  +S  +  +  L+L  P P  ST+  + KVL+
Sbjct: 508 LYKSTLICPVCKKTSVTFDPYNDLTL--PLPVNSTW--SNKVLI 547

 Score = 40.8 bits (94), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 20/29 (68%)

Query: 809 KKVLLEDCINLFTSDEVLSGENAWDCPRC 837
           KK+ L DC+ LF++ EVL   ++W CP C
Sbjct: 960 KKITLHDCLTLFSTPEVLGATDSWFCPNC 988

 Score = 40.4 bits (93), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 42/129 (32%), Positives = 58/129 (44%), Gaps = 24/129 (18%)

Query: 914  KTFNFITMPPILVIHLSRFF--YDLTKKNSTVITYPLI-LN----IVLKNNEVAK-YRLY 965
            K       P IL+IHL RF      + K +  + +P+  L+    +V KN +    Y L 
Sbjct: 996  KQIELWNAPDILLIHLKRFENQRSFSDKIADTVHFPITDLDMTPYLVYKNEDKGDIYDLI 1055

Query: 966  GIVNHFGNLISGHYTSLVNKDLKHEIRHGQQKWYYFDDEVVKQDNNHGDFDAGIASVSSS 1025
             + NH+G L  GHYT+ V        ++   KWYYFDD  V +        AG A     
Sbjct: 1056 AVDNHYGGLGGGHYTAYV--------KNIDGKWYYFDDSRVSETLPERSI-AGSA----- 1101

Query: 1026 DVYVLFYER 1034
              Y+LFY R
Sbjct: 1102 --YLLFYRR 1108

>Kpol_2001.54 s2001 complement(144924..148595) [3672 bp, 1223 aa]
           {ON} complement(144924..148595) [3672 nt, 1224 aa]
          Length = 1223

 Score = 53.5 bits (127), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 53/196 (27%), Positives = 82/196 (41%), Gaps = 17/196 (8%)

Query: 614 GLRNLGSTCYINSMLQCLFATRKFRDIFLSPKYHDYIS----KGYIHRAQISRSFHMLFK 669
           GL NLG+TCY+NS LQCL    + RD FL   +   I+     GY  +  ++RSF +L +
Sbjct: 343 GLNNLGNTCYMNSALQCLVHIPQLRDYFLYKVFEKEINLDNPLGY--QGHVARSFAILIQ 400

Query: 670 KMYMNG---GCSVVPSGFLKAC---NSMRPDFKIPNXXXXXXXXXXXXXXXXXXXXSDPE 723
            ++ +      S  P+ F       NSM   +   +                    + P 
Sbjct: 401 NLFKDELLPSLSYSPTTFKSTVGHFNSMFSGYLQQDSQEFIAFLLDGLHEDLNRITNKP- 459

Query: 724 QVANDYPQLLLHDD-DNLQVDGKEYDKWFEDSISKNGLSPIDSIFQGQMENCLQCQRCGH 782
               + P L   DD  N +V  K  D  +   + +N  S I  IF G  ++ L C  C +
Sbjct: 460 --VVEKPSLKPEDDVSNQEVIKKLADDTWNSHLLRND-SIITDIFVGLYKSTLHCPECDN 516

Query: 783 SSYNYSTFYVLSLAIP 798
            S  +  +  L+L +P
Sbjct: 517 LSVTFDPYNDLTLPLP 532

 Score = 42.7 bits (99), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 42/132 (31%), Positives = 61/132 (46%), Gaps = 23/132 (17%)

Query: 914  KTFNFITMPPILVIHLSRFF--YDLTKKNSTVITYPLI---LNIVLKNNEVAKYRLYGIV 968
            K     + P IL+IHL RF      + K    + +P+    L+  + NN+ +K  +Y +V
Sbjct: 943  KQLQLWSTPDILLIHLKRFENQSSFSDKIDDTVYFPITDLDLSPYVVNNDESKSTIYDLV 1002

Query: 969  ---NHFGNLISGHYTSLVNKDLKHEIRHGQQKWYYFDDEVVKQDNNHGDFDAGIASVSSS 1025
               NH+G L  GHYT+ V            +KWYYFDD  V +            S++ S
Sbjct: 1003 SVDNHYGGLGGGHYTAYVK-------NFVDKKWYYFDDSRVTE-------TVPERSIAGS 1048

Query: 1026 DVYVLFYERIYD 1037
              Y+LFY R  D
Sbjct: 1049 -AYLLFYMRRSD 1059

 Score = 41.6 bits (96), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 15/29 (51%), Positives = 20/29 (68%)

Query: 809 KKVLLEDCINLFTSDEVLSGENAWDCPRC 837
           KK+ L+DC+NLF   EVL   ++W CP C
Sbjct: 907 KKITLDDCLNLFAKKEVLGMNDSWYCPTC 935

>Suva_6.276 Chr6 complement(481843..485613) [3771 bp, 1256 aa] {ON}
           YJL197W (REAL)
          Length = 1256

 Score = 53.1 bits (126), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 39/66 (59%), Gaps = 6/66 (9%)

Query: 613 TGLRNLGSTCYINSMLQCLFATRKFRDIFLSPKYHDYISK----GYIHRAQISRSFHMLF 668
           TGL NLG+TCY+NS LQCL    + RD FL   Y   I++    GY     ++R+F  L 
Sbjct: 361 TGLVNLGNTCYMNSALQCLVHLPQLRDYFLYNGYEKEINEENPLGY--HGYVARAFSDLI 418

Query: 669 KKMYMN 674
           +K++ N
Sbjct: 419 QKLFQN 424

 Score = 42.4 bits (98), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 43/130 (33%), Positives = 58/130 (44%), Gaps = 25/130 (19%)

Query: 914  KTFNFITMPPILVIHLSRFF--YDLTKKNSTVITYPLILNIVLKNNEVAK-------YRL 964
            K       P IL+IHL RF      + K    + +P I ++ L  + V K       Y L
Sbjct: 995  KQIQLWNTPDILLIHLKRFESQRSFSDKIDDTVNFP-ITDLDLSEHVVYKDDPRGSIYDL 1053

Query: 965  YGIVNHFGNLISGHYTSLVNKDLKHEIRHGQQKWYYFDDEVVKQDNNHGDFDAGIASVSS 1024
            Y + NH+G L  GHYT+ V   + +       KWYYFDD  V +            SV+ 
Sbjct: 1054 YAVDNHYGGLGGGHYTAYVKNFMDN-------KWYYFDDSRVTETVPEN-------SVAG 1099

Query: 1025 SDVYVLFYER 1034
            S  Y+LFY R
Sbjct: 1100 S-AYLLFYIR 1108

 Score = 36.6 bits (83), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 19/32 (59%)

Query: 806 GKTKKVLLEDCINLFTSDEVLSGENAWDCPRC 837
            K + + L DC+ LF+  E+L   ++W CP C
Sbjct: 956 AKERTITLNDCLQLFSKPEILGLNDSWYCPTC 987

>NDAI0E04180 Chr5 complement(941527..944010) [2484 bp, 827 aa] {ON}
            Anc_7.390 YBL067C
          Length = 827

 Score = 52.4 bits (124), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 42/131 (32%), Positives = 54/131 (41%), Gaps = 15/131 (11%)

Query: 914  KTFNFITMPPILVIHLSRFFYD----LTKKNSTVITYPLILNIVLKNNEV--AKYRLYGI 967
            +T     +P  L +HL RF Y        K    I YPL LN+          KY+L GI
Sbjct: 618  RTVGLKKLPNTLALHLKRFKYSEEHFTNIKLFNKIVYPLELNVSSSFTSSISKKYKLQGI 677

Query: 968  VNHFGNL-ISGHYTSLVNKDLKHEIRHGQQKWYYFDDEVVKQDNNHGDFDAGIASVSSSD 1026
            V H G+    GHY ++   D     ++G   W  FDDE     N            S + 
Sbjct: 678  VVHMGSSPQQGHYVAICKTD-----KYG---WLLFDDETASWINEEEVLSFIGDEKSQNT 729

Query: 1027 VYVLFYERIYD 1037
             YVLFYE + D
Sbjct: 730  AYVLFYEEVKD 740

 Score = 35.4 bits (80), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 18/27 (66%)

Query: 612 ITGLRNLGSTCYINSMLQCLFATRKFR 638
           I G  N G+TCY NS+LQCL+    F+
Sbjct: 154 IFGYENFGNTCYCNSVLQCLYHLDDFK 180

>NDAI0A01670 Chr1 complement(368070..370610) [2541 bp, 846 aa] {ON}
            Anc_7.390 YBL067C
          Length = 846

 Score = 51.6 bits (122), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 41/124 (33%), Positives = 58/124 (46%), Gaps = 15/124 (12%)

Query: 921  MPPILVIHLSRFFYDLTKKNS----TVITYPLILNIVLK-NNEVAK-YRLYGIVNHFGNL 974
            +P IL +HL RF Y   K  +      + YPL LN+    ++ + K Y L G+V H G+ 
Sbjct: 645  LPHILALHLKRFKYSEVKNTNIKLFNKVYYPLTLNVASTFDSSIEKAYELTGVVIHMGSS 704

Query: 975  IS-GHYTSLVNKDLKHEIRHGQQKWYYFDDEVVKQDNNHGDFDAGIASVSSSDVYVLFYE 1033
               GHY SL   D     + G   W  FDDE V+  +     +      + +  YVLFY+
Sbjct: 705  PQHGHYVSLCKND-----KFG---WLLFDDETVESVSESTVLEFTGDPNNQATAYVLFYK 756

Query: 1034 RIYD 1037
             I D
Sbjct: 757  EIKD 760

 Score = 38.5 bits (88), Expect = 0.098,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 26/43 (60%), Gaps = 2/43 (4%)

Query: 612 ITGLRNLGSTCYINSMLQCLFATRKFRDIFLSPKYHDYISKGY 654
           + G  N G+TCY NS+LQCL+   +FR   L  +Y D++   Y
Sbjct: 171 VFGYENFGNTCYCNSVLQCLYNLYEFRLNML--EYSDHLPHNY 211

>KNAG0C02180 Chr3 (429789..433484) [3696 bp, 1231 aa] {ON} Anc_1.137
           YJL197W
          Length = 1231

 Score = 51.6 bits (122), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 53/202 (26%), Positives = 85/202 (42%), Gaps = 18/202 (8%)

Query: 609 SLSITGLRNLGSTCYINSMLQCLFATRKFRDIFLSPKYHDYISK----GYIHRAQISRSF 664
           S    GL NLG+TCY+NS LQCL    + RD F+   +   I+     G+  +  ++RSF
Sbjct: 317 STGTIGLSNLGNTCYMNSGLQCLVHIPQIRDYFVYNGFEKEINVNNPLGF--QGHMARSF 374

Query: 665 HMLFKKMYMNGGCS----VVPSGF---LKACNSMRPDFKIPNXXXXXXXXXXXXXXXXXX 717
           H L + ++ +        V P+ F   L   NSM   F+  +                  
Sbjct: 375 HGLIQSLFGDSIAPFPSYVSPTHFKSTLVHFNSMFSGFQQQDSQEFLAFLLDSLHEDLNR 434

Query: 718 XXSDPEQVANDYPQLLLHDDDN-LQVDGKEYDKWFEDSISKNGLSPIDSIFQGQMENCLQ 776
               P     + P L   DD N      K  ++ ++  + +N  S I  IF G  ++ L+
Sbjct: 435 IVEKPYV---EKPSLKPGDDINDFDTIKKLANETWKSHLMRND-SIITDIFVGMYKSTLE 490

Query: 777 CQRCGHSSYNYSTFYVLSLAIP 798
           C  C + S  +  +  L+L +P
Sbjct: 491 CPECSNVSITFDPYNDLTLPLP 512

 Score = 38.1 bits (87), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 20/29 (68%)

Query: 809 KKVLLEDCINLFTSDEVLSGENAWDCPRC 837
           ++  L+DC+NLF+  EVL   ++W CP C
Sbjct: 891 QETTLKDCLNLFSKKEVLGMSDSWYCPNC 919

 Score = 37.0 bits (84), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 40/129 (31%), Positives = 56/129 (43%), Gaps = 23/129 (17%)

Query: 914  KTFNFITMPPILVIHLSRF--FYDLTKKNSTVITYP-----LILNIVLKNNEVAK-YRLY 965
            K       P + +IHL RF      + K    I +P     +   +V K++     Y L 
Sbjct: 927  KKIELWNTPDVFLIHLKRFENTRSFSDKIDATILFPIEDLDMSEYLVYKDDPRGSVYDLI 986

Query: 966  GIVNHFGNLISGHYTSLVNKDLKHEIRHGQQKWYYFDDEVVKQDNNHGDFDAGIASVSSS 1025
             + NH+G +  GHYT+ V K+L        Q WYYFDD  V + +      AG A     
Sbjct: 987  AVDNHYGGMGGGHYTAYV-KNLT------DQNWYYFDDSRVSKTSPEKSI-AGSA----- 1033

Query: 1026 DVYVLFYER 1034
              Y+LFY R
Sbjct: 1034 --YLLFYLR 1040

>NCAS0E02610 Chr5 complement(520877..523030) [2154 bp, 717 aa] {ON}
            Anc_7.390
          Length = 717

 Score = 51.2 bits (121), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 40/124 (32%), Positives = 60/124 (48%), Gaps = 15/124 (12%)

Query: 921  MPPILVIHLSRFFYDLTK----KNSTVITYPLIL--NIVLKNNEVAKYRLYGIVNHFGNL 974
            +P  L++HL RF Y   +    K  + + YPLIL  N   K  +  KY L GIV H G+ 
Sbjct: 518  LPDTLILHLKRFKYSEQQLSNIKLFSKVYYPLILEVNSNYKCTDTIKYELSGIVIHVGDG 577

Query: 975  IS-GHYTSLVNKDLKHEIRHGQQKWYYFDDEVVKQDNNHGDFDAGIASVSSSDVYVLFYE 1033
               GHY +L   +     ++G   W ++DDE V+  +            + S  YVLFY+
Sbjct: 578  PQMGHYVALCKTE-----KYG---WLFYDDETVESVSEETVLKFIGDEKTQSTAYVLFYK 629

Query: 1034 RIYD 1037
            ++ D
Sbjct: 630  KLGD 633

 Score = 37.4 bits (85), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 19/27 (70%)

Query: 612 ITGLRNLGSTCYINSMLQCLFATRKFR 638
           + G  N G+TCY NS+LQCL+   +FR
Sbjct: 125 VFGYENFGNTCYCNSVLQCLYNLPEFR 151

>KNAG0B02370 Chr2 complement(463599..465860) [2262 bp, 753 aa] {ON}
            Anc_7.390 YBL067C
          Length = 753

 Score = 51.2 bits (121), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 57/121 (47%), Gaps = 17/121 (14%)

Query: 921  MPPILVIHLSRFFYDLTKKNSTV-----ITYPLILNIVLKNNEVA--KYRLYGIVNHFGN 973
            +P IL +HL RF Y    +N+ +     ITYPL L +  K +     KY L G+V H G 
Sbjct: 548  LPRILALHLKRFKYS-EAQNTNIKLFNKITYPLFLEVASKFDPSVSKKYELTGVVLHMGG 606

Query: 974  LIS-GHYTSLVNKDLKHEIRHGQQKWYYFDDEVVKQDNNHGDFDAGIASVSSSDVYVLFY 1032
                GHY S+   D           W +FDDE V+  +     +    + +S+  YVLFY
Sbjct: 607  GPQHGHYVSVCKTD--------NFGWLFFDDETVETLDEPQVLNFTGDTTTSTTAYVLFY 658

Query: 1033 E 1033
            +
Sbjct: 659  K 659

 Score = 40.8 bits (94), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 17/31 (54%), Positives = 21/31 (67%)

Query: 612 ITGLRNLGSTCYINSMLQCLFATRKFRDIFL 642
           I G  N G+TCY NS+LQCLF   +FR+  L
Sbjct: 113 IFGYENFGNTCYCNSILQCLFNLTEFRNSIL 143

>Kwal_33.13628 s33 (324581..328063) [3483 bp, 1160 aa] {ON} YJL197W
           (UBP12) - ubiquitin carboxyl-terminal hydrolase [contig
           114] FULL
          Length = 1160

 Score = 50.4 bits (119), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/63 (39%), Positives = 37/63 (58%), Gaps = 2/63 (3%)

Query: 612 ITGLRNLGSTCYINSMLQCLFATRKFRDIFLSPKYHDYI--SKGYIHRAQISRSFHMLFK 669
           I GL NLG++CY+NS LQCL    + RD FL   +   I  S    ++ QI+++F  L K
Sbjct: 297 IVGLSNLGNSCYMNSALQCLVHIPELRDYFLYGGFEQDINTSNPLGYQGQIAQAFAALVK 356

Query: 670 KMY 672
            ++
Sbjct: 357 SLF 359

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 40/129 (31%), Positives = 56/129 (43%), Gaps = 23/129 (17%)

Query: 914  KTFNFITMPPILVIHLSRF--FYDLTKKNSTVITYPLI-----LNIVLKN-NEVAKYRLY 965
            K       P IL IHL RF   +  + K S V+ +P+       ++V  + N+ + Y L 
Sbjct: 906  KQIQLWNTPDILTIHLKRFENRHSFSDKISDVVDFPITGLDMSEHLVCHDPNQNSMYDLI 965

Query: 966  GIVNHFGNLISGHYTSLVNKDLKHEIRHGQQKWYYFDDEVVKQDNNHGDFDAGIASVSSS 1025
             + NH+G L  GHYT+ V   +         KWYYFDD  V +               S 
Sbjct: 966  AVDNHYGGLGGGHYTAYVKNFM-------DGKWYYFDDSRVSE--------TEAERAISG 1010

Query: 1026 DVYVLFYER 1034
              Y+LFY R
Sbjct: 1011 AAYLLFYRR 1019

 Score = 35.8 bits (81), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 17/27 (62%)

Query: 811 VLLEDCINLFTSDEVLSGENAWDCPRC 837
           + L DC+ LF+  EVL   ++W CP C
Sbjct: 872 ISLTDCLELFSKSEVLGAADSWYCPNC 898

>CAGL0M11198g Chr13 (1102767..1104152) [1386 bp, 461 aa] {ON} similar
            to uniprot|P50102 Saccharomyces cerevisiae YMR223w UBP8
          Length = 461

 Score = 49.7 bits (117), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 33/107 (30%), Positives = 57/107 (53%), Gaps = 19/107 (17%)

Query: 913  IKTFNFITMPPILVIHLSRFFYDLTKKNSTV---ITYPLILNI--VLKNNE------VAK 961
            IK F    +PP+LV+ L RF + ++  N  +   I +P IL++   LK+N+         
Sbjct: 341  IKQFTINKLPPVLVLQLKRFEHLMSGVNQKLNDYIEFPKILDMKPYLKDNQNPDEDPSIL 400

Query: 962  YRLYGIVNHFGNLISGHYTSLVNKDLKHEIRHGQQKWYYFDDEVVKQ 1008
            Y L GI++H G++  GHY +        +I +G+  W+ F+D +V +
Sbjct: 401  YELIGIISHTGSVNEGHYVAFC------KIENGE--WFKFNDSMVTK 439

 Score = 38.5 bits (88), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 27/39 (69%), Gaps = 6/39 (15%)

Query: 593 QYISVPTIEQSSNVYVSLSITGLRNLGSTCYINSMLQCL 631
           +Y +VPT++Q         + GL N+GSTCY++S++QC+
Sbjct: 123 EYTNVPTVDQID------GMAGLVNMGSTCYMSSIMQCI 155

>Ecym_8140 Chr8 complement(295730..299524) [3795 bp, 1264 aa] {ON}
           similar to Ashbya gossypii AFR627C
          Length = 1264

 Score = 50.1 bits (118), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 28/78 (35%), Positives = 41/78 (52%), Gaps = 8/78 (10%)

Query: 603 SSNVYV------SLSITGLRNLGSTCYINSMLQCLFATRKFRDIFLSPKYHDYIS--KGY 654
           +SN Y+      S    GL NLG+TCY+NS LQCL    +F+D FL   Y   I+     
Sbjct: 333 ASNYYIYNQMTPSNGTVGLGNLGNTCYMNSALQCLVHIPEFKDYFLYNAYEKEINVDNPL 392

Query: 655 IHRAQISRSFHMLFKKMY 672
            H+  I+ +F  L + ++
Sbjct: 393 GHKGHIAWAFGTLIQSLF 410

 Score = 40.8 bits (94), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 41/129 (31%), Positives = 60/129 (46%), Gaps = 23/129 (17%)

Query: 914  KTFNFITMPPILVIHLSRFF--YDLTKKNSTVITYPLI-LN----IVLKNNEVAK-YRLY 965
            K       P IL+IHL RF      + K   ++ +P+  L+    +V K+++    Y L 
Sbjct: 971  KQIELWNTPDILLIHLKRFENQRSFSDKIGDIVHFPITDLDMSPYLVYKDDKKGTIYDLI 1030

Query: 966  GIVNHFGNLISGHYTSLVNKDLKHEIRHGQQKWYYFDDEVVKQDNNHGDFDAGIASVSSS 1025
             + NH+G L  GHYT+ V   L +       KWYYFDD  V +            S++ S
Sbjct: 1031 AVDNHYGGLGGGHYTAYVKNFLDN-------KWYYFDDSRVNE-------TVPERSIAGS 1076

Query: 1026 DVYVLFYER 1034
              Y+LFY R
Sbjct: 1077 -AYLLFYRR 1084

 Score = 40.4 bits (93), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 20/29 (68%)

Query: 809 KKVLLEDCINLFTSDEVLSGENAWDCPRC 837
           KK+ L DC+ LF++ EVL   ++W CP C
Sbjct: 935 KKITLHDCLTLFSTPEVLGATDSWYCPSC 963

>KAFR0F01560 Chr6 (310936..314451) [3516 bp, 1171 aa] {ON} Anc_1.137
           YJL197W
          Length = 1171

 Score = 50.1 bits (118), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 53/202 (26%), Positives = 82/202 (40%), Gaps = 18/202 (8%)

Query: 614 GLRNLGSTCYINSMLQCLFATRKFRDIFLSPKYHDYIS-------KGYIHRAQISRSFHM 666
           GL NLG+TCY+NS LQCL    + RD FL   Y   ++       KGY+ +A  S     
Sbjct: 324 GLSNLGNTCYMNSALQCLVHIPQLRDYFLYSAYEAELNTDNLIGYKGYVAKA-FSSLVQN 382

Query: 667 LFKKMYMNGGC--SVVPSGFLKAC---NSMRPDFKIPNXXXXXXXXXXXXXXXXXXXXSD 721
           LF       G   S  P+ F       NSM   +   +                    + 
Sbjct: 383 LFGDTITKQGTNSSFGPNHFKSTVGHFNSMFSGYLQQDSQEFLAFLLDSLHEDLNRIINK 442

Query: 722 PEQVANDYPQLLLHDD-DNLQVDGKEYDKWFEDSISKNGLSPIDSIFQGQMENCLQCQRC 780
           P   + + P L   DD ++  V     D+ ++  + +N  S I  +F G  ++ L+C  C
Sbjct: 443 P---STEKPSLKEGDDYNDPAVIKSLADETWKMHLLRND-SVITDLFVGMYKSTLECPEC 498

Query: 781 GHSSYNYSTFYVLSLAIPTPGT 802
            + S  +  +  L+L +P   T
Sbjct: 499 TNVSITFDPYSDLTLPLPVDST 520

 Score = 42.0 bits (97), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 43/130 (33%), Positives = 58/130 (44%), Gaps = 25/130 (19%)

Query: 914  KTFNFITMPPILVIHLSRFF--YDLTKKNSTVITYPLILNIVLKNNEVAK-------YRL 964
            K       P +L+IHL RF      + K    + +P I N+ +    V K       Y L
Sbjct: 906  KRIQLWNTPDVLLIHLKRFENQRSFSDKIDATVNFP-IENLDMSPYLVHKDDPRGTVYDL 964

Query: 965  YGIVNHFGNLISGHYTSLVNKDLKHEIRHGQQKWYYFDDEVVKQDNNHGDFDAGIASVSS 1024
            Y + NH+G L  GHYT+ V   + +       KWYYFDD  V + +          SVS 
Sbjct: 965  YAVDNHYGGLGGGHYTAYVKNFIDN-------KWYYFDDSRVYETDPE-------KSVSG 1010

Query: 1025 SDVYVLFYER 1034
            S  Y+LFY R
Sbjct: 1011 S-AYLLFYLR 1019

 Score = 41.6 bits (96), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 21/32 (65%)

Query: 806 GKTKKVLLEDCINLFTSDEVLSGENAWDCPRC 837
           G  K++ L DC+NLF+  EVL   ++W CP C
Sbjct: 867 GSDKEITLNDCLNLFSKREVLGLNDSWYCPHC 898

>Ecym_4685 Chr4 complement(1332993..1335329) [2337 bp, 778 aa] {ON}
            similar to Ashbya gossypii AGR370W
          Length = 778

 Score = 49.7 bits (117), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 38/130 (29%), Positives = 56/130 (43%), Gaps = 17/130 (13%)

Query: 914  KTFNFITMPPILVIHLSRFFYDLTKKNSTV-----ITYPLILNIVLKNNEVA--KYRLYG 966
            +T     +P IL +HL RF Y   K  S +     I YPL L +  K++ +    Y L G
Sbjct: 583  RTVGLKQLPKILSLHLKRFKYS-EKHQSNIKLFNKIYYPLKLKVCTKSDTIVCKNYELNG 641

Query: 967  IVNHFGNLIS-GHYTSLVNKDLKHEIRHGQQKWYYFDDEVVKQDNNHGDFDAGIASVSSS 1025
            IV H G     GHY ++         +H    W  +DDE V+  +    F         +
Sbjct: 642  IVIHMGGGPQHGHYVAIC--------KHDMFGWLLYDDETVESIDEETVFKFVGDEKDMT 693

Query: 1026 DVYVLFYERI 1035
              YVLF++ +
Sbjct: 694  TAYVLFFKEV 703

 Score = 45.4 bits (106), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 45/83 (54%), Gaps = 9/83 (10%)

Query: 573 HRYLSHSKRSQHQHYSP--ISHQYISVPTIEQSSNVYVSLSITGLRNLGSTCYINSMLQC 630
            ++L  +K + H+ + P  ++ +   +P  + S+ V+      GL N G+TCY NS+LQC
Sbjct: 97  QQFLGDAKDTLHELFFPGLVTRESEHLPCGDGSTKVF------GLENFGNTCYCNSVLQC 150

Query: 631 LFATRKFR-DIFLSPKYHDYISK 652
           LF   + R +I + P   D  S+
Sbjct: 151 LFNLSELRTNILMYPIRKDPASR 173

 Score = 37.7 bits (86), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 39/75 (52%), Gaps = 8/75 (10%)

Query: 763 IDSIFQGQMENCLQCQRCGHSSYNYSTFYVLSLAIPTPGTSTFGKTKKVLLEDCINLFTS 822
           + S+FQG M N ++C  C + + +   F  L  AIP        + ++V ++D ++ F  
Sbjct: 509 VQSLFQGTMINSIKCLTCDNVTSSDELF--LDFAIPV------NEDEEVNIQDMLSNFNQ 560

Query: 823 DEVLSGENAWDCPRC 837
            E+L+G N + C  C
Sbjct: 561 REMLNGANKFYCDSC 575

>TPHA0P00680 Chr16 (139640..141823) [2184 bp, 727 aa] {ON} Anc_7.390
            YBL067C
          Length = 727

 Score = 49.7 bits (117), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 43/142 (30%), Positives = 64/142 (45%), Gaps = 22/142 (15%)

Query: 902  SEKWKSKKLTTIKTFNFITMPPILVIHLSRFFYDLTKKNSTV-----ITYPLILNI--VL 954
            +E  ++++L  IK      +P  LV+HL RF Y   +KN  +     + YP  LNI  V 
Sbjct: 526  NEYQEAERLIGIKE-----LPKHLVVHLKRFKY-CEEKNCNIKLFNKVNYPFTLNISSVF 579

Query: 955  KNNEVAKYRLYGIVNHFGNLIS-GHYTSLVNKDLKHEIRHGQQKWYYFDDEVVKQDNNHG 1013
             ++   KY L  IV H G     GHY +L         +H    W  +DDE V+  ++  
Sbjct: 580  DDSISKKYELNSIVVHIGESPQLGHYVTLC--------KHKSYGWLIYDDETVQAVSDEL 631

Query: 1014 DFDAGIASVSSSDVYVLFYERI 1035
                      S+  Y+LFYE +
Sbjct: 632  VSRILNNEQRSATAYLLFYEEV 653

 Score = 41.2 bits (95), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 23/41 (56%)

Query: 604 SNVYVSLSITGLRNLGSTCYINSMLQCLFATRKFRDIFLSP 644
           SN  V   + G +N G TCY NS+LQ LF    FRD  + P
Sbjct: 97  SNYDVGERVFGFQNFGYTCYCNSILQALFNIGSFRDGIIGP 137

>NCAS0I03140 Chr9 complement(576993..580598) [3606 bp, 1201 aa] {ON}
           Anc_1.137 YJL197W
          Length = 1201

 Score = 49.7 bits (117), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 39/68 (57%), Gaps = 6/68 (8%)

Query: 609 SLSITGLRNLGSTCYINSMLQCLFATRKFRDIFLSPKYHDYISK----GYIHRAQISRSF 664
           SL ITGL NLG+TCY+NS LQC+     FR+ FL   Y   ++     GY  +  ++ +F
Sbjct: 317 SLEITGLVNLGNTCYMNSALQCITHIPVFREYFLYSGYEKELNTDNPLGY--QGHVAEAF 374

Query: 665 HMLFKKMY 672
             L + ++
Sbjct: 375 SELIRCLF 382

 Score = 41.6 bits (96), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 22/31 (70%)

Query: 807 KTKKVLLEDCINLFTSDEVLSGENAWDCPRC 837
           K K++ L DC+NLF+  E+LS  ++W CP C
Sbjct: 892 KNKEITLNDCLNLFSKPEILSLNDSWYCPTC 922

 Score = 36.6 bits (83), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 37/129 (28%), Positives = 55/129 (42%), Gaps = 23/129 (17%)

Query: 914  KTFNFITMPPILVIHLSRFF--YDLTKKNSTVITYPLI-----LNIVLKNNEVAK-YRLY 965
            K       P +L+IHL RF      + K   V+ +P+       ++V K++     Y L 
Sbjct: 930  KQIQLWNAPDVLLIHLKRFENQQSFSDKIDDVVQFPITDFDISEHLVYKDDPRGNVYDLI 989

Query: 966  GIVNHFGNLISGHYTSLVNKDLKHEIRHGQQKWYYFDDEVVKQDNNHGDFDAGIASVSSS 1025
             + NH+G L  GHYT+               KWYYFDD  V +            S++ +
Sbjct: 990  AVDNHYGGLGGGHYTAYAK-------NSTDGKWYYFDDSRVTE-------TVAENSITGA 1035

Query: 1026 DVYVLFYER 1034
              Y+LFY R
Sbjct: 1036 -AYLLFYLR 1043

>NDAI0B00480 Chr2 complement(89965..93726) [3762 bp, 1253 aa] {ON}
           Anc_1.137 YJL197W
          Length = 1253

 Score = 49.7 bits (117), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 37/128 (28%), Positives = 60/128 (46%), Gaps = 19/128 (14%)

Query: 583 QHQHYSPISHQYISVPTIEQSS-----------NVYVSLSITGLRNLGSTCYINSMLQCL 631
           Q + ++P S  ++     +Q S           N+  S    GL NLG+TCY+NS LQC+
Sbjct: 289 QMKEFTPTSFDFVIETKPKQKSSHWPSNFLIYNNLQSSPGTIGLTNLGNTCYMNSALQCI 348

Query: 632 FATRKFRDIFLSPKYHDYISKG--YIHRAQISRSFHMLFKKMYMNGGCSVV---PSGF-- 684
                FRD FL   +   +++G    ++  ++R+F  L + ++ +   S     PS F  
Sbjct: 349 THIPIFRDYFLYGTFQKEVNEGNPLGYQGYMARAFSDLIQSLFGDNITSTTAYSPSYFKS 408

Query: 685 -LKACNSM 691
            L   NSM
Sbjct: 409 TLGHFNSM 416

 Score = 37.7 bits (86), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 20/29 (68%)

Query: 809 KKVLLEDCINLFTSDEVLSGENAWDCPRC 837
           + + L+DC+ LF+  E+LS  ++W CP C
Sbjct: 937 RHITLDDCLKLFSKPEILSSNDSWYCPHC 965

 Score = 37.4 bits (85), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 40/129 (31%), Positives = 54/129 (41%), Gaps = 23/129 (17%)

Query: 914  KTFNFITMPPILVIHLSRFFYDLTKKNSTVIT--YPLI-----LNIVLKNNEVAK-YRLY 965
            K       P IL+IHL RF    +  +  V T  +P+       ++V K +     Y L 
Sbjct: 973  KQIELWNTPDILLIHLKRFENQRSFSDKIVDTVFFPITDFDISEHLVYKEDPRGNVYDLI 1032

Query: 966  GIVNHFGNLISGHYTSLVNKDLKHEIRHGQQKWYYFDDEVVKQDNNHGDFDAGIASVSSS 1025
             + NH+G L  GHYT+               KWYYFDD  V          A   S++ S
Sbjct: 1033 AVDNHYGGLGGGHYTAYAK-------NANDNKWYYFDDSRVS-------VTAPEKSIAGS 1078

Query: 1026 DVYVLFYER 1034
              Y+LFY R
Sbjct: 1079 -AYLLFYVR 1086

>TPHA0E00870 Chr5 complement(174245..176392) [2148 bp, 715 aa] {ON}
            Anc_7.390 YBL067C
          Length = 715

 Score = 49.3 bits (116), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 51/94 (54%), Gaps = 17/94 (18%)

Query: 921  MPPILVIHLSRFFYDLTKKNSTV-----ITYPLILNI-VLKNNEVAK-YRLYGIVNHFGN 973
            +P  L++HL RF Y   ++NS +     I YPL+L +    N++++K Y L GIV H G 
Sbjct: 520  LPETLILHLKRFKYS-EEQNSNIKLFNKINYPLVLQVSSTSNSDISKSYDLTGIVLHLGG 578

Query: 974  LIS-GHYTSLVNKDLKHEIRHGQQKWYYFDDEVV 1006
                GHY S+   +     ++G   W  FDDEVV
Sbjct: 579  GPQHGHYVSICKNE-----KYG---WLLFDDEVV 604

 Score = 37.7 bits (86), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 26/48 (54%), Gaps = 5/48 (10%)

Query: 592 HQYISVPTIEQSSNVYVSLSITGLRNLGSTCYINSMLQCLFATRKFRD 639
            + + +  +  SSN      + G  N G+TCY NS+LQCL+   + RD
Sbjct: 96  QKLLEITKLSDSSN-----KVFGYENFGNTCYCNSVLQCLYNIPELRD 138

>KLLA0C03476g Chr3 (314815..318573) [3759 bp, 1252 aa] {ON} similar
           to uniprot|P39538 Saccharomyces cerevisiae YJL197W UBP12
           Ubiquitin-specific protease present in the nucleus and
           cytoplasm that cleaves ubiquitin from ubiquitinated
           proteins
          Length = 1252

 Score = 49.7 bits (117), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 50/195 (25%), Positives = 77/195 (39%), Gaps = 11/195 (5%)

Query: 612 ITGLRNLGSTCYINSMLQCLFATRKFRDIFLSPKYHDY--ISKGYIHRAQISRSF-HMLF 668
           I GL NLG+TCY+NS LQCL    +  + FL   Y     I+    H+  ++ +F H+L+
Sbjct: 338 IMGLSNLGNTCYMNSALQCLLHIPELNEYFLYKGYEREININNPLGHKGDVAHAFGHLLY 397

Query: 669 KKMYMNGGCSV--VPSGFLKAC---NSMRPDFKIPNXXXXXXXXXXXXXXXXXXXXSDPE 723
                + G S    P  F       NS+   +   +                      P 
Sbjct: 398 SLFAPSYGQSTFYAPRNFKNTIGHYNSLFAGYGQQDSQEFLAFLLDGLHEDLNRVIEKPY 457

Query: 724 QVANDYPQLLLHDDDNLQVDGKEYDKWFEDSISKNGLSPIDSIFQGQMENCLQCQRCGHS 783
               ++P     DD + Q+     + W  D I K   S I  +F G  ++ L C  C H 
Sbjct: 458 VNKPEFPNDGQIDDTD-QIVLLAANMW--DYIKKRNDSVIMDLFVGLYKSTLVCPNCNHV 514

Query: 784 SYNYSTFYVLSLAIP 798
           S  +  +  L+L +P
Sbjct: 515 SITFDPYNDLTLPLP 529

 Score = 38.5 bits (88), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 41/129 (31%), Positives = 54/129 (41%), Gaps = 23/129 (17%)

Query: 914  KTFNFITMPPILVIHLSRFF--YDLTKKNSTVITYP---LILNIVL---KNNEVAKYRLY 965
            K       P IL+IHL RF      + K    + +P   L ++  L   K  E   Y L 
Sbjct: 936  KQIELWNTPDILLIHLKRFENQRSFSDKIDATVKFPIEGLDMSPYLSYKKEGENDVYDLI 995

Query: 966  GIVNHFGNLISGHYTSLVNKDLKHEIRHGQQKWYYFDDEVVKQDNNHGDFDAGIASVSSS 1025
             + NH+G L  GHYT+     +         KWYYFDD  V + +      AG A     
Sbjct: 996  AVDNHYGGLGGGHYTAYCRNFI-------DGKWYYFDDSRVNEVSPENSI-AGSA----- 1042

Query: 1026 DVYVLFYER 1034
              Y+LFY R
Sbjct: 1043 --YLLFYRR 1049

 Score = 34.7 bits (78), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 13/36 (36%), Positives = 22/36 (61%), Gaps = 2/36 (5%)

Query: 804 TFGKTKK--VLLEDCINLFTSDEVLSGENAWDCPRC 837
           T  +T+K  + L+ C+ LF+  E+L   ++W CP C
Sbjct: 893 TRAQTEKSSITLDSCLRLFSQPEILGSADSWYCPNC 928

>Kpol_534.23 s534 (53632..53653,53786..55254) [1491 bp, 496 aa] {ON}
           (53632..53653,53786..55254) [1491 nt, 497 aa]
          Length = 496

 Score = 48.9 bits (115), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 41/86 (47%), Gaps = 8/86 (9%)

Query: 614 GLRNLGSTCYINSMLQCLFATRKFRDIFLSPKYHDYISKG----YIHRAQISRSFHMLFK 669
           GL N+G+TCY+NS LQ L+     RD+ L  K    +  G    Y   +++ R F  L K
Sbjct: 110 GLLNMGNTCYMNSTLQALYRVDGLRDMVLKYKEQANVQPGDELHYKLISELKRCFENLQK 169

Query: 670 KMYMNGGCSVVPSGFLKACNSMRPDF 695
           K Y     SV+P  FL       P F
Sbjct: 170 KSYE----SVMPVVFLNLLRKCYPQF 191

>TBLA0J00600 Chr10 (129182..133570) [4389 bp, 1462 aa] {ON}
           Anc_1.137 YJL197W
          Length = 1462

 Score = 48.9 bits (115), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 55/222 (24%), Positives = 87/222 (39%), Gaps = 24/222 (10%)

Query: 609 SLSITGLRNLGSTCYINSMLQCLFATRKFRDIFLSPKYHDYIS-------KGYIHRAQIS 661
           S    GL NLG+TCY+NS LQCL    KF + FL   Y   I+       +G +  A   
Sbjct: 410 STGTLGLVNLGNTCYMNSALQCLIHLPKFNEYFLLNGYQKEINLDNPIGYQGNVANA-FG 468

Query: 662 RSFHMLFKKMYMNGGC--------SVVPSGF---LKACNSMRPDFKIPNXXXXXXXXXXX 710
           +  H LF++  ++           S  P+ F   +  CNSM   +   +           
Sbjct: 469 KLIHKLFEERIIDNESEKSSFSINSFSPTNFKSTVGYCNSMFSGYLQQDSQEFLAFILDG 528

Query: 711 XXXXXXXXXSDPEQVANDYPQLLLHDDDNLQVDGKEYDKWFEDSISKNGLSPIDSIFQGQ 770
                      P       P+   + D   +V  K  D  +E  + +N  S +  +F G 
Sbjct: 529 LHEDLNRILKKPFVEKPSLPENSNYKD--YKVIKKLADDTWEAHLKRND-SIVTDLFVGM 585

Query: 771 MENCLQCQRCGHSSYNYSTFYVLSLAIPTPGTSTFGKTKKVL 812
            ++ LQC  C + S  +  +  L+L  P P  + + K  K+ 
Sbjct: 586 YKSTLQCPDCHNVSVTFDPYNDLTL--PLPVETIWNKVIKIF 625

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 55/129 (42%), Gaps = 23/129 (17%)

Query: 914  KTFNFITMPPILVIHLSRFF--YDLTKKNSTVITYP-----LILNIVLKNNEVAK-YRLY 965
            K       P IL+IHL RF      + K   V+ +P     L  +IV  + E +  Y L 
Sbjct: 1104 KQIELWNTPDILLIHLKRFENQRSFSDKIDAVVNFPITDLDLTPHIVCTDQEKSNIYDLI 1163

Query: 966  GIVNHFGNLISGHYTSLVNKDLKHEIRHGQQKWYYFDDEVVKQDNNHGDFDAGIASVSSS 1025
             + NH+G L  GHYT+ V   +        QKWYYFDD  V          A      S 
Sbjct: 1164 AVDNHYGGLGGGHYTAYVKNFV-------DQKWYYFDDSRVSL--------ADPQRSISG 1208

Query: 1026 DVYVLFYER 1034
              Y+LFY R
Sbjct: 1209 SAYLLFYVR 1217

 Score = 42.4 bits (98), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 23/33 (69%)

Query: 805  FGKTKKVLLEDCINLFTSDEVLSGENAWDCPRC 837
            F K K +LL+DC+ LF+  E+L  +++W CP C
Sbjct: 1064 FEKEKTILLDDCLRLFSKPEILGLQDSWYCPTC 1096

>Ecym_2717 Chr2 (1388844..1390295) [1452 bp, 483 aa] {ON} similar to
           Ashbya gossypii AEL029W
          Length = 483

 Score = 48.1 bits (113), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 41/83 (49%), Gaps = 1/83 (1%)

Query: 614 GLRNLGSTCYINSMLQCLFATRKFRDIFLSPKYHDYISKGY-IHRAQISRSFHMLFKKMY 672
           G+ NLG+TCY+N+ LQ LF     R+  L       I +G   + AQ+ R   + F+K+ 
Sbjct: 103 GIANLGNTCYMNATLQGLFRIDPLREQVLEFDEKRAIKEGVDTYHAQLVRELKVTFQKLK 162

Query: 673 MNGGCSVVPSGFLKACNSMRPDF 695
              G ++ P   L+    + P F
Sbjct: 163 DRKGENITPLLLLEILRRVFPQF 185

 Score = 35.4 bits (80), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 24/46 (52%), Gaps = 8/46 (17%)

Query: 962  YRLYGIVNHFG-NLISGHYTSLVNKDLKHEIRHGQQKWYYFDDEVV 1006
            Y L G++ H G N  SGHY + +  D         +KWY FDD+ V
Sbjct: 415  YDLIGVITHQGANSESGHYQAFIRDD-------ADEKWYRFDDDKV 453

>TBLA0C01200 Chr3 complement(258492..259981,260188..260209) [1512
           bp, 503 aa] {ON} Anc_1.369 YFR010W
          Length = 503

 Score = 48.1 bits (113), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 43/86 (50%), Gaps = 8/86 (9%)

Query: 614 GLRNLGSTCYINSMLQCLFATRKFRDIFLSPKYHDYISKG-YIHRA---QISRSFHMLFK 669
           GL+NLG+TCY+N+ LQCLF     R++ L+ K    +S    +H+    ++   F  L K
Sbjct: 110 GLKNLGNTCYLNATLQCLFRIEPLREMILNYKQSSSVSPADEVHQKIVLELRNCFDSLDK 169

Query: 670 KMYMNGGCSVVPSGFLKACNSMRPDF 695
           K +     +V+P   L       P F
Sbjct: 170 KKFQ----AVMPLMLLNVLRKAYPQF 191

>CAGL0I05522g Chr9 complement(521749..523923) [2175 bp, 724 aa] {ON}
            some similarities with uniprot|P39967 Saccharomyces
            cerevisiae YER098w UBP9 or uniprot|P38187 Saccharomyces
            cerevisiae YBL067c UBP13
          Length = 724

 Score = 48.1 bits (113), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 45/99 (45%), Gaps = 13/99 (13%)

Query: 914  KTFNFITMPPILVIHLSRFFYD--LTKKNSTVITYPLILNI--VLKNNEVAKYRLYGIVN 969
            KT  F  +P  L +HL RF  D  +  K    I YPL L +     N+    Y L G+V 
Sbjct: 531  KTVGFEKLPKTLALHLKRFKCDGIVNSKLFNKIEYPLTLTVCSCFDNSLCKTYELTGVVL 590

Query: 970  HFG-NLISGHYTSLVNKDLKHEIRHGQQKWYYFDDEVVK 1007
            H G +   GHY S+         +H +  W  +DDE ++
Sbjct: 591  HVGASPTHGHYVSIC--------KHEKYGWLMYDDETIE 621

 Score = 38.9 bits (89), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 33/64 (51%), Gaps = 7/64 (10%)

Query: 612 ITGLRNLGSTCYINSMLQCLFATRKFRDIFLS-PKYHDYISKGYIHRAQISRSFHMLFKK 670
           + G  N G TCY NS+LQC++   +FR   L  P+ +   S+  +        FH L ++
Sbjct: 120 VFGYENFGHTCYCNSVLQCIYNLPEFRKSILQFPQRYPLKSRVRVEE------FHSLHER 173

Query: 671 MYMN 674
            Y+N
Sbjct: 174 NYIN 177

>NDAI0I02530 Chr9 (584472..588065) [3594 bp, 1197 aa] {ON} Anc_5.18
            YMR304W
          Length = 1197

 Score = 48.1 bits (113), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 32/101 (31%), Positives = 47/101 (46%), Gaps = 19/101 (18%)

Query: 918  FITMPPILVIHLSRFFYDLTKKNSTVIT----YPLILNIV--------LKNNEVAKYRLY 965
            F + PPIL + L RF YD        I     +P   +            NNE   Y L+
Sbjct: 382  FESFPPILHLQLKRFEYDFNFDQLIKINDRYEFPESFDTSPYMEKKEDGSNNEPCIYNLH 441

Query: 966  GIVNHFGNLISGHYTSLVNKDLKHEIRHGQQKWYYFDDEVV 1006
            G++ H G++ +GHY +++  DL       + +WY FDDE V
Sbjct: 442  GVLVHTGDISTGHYYAMIKPDL-------EDQWYRFDDEKV 475

 Score = 39.3 bits (90), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 20/28 (71%)

Query: 613 TGLRNLGSTCYINSMLQCLFATRKFRDI 640
            G RN G+TCY+NS+LQ  F T+ FR +
Sbjct: 201 VGFRNQGATCYLNSLLQSYFFTKYFRKL 228

>CAGL0L01639g Chr12 (178104..181547) [3444 bp, 1147 aa] {ON} similar
           to uniprot|P39538 Saccharomyces cerevisiae YJL197w UBP12
           ubiquitin C-terminal hydrolase
          Length = 1147

 Score = 48.1 bits (113), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 54/215 (25%), Positives = 88/215 (40%), Gaps = 23/215 (10%)

Query: 612 ITGLRNLGSTCYINSMLQCLFATRKFRDIFLSPKYHDYIS----KGYIHRAQISRSFHML 667
           I GL NLG+TCY+NS LQCL    K RD F    Y   I+     GY     ++ +F  L
Sbjct: 288 IVGLSNLGNTCYMNSGLQCLVHIPKLRDYFFYGGYEQEINLDNPLGY--NGTVATAFGNL 345

Query: 668 FKKMY-----MNGGCSVVPSGF---LKACNSMRPDFKIPNXXXXXXXXXXXXXXXXXXXX 719
            + +Y          S  P+ F   L   NSM   +   +                    
Sbjct: 346 IQNLYSYHWNQQQYQSYSPNRFKMTLGQANSMFAGYMQQDSQEFLAFLLDSLHEDLNRIH 405

Query: 720 SDP--EQVANDYPQLLLHDDDNLQVDGKEYDKWFEDSISKNGLSPIDSIFQGQMENCLQC 777
             P  E+   +  + L  ++   Q+  K +D      +++N  S I+ +F G  ++ L+C
Sbjct: 406 DKPYIEKPTLETSEELADENAVKQLAKKTWDA----HLARND-SVINDLFVGMYKSTLKC 460

Query: 778 QRCGHSSYNYSTFYVLSLAIPTPGTSTFGKTKKVL 812
             C + S  +  +  L+L  P P ++ + K  K+ 
Sbjct: 461 PTCKNISITFDPYNDLTL--PLPISTVWNKKVKIF 493

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 39/129 (30%), Positives = 61/129 (47%), Gaps = 27/129 (20%)

Query: 914  KTFNFITMPPILVIHLSRFF--YDLTKKNSTVITYPL--------ILNIVLKNNEVAKYR 963
            K       P IL+IHL RF      + K   V+ +P+        +++ V+++  +  Y 
Sbjct: 879  KQLELWNTPEILLIHLKRFENQRSFSDKIDAVVDFPIEGLDMTPYVVDSVVEDGCI--YD 936

Query: 964  LYGIVNHFGNLISGHYTSLVNKDLKHEIRHGQQKWYYFDDEVVKQDNNHGDFDAGIASVS 1023
            L+ + NH+G L  GHYTS V  ++ +       +WYYFDD  V   +          SV+
Sbjct: 937  LFAVDNHYGGLGGGHYTSYVKNNIDN-------RWYYFDDSRVSSTDPK-------KSVA 982

Query: 1024 SSDVYVLFY 1032
             S  Y+LFY
Sbjct: 983  GS-AYLLFY 990

 Score = 33.9 bits (76), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 11/27 (40%), Positives = 18/27 (66%)

Query: 811 VLLEDCINLFTSDEVLSGENAWDCPRC 837
           + L+ C+ LF+  EVL   ++W CP+C
Sbjct: 845 ITLDSCLKLFSKPEVLGINDSWYCPKC 871

>TPHA0A02540 Chr1 (543606..547466) [3861 bp, 1286 aa] {ON} Anc_1.137
           YJL197W
          Length = 1286

 Score = 48.1 bits (113), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 53/120 (44%), Gaps = 25/120 (20%)

Query: 572 RHRYLSHSKRSQHQHYSPISHQYISVPTIEQSSNVYVSLSITGLRNLGSTCYINSMLQCL 631
           +H   ++   S + HY+PI +   +V                GL NLG+TCY+NS LQCL
Sbjct: 373 KHSNCNYHWLSNYFHYNPIQNGVGNV----------------GLNNLGNTCYMNSALQCL 416

Query: 632 FATRKFRDIFLSPKYHDYIS----KGYIHRAQISRSFHMLFKKMYMNG---GCSVVPSGF 684
                 RD F    Y + I+     G+  +  I+ +F  L + +Y N      S  PS F
Sbjct: 417 AHIPPIRDYFKFGAYKNEINLDNPLGF--QGNIANAFSALVQNLYKNQFIPSASYAPSQF 474

 Score = 38.5 bits (88), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 41/129 (31%), Positives = 60/129 (46%), Gaps = 23/129 (17%)

Query: 914  KTFNFITMPPILVIHLSRFFY--DLTKKNSTVITYP-----LILNIVLKN-NEVAKYRLY 965
            K     + P IL IHL RF      + K   V+ +P     L  +I+ K+ +++  Y L 
Sbjct: 996  KQIQLWSTPDILTIHLKRFETQGSFSDKIDDVVDFPINGLDLSKHILDKSTSQLNIYDLI 1055

Query: 966  GIVNHFGNLISGHYTSLVNKDLKHEIRHGQQKWYYFDDEVVKQDNNHGDFDAGIASVSSS 1025
             + NH+G L  GHYT+ +   + +       KWYYFDD  V +            SV+ S
Sbjct: 1056 AVDNHYGGLGGGHYTAYIKNLIDN-------KWYYFDDSRVSE-------TVPERSVAGS 1101

Query: 1026 DVYVLFYER 1034
              Y+LFY R
Sbjct: 1102 -AYLLFYMR 1109

 Score = 37.4 bits (85), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 19/29 (65%)

Query: 809 KKVLLEDCINLFTSDEVLSGENAWDCPRC 837
           K + LED +NLF   EVL   ++W CP+C
Sbjct: 960 KNITLEDSLNLFERAEVLGINDSWYCPKC 988

>KNAG0E01290 Chr5 complement(254460..258050) [3591 bp, 1196 aa] {ON}
            Anc_5.18 YMR304W
          Length = 1196

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 31/116 (26%), Positives = 50/116 (43%), Gaps = 20/116 (17%)

Query: 918  FITMPPILVIHLSRFFYDLTKKNSTVIT----YPLILNIV---------LKNNEVAKYRL 964
            F + PP+L + L RF YD        I     +P  +++          L N E   Y L
Sbjct: 384  FESFPPVLHLQLKRFEYDFNYDQLIKINDRYEFPETIDVSPYIEKGSEQLSNKEACIYNL 443

Query: 965  YGIVNHFGNLISGHYTSLVNKDLKHEIRHGQQKWYYFDDEVVKQDNNHGDFDAGIA 1020
            +G++ H G++ +GHY +++   +  E       WY FDD+ V +      FD    
Sbjct: 444  HGVLVHAGDISTGHYYTMIRPGVSDE-------WYRFDDDKVWRVTKKQAFDENFG 492

 Score = 37.4 bits (85), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 14/26 (53%), Positives = 19/26 (73%)

Query: 613 TGLRNLGSTCYINSMLQCLFATRKFR 638
            G +N G+TCY+NS+LQ  F T+ FR
Sbjct: 203 VGFKNQGATCYLNSLLQSYFFTKYFR 228

>TDEL0G00410 Chr7 complement(82945..86505) [3561 bp, 1186 aa] {ON}
            Anc_5.18 YMR304W
          Length = 1186

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 35/111 (31%), Positives = 54/111 (48%), Gaps = 19/111 (17%)

Query: 918  FITMPPILVIHLSRFFYD-----LTKKNS------TVITYPLILNIVLKNNEVAK-YRLY 965
            F + PP+L + L RF YD     L K N       ++   P + +  L+ N   K Y+L+
Sbjct: 384  FESFPPVLHLQLKRFEYDFNYDQLIKVNDRYEFPDSIDLAPYMDSEALEQNPGPKIYKLH 443

Query: 966  GIVNHFGNLISGHYTSLVNKDLKHEIRHGQQKWYYFDDEVVKQDNNHGDFD 1016
            G++ H G++ +GHY +L+    K E       WY FDD+ V +      FD
Sbjct: 444  GVLVHTGDISTGHYYTLIKPSTKDE-------WYRFDDDRVWRATKKQIFD 487

 Score = 37.7 bits (86), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 20/28 (71%)

Query: 613 TGLRNLGSTCYINSMLQCLFATRKFRDI 640
            G RN G+TCY+NS+LQ  + T+ FR +
Sbjct: 203 VGFRNQGATCYLNSLLQSYYFTKYFRRL 230

>KLTH0F03674g Chr6 (321662..325258) [3597 bp, 1198 aa] {ON} similar
           to uniprot|P39538 Saccharomyces cerevisiae YJL197W UBP12
           Ubiquitin-specific protease present in the nucleus and
           cytoplasm that cleaves ubiquitin from ubiquitinated
           proteins
          Length = 1198

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 38/64 (59%), Gaps = 6/64 (9%)

Query: 613 TGLRNLGSTCYINSMLQCLFATRKFRDIFLSPKYHDYISK----GYIHRAQISRSFHMLF 668
           TGL NLG++CY+NS LQCL    + +D FL   Y + ++     GY  +  ++++F  L 
Sbjct: 334 TGLSNLGNSCYMNSALQCLVHIPELKDYFLYGGYEEDVNTQNPLGY--KGLVAQAFAALI 391

Query: 669 KKMY 672
           K ++
Sbjct: 392 KSLF 395

 Score = 45.8 bits (107), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 59/129 (45%), Gaps = 23/129 (17%)

Query: 914  KTFNFITMPPILVIHLSRF--FYDLTKKNSTVITYPLI-LN----IVLKNNEVAK-YRLY 965
            K       P IL IHL RF   +  + K S V+ +P+  LN    +V ++ E    Y L 
Sbjct: 937  KQIQLWNSPDILTIHLKRFESRHSFSDKISDVVDFPICGLNMSDHLVCEDAEQNNLYDLV 996

Query: 966  GIVNHFGNLISGHYTSLVNKDLKHEIRHGQQKWYYFDDEVVKQDNNHGDFDAGIASVSSS 1025
             + NH+G L  GHYT+     +         KWYYFDD  V + +          SVS +
Sbjct: 997  AVDNHYGGLGGGHYTAFAKNPV-------DGKWYYFDDSRVSETDPE-------TSVSGA 1042

Query: 1026 DVYVLFYER 1034
              Y+LFY R
Sbjct: 1043 -AYLLFYRR 1050

 Score = 37.4 bits (85), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 20/29 (68%)

Query: 809 KKVLLEDCINLFTSDEVLSGENAWDCPRC 837
           +++ L DC+ LF+  EVLS  ++W CP C
Sbjct: 901 RRISLFDCLKLFSKPEVLSAADSWYCPTC 929

>TPHA0L02290 Chr12 (479360..482941) [3582 bp, 1193 aa] {ON} Anc_5.18
            YMR304W
          Length = 1193

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 39/117 (33%), Positives = 57/117 (48%), Gaps = 21/117 (17%)

Query: 918  FITMPPILVIHLSRFFYD-----LTKKNS------TVITYPLILNIVLKN-NEVAK--YR 963
            F + P +L + L RF YD     L K N       ++   P +   VLKN NE     Y+
Sbjct: 390  FESFPKVLHLQLKRFEYDFNFDQLIKINDRYEFPDSIDLSPYLDKDVLKNENETESHIYK 449

Query: 964  LYGIVNHFGNLISGHYTSLVNKDLKHEIRHGQQKWYYFDDEVVKQDNNHGDFDAGIA 1020
            L+G++ H G++ +GHY +++  DL      G Q WY FDDE V + +    FD    
Sbjct: 450  LHGVLVHTGDISTGHYYTMIKPDL------GDQ-WYRFDDERVWKVDRKQVFDENFG 499

 Score = 39.7 bits (91), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 20/28 (71%)

Query: 613 TGLRNLGSTCYINSMLQCLFATRKFRDI 640
            G RN G+TCY+NS+LQ  F T+ FR +
Sbjct: 209 VGFRNQGATCYLNSLLQSYFFTKYFRKL 236

>TBLA0D01070 Chr4 complement(275843..277294) [1452 bp, 483 aa] {ON}
           Anc_8.742 YMR223W
          Length = 483

 Score = 47.0 bits (110), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 60/262 (22%), Positives = 112/262 (42%), Gaps = 35/262 (13%)

Query: 585 QHYSPISHQYISVPTIEQSSNVYVSLSITGLRNLGSTCYINSMLQCLFATRKFRDIFLSP 644
           ++++ IS++  S+PT+ Q+        + GL N+GSTCY++S+LQCL     F D+ +  
Sbjct: 116 KYWNRISNE-TSIPTLTQAH------GLKGLVNMGSTCYMSSILQCLMHNPLFVDLSMKG 168

Query: 645 KYHDYISKGYIHRAQISRSFHMLFKKMYMNGGCSVVPS-GFLKACN-SMRPDFKIPNXXX 702
            +++Y       +  +S +   +  + Y  G     P+ G +   N S R +  +     
Sbjct: 169 VHYNYCKIQDPMKC-MSCAIDNIISETY--GNKKTTPNEGLVDILNCSWRVNKNLAGYTQ 225

Query: 703 XXXXXXXXXXXXXXXXXSDPEQVANDYPQLLLHDDDNLQVDGKEYDKWFEDSISKNGLSP 762
                                Q+ NDY    +HD +  +++G ++      + SK  L  
Sbjct: 226 QDAHEFLQFIL---------NQMHNDYKLNEIHDTNKQEMNGTDFKTMVNGNSSKEHLHL 276

Query: 763 ID----SIFQGQMENCLQCQRCGHSSYNYSTFYVLSLAIPTPGTSTFGKTKKVLLEDCIN 818
            +    +IFQG +++ + C  C   S      Y + L++   G ST        L +C+ 
Sbjct: 277 CNCLPHTIFQGFLKSIISCSECKAQSQTTIDPY-MDLSLDVKGKST--------LYECLE 327

Query: 819 LFTSDEVLSGENAWDCPRCGTS 840
            F   E L  +  ++C +C  S
Sbjct: 328 SFHRTERLH-DFTYNCKKCNKS 348

 Score = 37.0 bits (84), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 29/115 (25%), Positives = 46/115 (40%), Gaps = 30/115 (26%)

Query: 914  KTFNFITMPPILVIHLSRFFYDLTKKNSTV---ITYPLILNI------------------ 952
            +  + + + PI+VI L RF + +T  +  +   + +PL LN+                  
Sbjct: 353  RQLSILKLAPIMVIQLKRFEHLITGSSVKINDFVEFPLHLNMKSFCTAPTPDTDPTNLNE 412

Query: 953  -VLKNNEVAKYRLYGIVNHFGNLISGHYTSLVNKDLKHEIRHGQQKWYYFDDEVV 1006
               K+     Y L GIV H G +  GHY +          +     WY F+D VV
Sbjct: 413  KTNKSTPDMIYELTGIVTHRGTVNEGHYITYT--------KTADGVWYQFNDSVV 459

>SAKL0H04994g Chr8 complement(445232..446596) [1365 bp, 454 aa] {ON}
            similar to uniprot|P50102 Saccharomyces cerevisiae
            YMR223W UBP8 Ubiquitin-specific protease that is a
            component of the SAGA (Spt-Ada-Gcn5-Acetyltransferase)
            acetylation complex required for SAGA-mediated
            deubiquitination of histone H2B
          Length = 454

 Score = 47.0 bits (110), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 38/141 (26%), Positives = 66/141 (46%), Gaps = 27/141 (19%)

Query: 902  SEKWKSKKLTTIKTFNFITMPPILVIHLSRFFYDL---TKKNSTVITYPLILNIV--LKN 956
             EK  +K+   I+      +PP+LV+ L RF + +   + K +  I +P  L++    + 
Sbjct: 325  CEKCNTKQ-NAIRQLTIAKLPPVLVLQLKRFEHSINGSSVKLNNYIEFPTYLDMSKYCQT 383

Query: 957  NEVAK-----YRLYGIVNHFGNLISGHYTSLVNKDLKHEIRHGQQKWYYFDDEVVKQDNN 1011
            ++V +     Y L G+++H G++  GHYTS+       +I  GQ  W+ F+D +V     
Sbjct: 384  DKVGETPAIVYELIGLISHQGSVNQGHYTSIC------KIPGGQ--WFKFNDSMVTA--- 432

Query: 1012 HGDFDAGIASVSSSDVYVLFY 1032
                      V     Y+LFY
Sbjct: 433  -----VAEIDVLKEQAYLLFY 448

>NCAS0B00580 Chr2 (86690..88090) [1401 bp, 466 aa] {ON} Anc_8.742
          Length = 466

 Score = 46.6 bits (109), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 36/113 (31%), Positives = 56/113 (49%), Gaps = 21/113 (18%)

Query: 910  LTTIKTFNFITMPPILVIHLSRFFYDLTKKNSTV---ITYPLILNIV-----LKNNEVAK 961
            L  IK F    +PP+LV+ L RF + +   N  +   + YPL LN+        N E   
Sbjct: 344  LDPIKQFTINKLPPMLVLQLKRFEHFVNGTNVKLNEFVQYPLYLNMRDYCDRNTNQETPD 403

Query: 962  --YRLYGIVNHFGNLISGHYTSLVNKDLKHEIRHGQQKWYYFDD---EVVKQD 1009
              Y L GI++H G++  GHY  ++      +I  G  +W+ F+D    V+K+D
Sbjct: 404  IIYELTGILSHIGSINEGHYVVVL------KINDG--RWFKFNDSMISVIKED 448

>KAFR0A04210 Chr1 (843659..844981) [1323 bp, 440 aa] {ON} Anc_8.742
            YMR223W
          Length = 440

 Score = 46.6 bits (109), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 36/133 (27%), Positives = 57/133 (42%), Gaps = 34/133 (25%)

Query: 913  IKTFNFITMPPILVIHLSRFFYDLTKKN---STVITYPLILNI-----VLKNNEVAKYRL 964
            IK      +PP+LV+ L RF +    +N   +  I +P  LN+       +NN    Y L
Sbjct: 323  IKQLTIDKLPPVLVLQLKRFEHLNNGQNVKLNAFIEFPTYLNMKKYCHTEENNSSIIYEL 382

Query: 965  YGIVNHFGNLISGHYTSLVNKDLKHEIRHGQQKWYYFDDEVVKQDNNHGDFDAGIASVSS 1024
             G+++H G +  GHY + +  D           W+ F+D +V              S+S 
Sbjct: 383  NGVISHIGTVNEGHYIATLKLD--------SNNWFKFNDSMV-------------TSISE 421

Query: 1025 SDV-----YVLFY 1032
             +V     Y+LFY
Sbjct: 422  EEVLKDQAYLLFY 434

>KLLA0C06974g Chr3 complement(604344..605684) [1341 bp, 446 aa] {ON}
           similar to uniprot|P50102 Saccharomyces cerevisiae
           YMR223W UBP8 Ubiquitin-specific protease that is a
           component of the SAGA (Spt-Ada-Gcn5-Acetyltransferase)
           acetylation complex required for SAGA-mediated
           deubiquitination of histone H2B
          Length = 446

 Score = 45.8 bits (107), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 59/233 (25%), Positives = 95/233 (40%), Gaps = 46/233 (19%)

Query: 611 SITGLRNLGSTCYINSMLQCLFATRKFRDIFLSPKYHDY--ISKGYIHRAQISRSFHMLF 668
            + GL N+GSTC+++S++Q +     F +  LS K+ +   I  G      +S +   + 
Sbjct: 131 GLQGLVNMGSTCFMSSIIQTIIHNPYFVEDLLSHKHCNNCDIKSG---TKCVSCALDEIA 187

Query: 669 KKMYMNG----GCSVVPSGFLKACNSMRPDFKIPNXXXXXXXXXXXXXXXXXXXXSDPEQ 724
              Y NG      S V  GF+   N +   + I +                       +Q
Sbjct: 188 CDFYGNGPGTGKSSSVSKGFV---NLLSASWHINHHLV-----------------GSSQQ 227

Query: 725 VANDYPQLLLHDDDNLQVDGKEYDKWFEDSISKNGLSPIDSIFQGQMENCLQCQRCGHSS 784
            A++Y Q LL   + L  D   + + F  S + +       IFQG ++N LQC +CG S 
Sbjct: 228 DAHEYWQFLL---NQLHTD---HARVFGSSKAPDCQCITHRIFQGYLKNTLQCSQCGFSK 281

Query: 785 YNYSTFYVLSLAIPTPGTSTFGKTKKVLLEDCINLFTSDEVLSGENAWDCPRC 837
                   LSL I               LEDC++ F  +E L+ +  ++C  C
Sbjct: 282 TTIDPIMDLSLEIKNNPK----------LEDCLDHFQREETLT-DFHYECQSC 323

 Score = 39.7 bits (91), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 32/131 (24%), Positives = 54/131 (41%), Gaps = 26/131 (19%)

Query: 912  TIKTFNFITMPPILVIHLSRFFYDLTKKNSTV---ITYPLILNIVLKNNEVA-------K 961
             +K       P +LVI L RF + L  +++ +   + +PL LN+     ++         
Sbjct: 329  VVKQLTLHKAPNVLVIQLKRFEHQLNGQSAKLNDRVQFPLHLNLKPHLFQIEDEYIPNIA 388

Query: 962  YRLYGIVNHFGNLISGHYTSLVNKDLKHEIRHGQQKWYYFDDEVVKQDNNHGDFDAGIAS 1021
            Y L  +V+H G +  GHYT++   +          +W+ F+D VV               
Sbjct: 389  YDLLNVVSHQGTVDQGHYTTVSKTE--------DGQWFKFNDSVVTSVTE--------EQ 432

Query: 1022 VSSSDVYVLFY 1032
            V     Y+LFY
Sbjct: 433  VLEQQAYLLFY 443

>NDAI0C05950 Chr3 complement(1361343..1364585) [3243 bp, 1080 aa] {ON}
            Anc_8.202 YER151C
          Length = 1080

 Score = 45.8 bits (107), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 45/85 (52%), Gaps = 11/85 (12%)

Query: 953  VLKNNEVA-KYRLYGIVNHFGNLI-SGHYTS-LVNKDLKHEIRHGQQKWYYFDDEVVKQD 1009
            +LKNNE + KY+L  +V H G+    GHYT+ + NKDLK        KW+  DD  + + 
Sbjct: 1002 ILKNNESSRKYKLRAVVYHHGSSPDGGHYTADIYNKDLK--------KWFMIDDVNITEL 1053

Query: 1010 NNHGDFDAGIASVSSSDVYVLFYER 1034
             +    + G   + +   Y+L YE+
Sbjct: 1054 EDADVVNGGDNGLDTRTAYILMYEK 1078

>KLLA0D08459g Chr4 complement(718046..720298) [2253 bp, 750 aa] {ON}
            some similarities with uniprot|P53874 Saccharomyces
            cerevisiae YNL186W UBP10 Ubiquitin-specific protease that
            deubiquitinates ubiquitin-protein moieties may regulate
            silencing by acting on Sir4p involved in
            posttranscriptionally regulating Gap1p and possibly other
            transporters primarily located in the nucleus
          Length = 750

 Score = 45.4 bits (106), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 56/115 (48%), Gaps = 23/115 (20%)

Query: 906  KSKKLT-TIKTFNFITMPPILVIHLSRFFYDLT--KKNSTVITYPLILNIVLKNNEV--- 959
            K KK+T  +K+   I  P  LV+HL +F ++ T   K    ++YP+ L++    +E    
Sbjct: 575  KCKKVTNALKSNKIIRAPETLVVHLKKFRFNGTSSSKMKQAVSYPMFLDLTEYCHESISS 634

Query: 960  --AKYRLYGIVNHFG-NLISGHYTSLVNKDLKHEIRHGQQ---KWYYFDDEVVKQ 1008
               +Y+L  +V H G +L SGHY           I H +Q    W  +DDE + +
Sbjct: 635  LPVRYQLISVVVHEGRSLSSGHY-----------IAHCKQPDGSWATYDDEYINK 678

>CAGL0M13783g Chr13 (1354198..1357788) [3591 bp, 1196 aa] {ON} similar
            to uniprot|P50101 Saccharomyces cerevisiae YMR304w UBP15
          Length = 1196

 Score = 45.4 bits (106), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 48/100 (48%), Gaps = 18/100 (18%)

Query: 918  FITMPPILVIHLSRFFYD-----LTKKN------STVITYPLILNIVLKNNEVAKYRLYG 966
            F + PP+L + L RF YD     + K N       T+   P + +   +      Y L+G
Sbjct: 384  FESFPPVLHLQLKRFEYDFNYDQMIKVNDRYEFPETIDLSPYLEDSKKEKENNCVYNLHG 443

Query: 967  IVNHFGNLISGHYTSLVNKDLKHEIRHGQQKWYYFDDEVV 1006
            ++ H G++ +GHY +L+   L       + +WY FDDE V
Sbjct: 444  VLVHAGDISTGHYYTLIKPGL-------EDQWYRFDDERV 476

 Score = 38.9 bits (89), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 15/26 (57%), Positives = 19/26 (73%)

Query: 613 TGLRNLGSTCYINSMLQCLFATRKFR 638
            G RN G+TCY+NS+LQ  F T+ FR
Sbjct: 203 VGFRNQGATCYLNSLLQSYFFTKYFR 228

>KLTH0D12760g Chr4 (1045108..1046469) [1362 bp, 453 aa] {ON} similar
            to uniprot|P50102 Saccharomyces cerevisiae YMR223W UBP8
            Ubiquitin-specific protease that is a component of the
            SAGA (Spt-Ada-Gcn5- Acetyltransferase) acetylation
            complex required for SAGA- mediated deubiquitination of
            histone H2B
          Length = 453

 Score = 45.1 bits (105), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 37/135 (27%), Positives = 60/135 (44%), Gaps = 36/135 (26%)

Query: 913  IKTFNFITMPPILVIHLSRFFYDLTKKNSTV---ITYPLILNIV--LKNNEVAK-----Y 962
            IK      +PP+LV+ L RF + +   N  +   ITYP  LN+     ++E        Y
Sbjct: 334  IKQMTIAKLPPVLVLQLKRFEHLMNGNNVKLNGEITYPAYLNMAPFCHHSEARSVPDMVY 393

Query: 963  RLYGIVNHFGNLISGHYTSLVNKDLKHEIRHGQQKWYYFDDEVVKQDNNHGDFDAGIASV 1022
             L  +++  G++  GHYT +       ++  GQ  W+ F+D +             I S+
Sbjct: 394  ELVAVISQEGSVNQGHYTCMC------KVPGGQ--WFRFNDTM-------------IVSI 432

Query: 1023 SSSDV-----YVLFY 1032
            +  DV     Y+LFY
Sbjct: 433  TEEDVLRQQAYLLFY 447

>Suva_13.495 Chr13 (857778..861470) [3693 bp, 1230 aa] {ON} YMR304W
            (REAL)
          Length = 1230

 Score = 45.4 bits (106), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 33/107 (30%), Positives = 50/107 (46%), Gaps = 25/107 (23%)

Query: 918  FITMPPILVIHLSRFFYD-----LTKKN------STVITYPLILNIVLK-------NNEV 959
            F + PP+L + L RF YD     + K N       T+   P +   VLK       N   
Sbjct: 386  FESFPPVLHLQLKRFEYDFNYDQMIKVNDKYEFPETIDLSPFVDKDVLKKTLDSGDNGNP 445

Query: 960  AKYRLYGIVNHFGNLISGHYTSLVNKDLKHEIRHGQQKWYYFDDEVV 1006
              Y L+G++ H G++ +GHY +L+   +       + +WY FDDE V
Sbjct: 446  YIYNLHGVLVHSGDISTGHYYTLIKPGV-------EDQWYRFDDERV 485

 Score = 39.7 bits (91), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 20/28 (71%)

Query: 613 TGLRNLGSTCYINSMLQCLFATRKFRDI 640
            G RN G+TCY+NS+LQ  F T+ FR +
Sbjct: 205 VGFRNQGATCYLNSLLQSYFFTKYFRKL 232

>NDAI0F03410 Chr6 complement(820002..822614) [2613 bp, 870 aa] {ON}
            Anc_2.69 YNL186W
          Length = 870

 Score = 45.1 bits (105), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 36/137 (26%), Positives = 61/137 (44%), Gaps = 23/137 (16%)

Query: 907  SKKLTTIKTFNFITMPPILVIHLSRFFYD--LTKKNSTVITYPLILNIV-----LKNNEV 959
            +K    IK    +  P  LV+HL +F ++   + K    ++YP+ L+I       K    
Sbjct: 699  NKTTNAIKRSTILRAPETLVVHLKKFRFNGSTSSKMKQAVSYPMYLDITEYCESSKKVLP 758

Query: 960  AKYRLYGIVNHFG-NLISGHYTSLVNKDLKHEIRHGQQKWYYFDDEVVKQDNNHGDFDAG 1018
            AKY+L  +V H G +L SGHY +          R     W  +DDE++ +        + 
Sbjct: 759  AKYQLLSVVVHEGRSLSSGHYIA--------HCRQPDGTWATYDDELINK-------ISE 803

Query: 1019 IASVSSSDVYVLFYERI 1035
            +  ++  + Y L Y R+
Sbjct: 804  LKLLTEPNAYYLVYTRL 820

>Kwal_26.9151 s26 complement(1095026..1096390) [1365 bp, 454 aa] {ON}
            YMR223W (UBP8) - putative deubiquitinating enzyme [contig
            70] FULL
          Length = 454

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 50/105 (47%), Gaps = 20/105 (19%)

Query: 913  IKTFNFITMPPILVIHLSRFFYDLTKKNSTV----ITYPLILNIVLKNNEVAK------- 961
            IK      +PP+LV+ L RF + L   NS      I YP  LN+    ++          
Sbjct: 335  IKQMTIAKLPPVLVLQLKRFEH-LMNGNSVKLNEKIAYPTYLNMAPFCHQSESRPVPDMM 393

Query: 962  YRLYGIVNHFGNLISGHYTSLVNKDLKHEIRHGQQKWYYFDDEVV 1006
            Y L  +++H G++  GHYTS+       +I  GQ  W+ F+D ++
Sbjct: 394  YELVAVISHEGSVNQGHYTSMC------KIPGGQ--WFRFNDSMI 430

>YER098W Chr5 (355466..357730) [2265 bp, 754 aa] {ON}  UBP9Ubiquitin
            carboxyl-terminal hydrolase, ubiquitin-specific protease
            that cleaves ubiquitin-protein fusions
          Length = 754

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 52/120 (43%), Gaps = 15/120 (12%)

Query: 921  MPPILVIHLSRFFYDLTKKNS----TVITYPLILNI--VLKNNEVAKYRLYGIVNHFGNL 974
            +P IL +HL RF Y   +K++      I YPL L++      +   KY L G+V H G+ 
Sbjct: 554  LPHILSLHLKRFKYSEEQKSNIKLFNKILYPLTLDVSSTFNTSVYKKYELSGVVIHMGSG 613

Query: 975  IS-GHYTSLVNKDLKHEIRHGQQKWYYFDDEVVKQDNNHGDFDAGIASVSSSDVYVLFYE 1033
               GHY  +         R+ +  W  +DDE V+                 +  YVLFY+
Sbjct: 614  PQHGHYVCIC--------RNEKFGWLLYDDETVESIKEETVLQFTGHPGDQTTAYVLFYK 665

 Score = 37.7 bits (86), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 27/99 (27%), Positives = 46/99 (46%), Gaps = 27/99 (27%)

Query: 567 VSHAHRHRYLSHS-----KRSQHQHYSPIS-----HQYISVPTIE------QSSNVYVSL 610
            SH  R ++ S +      +  H+HY  ++      +Y S  T E      +SS ++ ++
Sbjct: 61  ASHERRSKFSSQTDNLAGNKHYHEHYHNMASTSDEREYDSSTTYEDRAFDTESSILFTTI 120

Query: 611 S-----------ITGLRNLGSTCYINSMLQCLFATRKFR 638
           +           + G  N G+TCY NS+LQCL+   +FR
Sbjct: 121 TDLMPYGDGSNKVFGYENFGNTCYCNSVLQCLYNIPEFR 159

>CAGL0K10494g Chr11 (1023698..1025185) [1488 bp, 495 aa] {ON} highly
           similar to uniprot|P43593 Saccharomyces cerevisiae
           YFR010w UBP6 ubiquitin-specific protease
          Length = 495

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/88 (30%), Positives = 43/88 (48%), Gaps = 10/88 (11%)

Query: 614 GLRNLGSTCYINSMLQCLFATRKFRDIFLS---PKYHDYISKGYIHRA---QISRSFHML 667
           GL+N+G+TCY+N+ LQ LF   + +D+ L     K  +  +   IH     ++ R+F  L
Sbjct: 110 GLQNMGNTCYLNATLQALFRADELKDLILQYDPSKVTNSDANDEIHYKIVLELKRTFETL 169

Query: 668 FKKMYMNGGCSVVPSGFLKACNSMRPDF 695
            K+ +     SV+P   L       P F
Sbjct: 170 KKRSFK----SVLPIMLLNTLRKCYPQF 193

>AEL029W Chr5 (580062..581402) [1341 bp, 446 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YFR010W (UBP6)
          Length = 446

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 41/83 (49%), Gaps = 1/83 (1%)

Query: 614 GLRNLGSTCYINSMLQCLFATRKFRDIFLSPKYHDYISKGY-IHRAQISRSFHMLFKKMY 672
           G+ N+G+TCY+N+ LQ L+     R+  L+       ++G  ++  Q+ R     F+K+ 
Sbjct: 61  GIVNMGNTCYMNATLQGLYGIVPLREQILAFDDKKATAEGMDLYHVQLIREIQATFRKLR 120

Query: 673 MNGGCSVVPSGFLKACNSMRPDF 695
              G ++ P   L+    + P F
Sbjct: 121 DKKGEAITPMLLLEILRRVFPQF 143

>YMR304W Chr13 (874987..878679) [3693 bp, 1230 aa] {ON}
            UBP15Ubiquitin-specific protease involved in protein
            deubiquitination; catalytic activity regulated by an
            N-terminal TRAF-like domain and and C-terminal sequences;
            physically interacts with anaphase-promoting
            complex/cyclosome (APC/C) activator, Cdh1p
          Length = 1230

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/108 (29%), Positives = 51/108 (47%), Gaps = 26/108 (24%)

Query: 918  FITMPPILVIHLSRFFYD-----LTKKN------STVITYPLILNIVLKNNEVAK----- 961
            F + PP+L + L RF YD     + K N       T+   P +   VLK    ++     
Sbjct: 386  FESFPPVLHLQLKRFEYDFNYDQMVKVNDKYEFPETIDLSPFVDKDVLKKTLDSENKDKN 445

Query: 962  ---YRLYGIVNHFGNLISGHYTSLVNKDLKHEIRHGQQKWYYFDDEVV 1006
               Y L+G++ H G++ +GHY +L+   +       + +WY FDDE V
Sbjct: 446  PYVYNLHGVLVHSGDISTGHYYTLIKPGV-------EDQWYRFDDERV 486

 Score = 39.7 bits (91), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 20/28 (71%)

Query: 613 TGLRNLGSTCYINSMLQCLFATRKFRDI 640
            G RN G+TCY+NS+LQ  F T+ FR +
Sbjct: 205 VGFRNQGATCYLNSLLQSYFFTKYFRKL 232

>AEL242W Chr5 (182610..184451) [1842 bp, 613 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL072W (UBP16)
          Length = 613

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/98 (29%), Positives = 52/98 (53%), Gaps = 11/98 (11%)

Query: 909 KLTTIKTFNFITMPPILVIHLSRFFYDLT--KKNSTVITYP--LILN-IVLKNNE----- 958
           K T +K    +  P +L++HLSR  ++     KN+  +T+P  L++N  +L+NN+     
Sbjct: 375 KSTIVKRTVSVDSPRVLILHLSRSVFNGVSYAKNTCNVTFPEELVINEQLLENNKCVGVR 434

Query: 959 VAKYRLYGIVNHFGNLISGHYTSLVNK-DLKHEIRHGQ 995
             +Y+L  ++ H G    GHY    +K D + + R G+
Sbjct: 435 AVRYKLCAMIKHIGTHSQGHYACFRHKPDFRKDPRTGE 472

>Smik_13.431 Chr13 (700800..702215) [1416 bp, 471 aa] {ON} YMR223W
            (REAL)
          Length = 471

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 39/137 (28%), Positives = 53/137 (38%), Gaps = 32/137 (23%)

Query: 912  TIKTFNFITMPPILVIHLSRFFYDLTKKNSTV---ITYPLILNI--VLKNNEVAK----- 961
             IK      +P +LV+ L RF + L   N  +   I +P  LN+       E  K     
Sbjct: 345  AIKQLGIHRLPSVLVLQLKRFEHLLNGSNRKLDDFIEFPTYLNMKSYCSTGESEKHTGNG 404

Query: 962  ------YRLYGIVNHFGNLISGHYTSLVNKDLKHEIRHGQQKWYYFDDEVVKQDNNHGDF 1015
                  Y L GIV+H G +  GHY +        +I  GQ  W+ F+D VV         
Sbjct: 405  KVPDIIYELIGIVSHRGTVNEGHYIAFC------KISGGQ--WFKFNDSVVT-------- 448

Query: 1016 DAGIASVSSSDVYVLFY 1032
                  V     Y+LFY
Sbjct: 449  SIAQGEVLKEQAYLLFY 465

 Score = 34.3 bits (77), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 25/37 (67%), Gaps = 6/37 (16%)

Query: 596 SVPTIEQSSNVYVSLSITGLRNLGSTCYINSMLQCLF 632
           +VP +E+         ++GL N+GSTC+++S+LQCL 
Sbjct: 126 TVPIMERRD------GLSGLINMGSTCFMSSILQCLI 156

>ZYRO0D07062g Chr4 complement(609322..612903) [3582 bp, 1193 aa] {ON}
            similar to uniprot|P50101 Saccharomyces cerevisiae
            YMR304W UBP15 Ubiquitin-specific protease that may play a
            role in ubiquitin precursor processing
          Length = 1193

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 34/115 (29%), Positives = 53/115 (46%), Gaps = 19/115 (16%)

Query: 918  FITMPPILVIHLSRFFYD-----LTKKN------STVITYPLILNIVLKNNEVAK-YRLY 965
            F + P +L + L RF YD     L K N        +   P +   VL+ N   + Y L+
Sbjct: 384  FESFPAVLHLQLKRFEYDFNYDQLVKINDRYEFPERIDLSPYMDKDVLEANPGPRWYGLH 443

Query: 966  GIVNHFGNLISGHYTSLVNKDLKHEIRHGQQKWYYFDDEVVKQDNNHGDFDAGIA 1020
            G++ H G++ +GHY +L+   L       + +WY FDDE V + +    FD    
Sbjct: 444  GVLVHTGDISTGHYYALIKPGL-------EDQWYRFDDERVWKVSKKQAFDENFG 491

 Score = 39.3 bits (90), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 20/28 (71%)

Query: 613 TGLRNLGSTCYINSMLQCLFATRKFRDI 640
            G RN G+TCY+NS+LQ  F T+ FR +
Sbjct: 203 VGFRNQGATCYLNSLLQSYFFTKYFRRL 230

>Klac_YGOB_Anc_5.18b Chr3 (1201452..1202573,1202576..1204954) [3501
            bp, 1166 aa] {ON} ANNOTATED BY YGOB -
          Length = 1166

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 47/99 (47%), Gaps = 17/99 (17%)

Query: 918  FITMPPILVIHLSRFFYD-----LTKKNS-----TVITYPLILNIVLKNNEVAKYRLYGI 967
            F + PP+L + L RF YD     L K N        I     L+     +  A Y L+G+
Sbjct: 377  FESFPPVLHLQLKRFEYDFNYDQLIKINDRYEFPESIDLSHYLDSAAPKDTPADYILHGV 436

Query: 968  VNHFGNLISGHYTSLVNKDLKHEIRHGQQKWYYFDDEVV 1006
            + H G++ +GHY +++  D      HG   WY FDD+ V
Sbjct: 437  LVHSGDISTGHYYAMIQPD-----AHGS--WYRFDDDRV 468

 Score = 35.4 bits (80), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 29/57 (50%), Gaps = 1/57 (1%)

Query: 611 SITGLRNLGSTCYINSMLQCLFATRKFRDIFLSPKYHDYISKGYIHRAQISRSFHML 667
              G +N G+TCY+NS+LQ    T+ FR +       D      +  A + R+F++L
Sbjct: 195 GFVGFKNQGATCYLNSLLQSYHFTKLFRKLVYQIPTEDENPTNSVALA-LQRAFYLL 250

>AGL357W Chr7 (33383..36883) [3501 bp, 1166 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YMR304W (UBP15)
          Length = 1166

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 31/101 (30%), Positives = 51/101 (50%), Gaps = 19/101 (18%)

Query: 918  FITMPPILVIHLSRFFYD-----LTKKN------STVITYPLILNIVLKNNEV-AKYRLY 965
            F + PP+L + L RF YD     L K N       ++   P +   V +++   AKY L+
Sbjct: 371  FESFPPVLHLQLKRFEYDFNYDQLIKINDRYEFPESIDLSPYLDPEVQEDSPANAKYNLH 430

Query: 966  GIVNHFGNLISGHYTSLVNKDLKHEIRHGQQKWYYFDDEVV 1006
            G++ H G++ +GHY +++   L       +  WY FDD+ V
Sbjct: 431  GVLVHTGDISTGHYYAMIKPGL-------EDAWYRFDDDKV 464

 Score = 38.1 bits (87), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 21/28 (75%)

Query: 613 TGLRNLGSTCYINSMLQCLFATRKFRDI 640
            GL+N G+TCY+NS+LQ  + T+ FR +
Sbjct: 190 VGLKNQGATCYLNSLLQSYYFTKYFRKL 217

>AGR139C Chr7 complement(1010460..1012829) [2370 bp, 789 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YER151C
            (UBP3)
          Length = 789

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 36/74 (48%), Gaps = 8/74 (10%)

Query: 962  YRLYGIVNHFG-NLISGHYTSLVNKDLKHEIRHGQQKWYYFDDEVVKQDNNHGDFDAGIA 1020
            YRL G+V H G +   GHYT+    D+ H+    Q KWY  DD  V +      F  G  
Sbjct: 723  YRLTGVVYHHGLSPSGGHYTA----DVLHQT---QDKWYRIDDNNVTEIRQEDVFKRGDE 775

Query: 1021 SVSSSDVYVLFYER 1034
            +  S   Y+L Y+R
Sbjct: 776  ASDSKTAYILIYQR 789

>Smik_13.521 Chr13 (857682..861377) [3696 bp, 1231 aa] {ON} YMR304W
            (REAL)
          Length = 1231

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 32/108 (29%), Positives = 51/108 (47%), Gaps = 26/108 (24%)

Query: 918  FITMPPILVIHLSRFFYD-----LTKKN------STVITYPLILNIVLKNNEVAK----- 961
            F + PP+L + L RF YD     + K N       T+   P +   VLK +  +      
Sbjct: 386  FESFPPVLHLQLKRFEYDFNYDQMVKVNDKYEFPETIDLSPFVDKEVLKKSLDSGDKSRN 445

Query: 962  ---YRLYGIVNHFGNLISGHYTSLVNKDLKHEIRHGQQKWYYFDDEVV 1006
               Y L+G++ H G++ +GHY +L+   +       + +WY FDDE V
Sbjct: 446  PYVYNLHGVLVHSGDISTGHYYTLIKPGV-------EDQWYRFDDERV 486

 Score = 39.7 bits (91), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 20/28 (71%)

Query: 613 TGLRNLGSTCYINSMLQCLFATRKFRDI 640
            G RN G+TCY+NS+LQ  F T+ FR +
Sbjct: 205 VGFRNQGATCYLNSLLQSYFFTKYFRKL 232

>NCAS0D00600 Chr4 (102081..103562) [1482 bp, 493 aa] {ON} Anc_1.369
           YFR010W
          Length = 493

 Score = 43.1 bits (100), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 39/85 (45%), Gaps = 7/85 (8%)

Query: 614 GLRNLGSTCYINSMLQCLFATRKFRDIFLSPKYHDYISKGYIHRA---QISRSFHMLFKK 670
           GL+N+G+TCY+N+ LQ LF     RD+ L+        +  +H     ++ R F  L  K
Sbjct: 108 GLQNMGNTCYMNATLQALFRVDSIRDLILNYDPAKASPQDEMHHKIVLEMKRCFENLENK 167

Query: 671 MYMNGGCSVVPSGFLKACNSMRPDF 695
            Y     SV+P   L       P F
Sbjct: 168 SYK----SVMPLMLLNVLRKCYPQF 188

>KLTH0H13354g Chr8 complement(1165485..1166953,1167017..1167035)
           [1488 bp, 495 aa] {ON} similar to uniprot|P43593
           Saccharomyces cerevisiae YFR010W UBP6 Ubiquitin-specific
           protease situated in the base subcomplex of the 26S
           proteasome releases free ubiquitin from branched
           polyubiquitin chains deletion causes hypersensitivity to
           cycloheximide and other toxic compounds
          Length = 495

 Score = 42.7 bits (99), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 33/58 (56%), Gaps = 3/58 (5%)

Query: 613 TGLRNLGSTCYINSMLQCLFATRKFRDIFLS--PKYHDYISKGYIHR-AQISRSFHML 667
            GL+NLG+TCY+NS LQ L+  R  R+  L+  P   +   + +I   A++ R F  L
Sbjct: 106 VGLKNLGNTCYMNSTLQALYQIRPLREEILNFQPPKENRSGEQHIQLVAELKRCFQQL 163

>Skud_13.478 Chr13 (848446..852141) [3696 bp, 1231 aa] {ON} YMR304W
            (REAL)
          Length = 1231

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 32/108 (29%), Positives = 50/108 (46%), Gaps = 26/108 (24%)

Query: 918  FITMPPILVIHLSRFFYD-----LTKKN------STVITYPLILNIVL--------KNNE 958
            F + PP+L + L RF YD     + K N       T+   P +   VL        K+  
Sbjct: 386  FESFPPVLHLQLKRFEYDFNYDQMVKVNDKYEFPETIDLSPFVDKDVLRKTLDSGDKDKN 445

Query: 959  VAKYRLYGIVNHFGNLISGHYTSLVNKDLKHEIRHGQQKWYYFDDEVV 1006
               Y L+G++ H G++ +GHY +L+   +       + +WY FDDE V
Sbjct: 446  PYIYNLHGVLVHSGDISTGHYYTLIKPGV-------EDQWYRFDDERV 486

 Score = 39.7 bits (91), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 20/28 (71%)

Query: 613 TGLRNLGSTCYINSMLQCLFATRKFRDI 640
            G RN G+TCY+NS+LQ  F T+ FR +
Sbjct: 205 VGFRNQGATCYLNSLLQSYFFTKYFRKL 232

>YMR223W Chr13 (716715..718130) [1416 bp, 471 aa] {ON}
            UBP8Ubiquitin-specific protease that is a component of
            the SAGA (Spt-Ada-Gcn5-Acetyltransferase) acetylation
            complex; required for SAGA-mediated deubiquitination of
            histone H2B
          Length = 471

 Score = 42.7 bits (99), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 41/142 (28%), Positives = 61/142 (42%), Gaps = 42/142 (29%)

Query: 912  TIKTFNFITMPPILVIHLSRFFYDLTKKNSTV---ITYPLILNIVL--------KNNEVA 960
             IK      +P +LV+ L RF + L   N  +   I +P  LN+          K++E  
Sbjct: 345  AIKQLGIHKLPSVLVLQLKRFEHLLNGSNRKLDDFIEFPTYLNMKNYCSTKEKDKHSENG 404

Query: 961  K-----YRLYGIVNHFGNLISGHYTSLVNKDLKHEIRHGQQKWYYFDDEVVKQDNNHGDF 1015
            K     Y L GIV+H G +  GHY +        +I  GQ  W+ F+D +V         
Sbjct: 405  KVPDIIYELIGIVSHKGTVNEGHYIAFC------KISGGQ--WFKFNDSMV--------- 447

Query: 1016 DAGIASVSSSDV-----YVLFY 1032
                +S+S  +V     Y+LFY
Sbjct: 448  ----SSISQEEVLKEQAYLLFY 465

 Score = 34.3 bits (77), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 25/35 (71%), Gaps = 6/35 (17%)

Query: 597 VPTIEQSSNVYVSLSITGLRNLGSTCYINSMLQCL 631
           VP++E+         ++GL N+GSTC+++S+LQCL
Sbjct: 127 VPSMERRD------GLSGLINMGSTCFMSSILQCL 155

>Ecym_5671 Chr5 complement(1362706..1366236) [3531 bp, 1176 aa] {ON}
            similar to Ashbya gossypii AGL357W
          Length = 1176

 Score = 42.7 bits (99), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 48/103 (46%), Gaps = 19/103 (18%)

Query: 918  FITMPPILVIHLSRFFYDLTKKNSTVIT--YPLILNIVLK---NNEVAK-------YRLY 965
            F + PP+L + L RF YD        I   Y    +I L    + EV K       Y L+
Sbjct: 380  FESFPPVLHLQLKRFEYDFNYDQLIKINDRYEFPESIDLSPYLDPEVRKIRPESMMYNLH 439

Query: 966  GIVNHFGNLISGHYTSLVNKDLKHEIRHGQQKWYYFDDEVVKQ 1008
            G++ H G++ +GHY +++   L         KWY FDD+ V Q
Sbjct: 440  GVLVHTGDISTGHYYAMIKPGL-------DDKWYRFDDDKVWQ 475

 Score = 38.5 bits (88), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 21/30 (70%)

Query: 611 SITGLRNLGSTCYINSMLQCLFATRKFRDI 640
              GL+N G+TCY+NS+LQ  + T+ FR +
Sbjct: 197 GFVGLKNQGATCYLNSLLQSYYFTKYFRKL 226

>Kpol_513.25 s513 (71125..74697) [3573 bp, 1190 aa] {ON}
            (71125..74697) [3573 nt, 1191 aa]
          Length = 1190

 Score = 42.7 bits (99), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 33/115 (28%), Positives = 53/115 (46%), Gaps = 19/115 (16%)

Query: 918  FITMPPILVIHLSRFFYD-----LTKKNS------TVITYPLILNIVLKNNEVAK-YRLY 965
            F + P +L + L RF YD     L K N        +   P +   +LK     K Y+L+
Sbjct: 385  FESFPAVLHLQLKRFEYDFNYDQLIKVNDRYEFPDKIDLAPYMDKELLKKTPGPKNYKLH 444

Query: 966  GIVNHFGNLISGHYTSLVNKDLKHEIRHGQQKWYYFDDEVVKQDNNHGDFDAGIA 1020
            G++ H G++ +GHY +++   L       + +WY FDDE V + +    FD    
Sbjct: 445  GVLVHTGDISTGHYYAMIKPTL-------EDQWYRFDDEKVWKVDKKQVFDENFG 492

 Score = 39.3 bits (90), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 20/28 (71%)

Query: 613 TGLRNLGSTCYINSMLQCLFATRKFRDI 640
            G RN G+TCY+NS+LQ  F T+ FR +
Sbjct: 204 VGFRNQGATCYLNSLLQSYFFTKYFRKL 231

>Kpol_1045.41 s1045 complement(95233..97371) [2139 bp, 712 aa] {ON}
            complement(95235..97373) [2139 nt, 713 aa]
          Length = 712

 Score = 42.4 bits (98), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 41/122 (33%), Positives = 54/122 (44%), Gaps = 15/122 (12%)

Query: 921  MPPILVIHLSRFFY-DLTKKNSTV---ITYPLILNIVLKNNE-VAK-YRLYGIVNHFG-N 973
            +P  L IHL RF Y D    N  +   I YP+ L +    +E V+K Y L G+V H G  
Sbjct: 527  LPKTLAIHLKRFKYSDEHGTNVKLFNKIKYPITLKVSSTFDESVSKDYELGGLVVHIGIG 586

Query: 974  LISGHYTSLVNKDLKHEIRHGQQKWYYFDDEVVKQDNNHGDFDAGIASVSSSDVYVLFYE 1033
               GHY S+         +     W  FDDE V+  +          S S+   YVLFY+
Sbjct: 587  PQHGHYISVC--------KTSDYGWLLFDDETVECISEDTVLSFVGDSNSAGTAYVLFYK 638

Query: 1034 RI 1035
             I
Sbjct: 639  EI 640

 Score = 42.0 bits (97), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 16/32 (50%), Positives = 22/32 (68%)

Query: 612 ITGLRNLGSTCYINSMLQCLFATRKFRDIFLS 643
           + GL N G+TCY NS+LQCL+   +FR+  L 
Sbjct: 130 VYGLENFGNTCYCNSILQCLYNMNEFRENILG 161

 Score = 35.0 bits (79), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 29/118 (24%), Positives = 54/118 (45%), Gaps = 9/118 (7%)

Query: 720 SDPEQVANDYPQLLLHDDDNLQVDGKEYDKWFEDSISKNGLSPIDSIFQGQMENCLQCQR 779
           +D  Q A+++   LL+D  +  +D    +K  +++ S N  + ++ IF+G + N ++C  
Sbjct: 404 TDMHQDAHEFLNFLLNDVSDY-LDKANTEKNPDNTRSGNETNFVNDIFKGTITNQIRCLT 462

Query: 780 CGHSSYNYSTFYVLSLAIPTPGTSTFGKTKKVLLEDCINLFTSDEVLSGENAWDCPRC 837
           C   +  Y +F  L   I   G  T    K ++       +   E+L G N + C  C
Sbjct: 463 CDTVTSRYESF--LDFPIEVIGDETIDIQKMMI------SYHQKEMLQGSNKFYCGTC 512

>Smik_5.244 Chr5 (364470..366719) [2250 bp, 749 aa] {ON} YER098W
            (REAL)
          Length = 749

 Score = 42.0 bits (97), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 52/120 (43%), Gaps = 15/120 (12%)

Query: 921  MPPILVIHLSRFFYDLTKKNS----TVITYPLILNI--VLKNNEVAKYRLYGIVNHFGNL 974
            +P IL +HL RF Y   +K++      I YPL L++      +   KY L G+V H G+ 
Sbjct: 552  LPYILSLHLKRFKYSEEQKSNIKLFNKILYPLTLDVSSTFDTSVSKKYELSGVVIHMGSG 611

Query: 975  IS-GHYTSLVNKDLKHEIRHGQQKWYYFDDEVVKQDNNHGDFDAGIASVSSSDVYVLFYE 1033
               GHY  +         ++ +  W  +DDE V+                 +  YVLFY+
Sbjct: 612  PQHGHYVCIC--------KNEKFGWLLYDDETVESIREETVLQFTGHPGDQTTAYVLFYK 663

 Score = 39.3 bits (90), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 41/158 (25%), Positives = 70/158 (44%), Gaps = 34/158 (21%)

Query: 568 SHAHRHRY------LSHSKRSQHQHYSPIS----HQYISVPTIE------QSSNVYVSLS 611
           SH  R R       L+  K+  H +YS  +     ++ S+ T E      +SS ++ ++S
Sbjct: 62  SHERRSRNSSQTDNLAEHKQHHHHNYSKANTADIEEHDSLGTYEDRALNTESSILFTTIS 121

Query: 612 -----------ITGLRNLGSTCYINSMLQCLFATRKFRDIFLSPKYHDYISKGYIHRAQI 660
                      + G  N G+TCY NS+LQCL+   +FR   L  +Y +  +   I ++ +
Sbjct: 122 DLMPYGDGSNKVFGYENFGNTCYCNSVLQCLYNIPEFRCNIL--QYPEKPATNRIRKSDL 179

Query: 661 SRSFHMLFK----KMYMNGGCSVVPSGFLK-ACNSMRP 693
             S   +F     +  +NGG +   S   +  CN+  P
Sbjct: 180 KGSKARIFTNESFETSVNGGNTKCESNDNEDTCNNHHP 217

>Suva_13.407 Chr13 (697513..698928) [1416 bp, 471 aa] {ON} YMR223W
            (REAL)
          Length = 471

 Score = 42.0 bits (97), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 40/142 (28%), Positives = 60/142 (42%), Gaps = 42/142 (29%)

Query: 912  TIKTFNFITMPPILVIHLSRFFYDLTKKNSTV---ITYPLILNIV-----------LKNN 957
             IK      +P +LV+ L RF + L   N  +   I +P  LN+            + N 
Sbjct: 345  AIKQLGIHKLPSVLVLQLKRFEHLLNGSNRKLDDFIQFPTYLNMKSYCSIRESEKHIGNK 404

Query: 958  EVAK--YRLYGIVNHFGNLISGHYTSLVNKDLKHEIRHGQQKWYYFDDEVVKQDNNHGDF 1015
            +V    Y L GIV+H G +  GHY +        +I  GQ  W+ F+D +V         
Sbjct: 405  KVPDIIYELIGIVSHKGTVNEGHYIAFC------KISGGQ--WFKFNDSMV--------- 447

Query: 1016 DAGIASVSSSDV-----YVLFY 1032
                +S+S  +V     Y+LFY
Sbjct: 448  ----SSISQEEVLKEQAYLLFY 465

 Score = 33.9 bits (76), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 24/35 (68%), Gaps = 6/35 (17%)

Query: 597 VPTIEQSSNVYVSLSITGLRNLGSTCYINSMLQCL 631
           VP +E+         ++GL N+GSTC+++S+LQCL
Sbjct: 127 VPIMERRD------GLSGLINMGSTCFMSSILQCL 155

>TBLA0C07020 Chr3 (1694706..1698449) [3744 bp, 1247 aa] {ON}
           Anc_5.18 YMR304W
          Length = 1247

 Score = 42.4 bits (98), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 21/28 (75%)

Query: 613 TGLRNLGSTCYINSMLQCLFATRKFRDI 640
            G RN G+TCY+NS+LQ  F T+ FRD+
Sbjct: 259 VGFRNQGATCYLNSLLQSYFFTKYFRDL 286

 Score = 42.0 bits (97), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 34/115 (29%), Positives = 50/115 (43%), Gaps = 19/115 (16%)

Query: 918  FITMPPILVIHLSRFFYD-----LTKKN------STVITYPLILNIVLKNNEVAK-YRLY 965
            F + P +L + L RF YD     L K N       T+   P +   VLK  +    Y L+
Sbjct: 440  FESFPEVLHLQLKRFEYDFNYDQLVKVNDRFEFPETIDLSPYMDKEVLKKQKGPNNYNLH 499

Query: 966  GIVNHFGNLISGHYTSLVNKDLKHEIRHGQQKWYYFDDEVVKQDNNHGDFDAGIA 1020
            G++ H G++ +GHY +++             KWY FDDE V +      FD    
Sbjct: 500  GVLVHTGDISTGHYYAMIKPT-------TDDKWYRFDDEKVWRVTKKQVFDENFG 547

>KNAG0G02930 Chr7 (644555..645934) [1380 bp, 459 aa] {ON} Anc_8.742
            YMR223W
          Length = 459

 Score = 42.0 bits (97), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 28/102 (27%), Positives = 51/102 (50%), Gaps = 16/102 (15%)

Query: 913  IKTFNFITMPPILVIHLSRFFYDLTKKNSTV---ITYPLILNIV--LKNNEVAK---YRL 964
            IK      + P LV+ L RF +  + +N  +   + +PL L++       E      YRL
Sbjct: 339  IKQLTIERLAPTLVLQLKRFEHLTSGQNVKLNDPVQFPLHLDMSRYCTGGEPTTSIVYRL 398

Query: 965  YGIVNHFGNLISGHYTSLVNKDLKHEIRHGQQKWYYFDDEVV 1006
             G+V+H G +  GHYT+++      ++  G+  W+ F+D ++
Sbjct: 399  SGVVSHSGTVNEGHYTAVL------QLNSGE--WFKFNDSMI 432

 Score = 32.7 bits (73), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 66/265 (24%), Positives = 103/265 (38%), Gaps = 60/265 (22%)

Query: 588 SPISHQYISVPTIEQSSNVYVSLSITGLRNLGSTCYINSMLQCLFATRKFRDIFLSPKYH 647
           S +S Q +S+PT  +   +Y      GL NLGSTC+++S+LQ L      +  FL     
Sbjct: 119 SAMSKQ-VSLPTSLRRDGLY------GLLNLGSTCFMSSILQSLIHNTYIQYWFL----- 166

Query: 648 DYISKGYIHRAQ-------ISRSFHMLFKKMYMNGGCSVVPSGFLKACNSMRPDFKIPNX 700
              + G+  R         IS +   +  + Y +       +GFL     +   +KI   
Sbjct: 167 ---NSGHARRCALRDPSSCISCALDRIISECYGSLSERNDHAGFLSL---LTCSWKINQN 220

Query: 701 XXXXXXXXXXXXXXXXXXXSDPEQVANDYPQLLLHDDDNLQVDGK-----EYDKWFEDSI 755
                                 +Q A+++ Q LL   + L  D K     + DK    S 
Sbjct: 221 FAGY-----------------SQQDAHEFLQFLL---NQLHCDYKRERQVDEDKEVRSSS 260

Query: 756 SKNGLSPIDSIFQGQMENCLQCQRCGHSSYNYSTFYVLSLAIPTPGTSTFGKTKKVLLED 815
           S+     + S FQG + + + C  C   S      + L L++   G  T        L D
Sbjct: 261 SQLCHCIVHSSFQGTLRSSIVCPECQDDSKTMLDPF-LDLSLDIKGQRT--------LYD 311

Query: 816 CINLFTSDEVLSGENAWDCPRCGTS 840
           C++ F   E L  +  + CPRC TS
Sbjct: 312 CLDSFHRREQLH-DFDYHCPRCQTS 335

>KLTH0B09944g Chr2 complement(826050..829619) [3570 bp, 1189 aa] {ON}
            similar to uniprot|P50101 Saccharomyces cerevisiae
            YMR304W UBP15 Ubiquitin-specific protease that may play a
            role in ubiquitin precursor processing
          Length = 1189

 Score = 42.0 bits (97), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 51/115 (44%), Gaps = 19/115 (16%)

Query: 918  FITMPPILVIHLSRFFYD-----LTKKN------STVITYPLILNIVLKNNEV-AKYRLY 965
            F + P +L + L RF YD     L K N       T+   P +   VLK N     Y L+
Sbjct: 383  FESFPSVLHLQLKRFEYDFNYDQLVKINDRYEFPETIDLSPYLDPDVLKKNPGPCVYNLH 442

Query: 966  GIVNHFGNLISGHYTSLVNKDLKHEIRHGQQKWYYFDDEVVKQDNNHGDFDAGIA 1020
            G++ H G +  GHY +++  D+      G Q W+ FDD+ V +      FD    
Sbjct: 443  GVLVHSGEISVGHYYAMIKPDV------GDQ-WFRFDDDKVWRVTKEQAFDENFG 490

 Score = 40.4 bits (93), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 16/27 (59%), Positives = 21/27 (77%)

Query: 614 GLRNLGSTCYINSMLQCLFATRKFRDI 640
           GL+N G+TCY+NS+LQ  F T+ FR I
Sbjct: 203 GLKNQGATCYLNSLLQSYFFTKLFRKI 229

>YFR010W Chr6 (165067..166566) [1500 bp, 499 aa] {ON}
           UBP6Ubiquitin-specific protease situated in the base
           subcomplex of the 26S proteasome, releases free
           ubiquitin from branched polyubiquitin chains; works in
           opposition to Hul5p polyubiquitin elongation activity;
           mutant has aneuploidy tolerance
          Length = 499

 Score = 41.6 bits (96), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 43/99 (43%), Gaps = 5/99 (5%)

Query: 601 EQSSNVYVSLSITGLRNLGSTCYINSMLQCLFATRKFRDIFLSPKYHDYISKGYIHRAQI 660
           EQ    +  L + G +N+G+TCY+N+ LQ L+     RD+ L+      +S       +I
Sbjct: 98  EQQVQQFAQLPV-GFKNMGNTCYLNATLQALYRVNDLRDMILNYNPSQGVSNSGAQDEEI 156

Query: 661 SRSFHMLFKKMYMN----GGCSVVPSGFLKACNSMRPDF 695
            +   +  K+ + N       SV+P   L       P F
Sbjct: 157 HKQIVIEMKRCFENLQNKSFKSVLPIVLLNTLRKCYPQF 195

>Skud_13.392 Chr13 (690758..692179) [1422 bp, 473 aa] {ON} YMR223W
            (REAL)
          Length = 473

 Score = 41.6 bits (96), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 40/144 (27%), Positives = 60/144 (41%), Gaps = 44/144 (30%)

Query: 912  TIKTFNFITMPPILVIHLSRFFYDLTKKNSTV---ITYPLILNIV-------------LK 955
             IK      +P +LV+ L RF + L   N  +   I +P  LN+              + 
Sbjct: 345  AIKQLGIHRLPSVLVLQLKRFEHLLNGTNRKLDDFIEFPTYLNMKSYCSTAESESENHIG 404

Query: 956  NNEVAK--YRLYGIVNHFGNLISGHYTSLVNKDLKHEIRHGQQKWYYFDDEVVKQDNNHG 1013
            N +V    Y L GIV+H G +  GHY +        +I  GQ  W+ F+D +V       
Sbjct: 405  NGKVPDIIYELIGIVSHKGTVNEGHYIAFC------KISGGQ--WFKFNDSMV------- 449

Query: 1014 DFDAGIASVSSSDV-----YVLFY 1032
                  +S+S  +V     Y+LFY
Sbjct: 450  ------SSISQEEVLKEQAYLLFY 467

 Score = 33.9 bits (76), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 24/35 (68%), Gaps = 6/35 (17%)

Query: 597 VPTIEQSSNVYVSLSITGLRNLGSTCYINSMLQCL 631
           VP +E+         ++GL N+GSTC+++S+LQCL
Sbjct: 127 VPAMERRD------GLSGLINMGSTCFMSSILQCL 155

>Kwal_34.16268 s34 (268814..270163) [1350 bp, 449 aa] {ON} YFR010W
           (UBP6) - (putative) ubiquitin-specific protease [contig
           710] FULL
          Length = 449

 Score = 41.6 bits (96), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 43/90 (47%), Gaps = 3/90 (3%)

Query: 607 YVSLSITGLRNLGSTCYINSMLQCLFATRKFRDIFLSPKY-HDYISKGYIHRAQISRSFH 665
           ++S +  GL+NLG+TCY+NS LQ L+  +  RD  L+ K   +  S+   H  Q+     
Sbjct: 54  HLSQTPVGLKNLGNTCYMNSTLQALYQIKPLRDEVLNYKVPREKPSEEQHH--QLVSELR 111

Query: 666 MLFKKMYMNGGCSVVPSGFLKACNSMRPDF 695
             F+++      SV P   L       P F
Sbjct: 112 RCFQQLKDKPQESVTPMLLLAMLRKCYPQF 141

>KNAG0A01970 Chr1 (157670..159085) [1416 bp, 471 aa] {ON} Anc_8.540
            YPL072W
          Length = 471

 Score = 41.6 bits (96), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 45/163 (27%), Positives = 65/163 (39%), Gaps = 43/163 (26%)

Query: 909  KLTTIKTFNFITMPPILVIHLSRFFYDLTK--KNSTVITYPLILNIVLKNN------EVA 960
            K   I+       P IL +HLSR  ++     +N   + YP  L IVL+ +      E  
Sbjct: 315  KTAIIRRTAISNAPSILSLHLSRSMFNGASFTRNPCRVEYPETL-IVLQRDVENGTAERI 373

Query: 961  KYRLYGIVNHFGNLISGHYTSLVNK-DLKHEIRHG------------------------- 994
             YRL  ++ H G   SGHY    +K DL   +  G                         
Sbjct: 374  TYRLRSMIKHTGTHYSGHYQCYKHKPDLVKLMGTGVTVNRSPTVLARPPMIQERVKTPKS 433

Query: 995  QQKW--YYFDDEVVKQDNNHGDFDAGIASVSSSDVYVLFYERI 1035
             ++W  ++  D VV++ N      AG     S  VY+LFYER+
Sbjct: 434  VRRWPYWFISDAVVRESN------AGKMLRESKYVYMLFYERV 470

>SAKL0H00418g Chr8 (50575..54147) [3573 bp, 1190 aa] {ON} similar to
            uniprot|P50101 Saccharomyces cerevisiae YMR304W UBP15
            Ubiquitin-specific protease that may play a role in
            ubiquitin precursor processing
          Length = 1190

 Score = 42.0 bits (97), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 33/121 (27%), Positives = 55/121 (45%), Gaps = 19/121 (15%)

Query: 918  FITMPPILVIHLSRFFYD-----LTKKN-------STVITYPLILNIVLKNNEVAKYRLY 965
            F + PP+L + L RF YD     L K N       S  ++  L   I   N +   Y L+
Sbjct: 387  FESFPPVLHLQLKRFEYDFNYDQLIKINDRYEFPESIDLSPYLDPEISSSNADSYIYDLH 446

Query: 966  GIVNHFGNLISGHYTSLVNKDLKHEIRHGQQKWYYFDDEVVKQDNNHGDFDAGIASVSSS 1025
            G++ H G++ +GHY +++   +       + +WY FDD+ V +   +  F+     V   
Sbjct: 447  GVLVHTGDISTGHYYTMIKPSI-------EDQWYRFDDDKVWRVTKNQVFEENFGHVRLP 499

Query: 1026 D 1026
            D
Sbjct: 500  D 500

 Score = 38.1 bits (87), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 20/28 (71%)

Query: 613 TGLRNLGSTCYINSMLQCLFATRKFRDI 640
            G +N G+TCY+NS+LQ  F T+ FR +
Sbjct: 206 VGFKNQGATCYLNSLLQSYFFTKYFRKL 233

>ZYRO0A05962g Chr1 complement(474545..475942) [1398 bp, 465 aa] {ON}
            similar to uniprot|P50102 Saccharomyces cerevisiae
            YMR223W UBP8 Ubiquitin-specific protease that is a
            component of the SAGA (Spt-Ada-Gcn5-Acetyltransferase)
            acetylation complex required for SAGA-mediated
            deubiquitination of histone H2B
          Length = 465

 Score = 41.2 bits (95), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 28/102 (27%), Positives = 47/102 (46%), Gaps = 15/102 (14%)

Query: 912  TIKTFNFITMPPILVIHLSRFFYDL---TKKNSTVITYPLILNI--VLKNNEVAK--YRL 964
             IK      +P +LV+ L RF + L   + K + ++ +PL LN+      ++V    + L
Sbjct: 348  AIKRLIIHKLPAVLVLQLKRFEHHLNGNSAKLNDIVEFPLFLNMRNYCDGDDVPDIIFEL 407

Query: 965  YGIVNHFGNLISGHYTSLVNKDLKHEIRHGQQKWYYFDDEVV 1006
             GI+ H G +  GHY +       H        W+ F+D +V
Sbjct: 408  IGIIAHRGTVNEGHYIAFTKVTTGH--------WFKFNDSMV 441

>KAFR0I02600 Chr9 (525365..529006) [3642 bp, 1213 aa] {ON} Anc_5.18
            YMR304W
          Length = 1213

 Score = 41.6 bits (96), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 34/132 (25%), Positives = 62/132 (46%), Gaps = 22/132 (16%)

Query: 918  FITMPPILVIHLSRFFYD-----LTKKNS------TVITYPLILNIVLKNNEV--AKYRL 964
            F + PP+L + L RF YD     L K N       ++     I  +  ++ E+    Y+L
Sbjct: 374  FESFPPVLHLQLKRFEYDFNYDQLIKVNDRYEFPDSIDVSSYIDKMGTEDTEMPPCIYKL 433

Query: 965  YGIVNHFGNLISGHYTSLVNKDLKHEIRHGQQKWYYFDDEVVKQDNNHGDFDA--GIASV 1022
            +G++ H G++ +GHY +++           + +WY FDDE V +      FD   G+  +
Sbjct: 434  HGVLVHAGDISTGHYYAMIKPS-------TEDQWYRFDDEKVWKVTKTQVFDENFGLDRI 486

Query: 1023 SSSDVYVLFYER 1034
               +V ++  E+
Sbjct: 487  PDDEVRLMSREQ 498

 Score = 37.7 bits (86), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 14/26 (53%), Positives = 19/26 (73%)

Query: 613 TGLRNLGSTCYINSMLQCLFATRKFR 638
            G +N G+TCY+NS+LQ  F T+ FR
Sbjct: 193 VGFKNQGATCYLNSLLQSYFFTKYFR 218

>Ecym_6248 Chr6 (468203..469603) [1401 bp, 466 aa] {ON} similar to
            Ashbya gossypii AFR551W
          Length = 466

 Score = 41.2 bits (95), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 32/118 (27%), Positives = 55/118 (46%), Gaps = 24/118 (20%)

Query: 902  SEKWKSKKLTTIKTFNFITMPPILVIHLSRFFYDLTKKNSTV---ITYPLILNI------ 952
             +K KS K   I+      +PP+L++ L RF + +   +  +   I++PL LN+      
Sbjct: 339  CKKCKSTK-NPIRQLTTAKLPPVLMLQLKRFEHLMNGTSVKINDYISFPLHLNMKDYCKP 397

Query: 953  --VLKNNEVAKYRLYGIVNHFGNLISGHYTSL--VNKDLKHEIRHGQQKWYYFDDEVV 1006
               L       Y+L  I++H G +  GHYT++  +N D+          W  F+D +V
Sbjct: 398  VDCLHPVPNMMYKLSAIISHHGTVHQGHYTTICRINGDI----------WAKFNDSMV 445

>Smik_5.318 Chr5 complement(474889..477618) [2730 bp, 909 aa] {ON}
            YER151C (REAL)
          Length = 909

 Score = 41.2 bits (95), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 37/146 (25%), Positives = 63/146 (43%), Gaps = 37/146 (25%)

Query: 921  MPPILVIHLSRF-FYDLTKKNSTVITY------------------PLIL------NIVLK 955
            +P +L+I L RF F +   K++ +  Y                   LI+      +I LK
Sbjct: 771  LPQVLLIQLKRFSFINNVNKDNAMTNYNAYNGRIEKIRKKIKYDHELIIPEESMSSITLK 830

Query: 956  NNEVA----KYRLYGIVNHFG-NLISGHYTSLVNKDLKHEIRHGQQKWYYFDDEVVKQDN 1010
            N+       +Y+L G++ H G +   GHYT+    D+ H+      KWY  DD  + +  
Sbjct: 831  NHTSGVDDRRYKLTGVIYHHGVSSDGGHYTA----DVYHK---EHNKWYRIDDVNITELE 883

Query: 1011 NHGDFDAGIASVSSSDVYVLFYERIY 1036
            +      G  +  S   Y+L Y+++Y
Sbjct: 884  DDDVLKGGEEASDSRTAYILMYQKVY 909

>Ecym_5544 Chr5 (1102256..1104760) [2505 bp, 834 aa] {ON} similar to
            Ashbya gossypii AGR139C
          Length = 834

 Score = 41.2 bits (95), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 34/74 (45%), Gaps = 8/74 (10%)

Query: 962  YRLYGIVNHFG-NLISGHYTSLVNKDLKHEIRHGQQKWYYFDDEVVKQDNNHGDFDAGIA 1020
            Y+L G+V H G +   GHYT+ V       +   ++KWY  DD  V + N       G  
Sbjct: 767  YKLTGVVYHHGLSSSGGHYTADV-------LHQDEEKWYRIDDTTVTEINKEEVVTGGEE 819

Query: 1021 SVSSSDVYVLFYER 1034
               S   Y+L Y+R
Sbjct: 820  GSHSRTAYILIYQR 833

>CAGL0I06600g Chr9 (639096..641546) [2451 bp, 816 aa] {ON} similar to
            uniprot|Q01477 Saccharomyces cerevisiae YER151c UBP3
            ubiquitin-specific proteinase
          Length = 816

 Score = 40.8 bits (94), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 37/143 (25%), Positives = 58/143 (40%), Gaps = 35/143 (24%)

Query: 921  MPPILVIHLSRFFY--DLTKKNSTV---------------ITYPLILNI--------VLK 955
            +P IL+I L RF +  +  K N                  I+Y   L I         L+
Sbjct: 681  LPQILLIQLKRFSFISNADKDNGMTNYNAYSGRIEKIRKKISYGHTLEIPDETLASSALR 740

Query: 956  NNEVAKYRLYGIVNHFG-NLISGHYTSLVNKDLKHEIRHGQQK-WYYFDDEVVKQDNNHG 1013
            NN    Y L G++ H G +   GHYT+        ++ H Q K WY  DD  + +  +  
Sbjct: 741  NNSSKTYELSGVIYHHGMSPDGGHYTA--------DVFHKQTKTWYRIDDVNITKLEDDD 792

Query: 1014 DFDAGIASVSSSDVYVLFYERIY 1036
                G  ++ S   Y+L Y+ ++
Sbjct: 793  VLKGGEDNMDSRTAYILMYQNVH 815

>NCAS0A03840 Chr1 (780031..782784) [2754 bp, 917 aa] {ON} Anc_8.202
            YER151C
          Length = 917

 Score = 40.8 bits (94), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 35/141 (24%), Positives = 62/141 (43%), Gaps = 35/141 (24%)

Query: 921  MPPILVIHLSRF-FYDLTKKNSTV----------------------ITYPL--ILNIVLK 955
            +P +L+I L RF F   + K+S +                      +T P+  + +  L+
Sbjct: 783  LPRVLLIQLKRFAFVTNSNKDSNMSNYNAYSGRIEKIRKKIIYGHDLTIPIESVSSTSLR 842

Query: 956  NNEVAKYRLYGIVNHFGNLI-SGHYTSLVNKDLKHEIRHGQ-QKWYYFDDEVVKQDNNHG 1013
            ++   +Y+L G++ H G+    GHYT+        ++ H Q  KWY  DD  + +  N  
Sbjct: 843  DDANREYKLTGVIYHHGSSPDGGHYTA--------DVFHQQTNKWYRIDDVNISELKNDH 894

Query: 1014 DFDAGIASVSSSDVYVLFYER 1034
              DA    + +   Y+L YE+
Sbjct: 895  VLDADDNDMGTRTAYILIYEK 915

>TBLA0B01930 Chr2 (439859..442918) [3060 bp, 1019 aa] {ON} Anc_8.202
            YER151C
          Length = 1019

 Score = 40.8 bits (94), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 38/142 (26%), Positives = 59/142 (41%), Gaps = 35/142 (24%)

Query: 921  MPPILVIHLSRF-FYDLTKKNSTVITYPL-------ILNIVLKNNEVA------------ 960
            +P +L+IHL RF F + T K++++  Y         I   +  N+E+             
Sbjct: 886  LPTVLLIHLKRFSFINNTDKDNSMANYNAYHGRIEKIRKKISYNHELVIPAETITNGKQL 945

Query: 961  -----KYRLYGIVNHFG-NLISGHYTSLVNKDLKHEIRHGQ-QKWYYFDDEVVKQDNNHG 1013
                  Y L G+V H G +   GHYT+        +I H +  KWY  DD  V +     
Sbjct: 946  APENRTYELTGVVYHHGLSSDGGHYTA--------DIYHKEVDKWYRIDDVTVTELEKDD 997

Query: 1014 DFDAGIASVSSSDVYVLFYERI 1035
                G  S  S   Y+L Y+++
Sbjct: 998  VLKGGENSTDSRTAYILMYQKL 1019

>KAFR0K01810 Chr11 (375304..377448) [2145 bp, 714 aa] {ON} Anc_7.390
           YBL067C
          Length = 714

 Score = 40.4 bits (93), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 27/56 (48%), Gaps = 1/56 (1%)

Query: 612 ITGLRNLGSTCYINSMLQCLFATRKFR-DIFLSPKYHDYISKGYIHRAQISRSFHM 666
           I G  N G+TCY NS+LQCLF    FR DI   P+      +   +     R F +
Sbjct: 121 IFGYENFGNTCYCNSILQCLFFLDDFRIDILKHPRKESIDGRKLKYSGNTPRIFTL 176

>TDEL0D02400 Chr4 (467340..467361,467436..468898) [1485 bp, 494 aa]
           {ON} Anc_1.369 YFR010W
          Length = 494

 Score = 40.0 bits (92), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 27/88 (30%), Positives = 39/88 (44%), Gaps = 12/88 (13%)

Query: 614 GLRNLGSTCYINSMLQCLFATRKFRDIFLSPKYH------DYISKGYIHRAQISRSFHML 667
           G +N+G+TCY+N+ LQ L+     RD+ L    +      D   K  +   ++ R F  L
Sbjct: 110 GFQNMGNTCYLNATLQALYRIEPLRDMILDYNQNSTTTPVDETHKKIV--VEMKRCFENL 167

Query: 668 FKKMYMNGGCSVVPSGFLKACNSMRPDF 695
             K Y     SV+P   L A     P F
Sbjct: 168 KSKSYK----SVMPMVLLTALRKCYPQF 191

>NDAI0H03550 Chr8 complement(865851..867359) [1509 bp, 502 aa] {ON}
           Anc_1.369 YFR010W
          Length = 502

 Score = 39.7 bits (91), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 40/89 (44%), Gaps = 11/89 (12%)

Query: 614 GLRNLGSTCYINSMLQCLFATRKFRDIFLSPK----YHDYISKGYIHRA---QISRSFHM 666
           G +N+G+TCY+N+ LQ L+ T   R + L  K       Y  +  +H     +I R F  
Sbjct: 112 GFQNMGNTCYMNATLQALYRTDDIRQMILDYKPPAQSSTYNPEDEMHHKIVLEIKRCFEN 171

Query: 667 LFKKMYMNGGCSVVPSGFLKACNSMRPDF 695
           L KK +     SV+P   L       P F
Sbjct: 172 LEKKNFK----SVMPMMLLTVLRKCYPQF 196

>Skud_5.223 Chr5 (351514..353760) [2247 bp, 748 aa] {ON} YER098W
            (REAL)
          Length = 748

 Score = 40.0 bits (92), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 33/123 (26%), Positives = 54/123 (43%), Gaps = 15/123 (12%)

Query: 921  MPPILVIHLSRFFYDLTKKNS----TVITYPLILNI--VLKNNEVAKYRLYGIVNHFGNL 974
            +P IL +HL RF Y   ++++      I YPL L++     ++   KY L G+V H G+ 
Sbjct: 546  LPYILSLHLKRFEYSEGQQSNIKLFNKILYPLSLDVSSTFDSSISKKYELSGVVIHMGSG 605

Query: 975  IS-GHYTSLVNKDLKHEIRHGQQKWYYFDDEVVKQDNNHGDFDAGIASVSSSDVYVLFYE 1033
               GHY  +         ++ +  W  +DDE V+                 +  YVLFY+
Sbjct: 606  PQHGHYVCIC--------KNEKFGWLLYDDETVESIREETVLKFTGHPGDQTTAYVLFYK 657

Query: 1034 RIY 1036
              +
Sbjct: 658  ETH 660

 Score = 38.9 bits (89), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 40/75 (53%), Gaps = 7/75 (9%)

Query: 609 SLSITGLRNLGSTCYINSMLQCLFATRKFR-DIFLSPKYHDYISKGYIHRAQISRSFHML 667
           S  + G  N G+TCY NS+LQCL+   +FR ++   P+    +S+  I ++ ++ S   +
Sbjct: 122 SNKVFGYENFGNTCYCNSVLQCLYNISEFRCNVLRYPERVPVVSR--IRKSDLNGSKARI 179

Query: 668 FK----KMYMNGGCS 678
           F     +   NGG S
Sbjct: 180 FTNESFEASTNGGNS 194

>Smik_7.314 Chr7 (526664..528163) [1500 bp, 499 aa] {ON} YFR010W
           (REAL)
          Length = 499

 Score = 39.7 bits (91), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 24/99 (24%), Positives = 43/99 (43%), Gaps = 5/99 (5%)

Query: 601 EQSSNVYVSLSITGLRNLGSTCYINSMLQCLFATRKFRDIFLSPKYHDYISKGYIHRAQI 660
           EQ    +  L + G +N+G+TCY+N+ LQ L+     R++ L+      +S   +   + 
Sbjct: 98  EQQVQQFAQLPV-GFKNMGNTCYLNATLQALYRVNDLREMILNYNPSQGVSNNGVQDEET 156

Query: 661 SRSFHMLFKKMYMN----GGCSVVPSGFLKACNSMRPDF 695
            +   +  K+ + N       SV+P   L       P F
Sbjct: 157 HKQIVIEMKRCFENLQNKSFKSVLPIVLLNTLRKCYPQF 195

>TPHA0E01710 Chr5 (343977..347828) [3852 bp, 1283 aa] {ON} Anc_5.443
           YOR124C
          Length = 1283

 Score = 40.0 bits (92), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 16/27 (59%), Positives = 20/27 (74%)

Query: 613 TGLRNLGSTCYINSMLQCLFATRKFRD 639
           TGL N+G+TCY+NS+LQ  FA    RD
Sbjct: 747 TGLNNIGNTCYLNSLLQYYFAISPLRD 773

>Suva_6.83 Chr6 complement(143456..144958) [1503 bp, 500 aa] {ON}
           YFR010W (REAL)
          Length = 500

 Score = 39.7 bits (91), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 38/89 (42%), Gaps = 4/89 (4%)

Query: 611 SITGLRNLGSTCYINSMLQCLFATRKFRDIFLSPKYHDYISKGYIH----RAQISRSFHM 666
           S  G +N+G+TCY+N+ LQ L+     RD+ L+    + +S           QI      
Sbjct: 107 SPVGFKNMGNTCYLNATLQALYRVDDVRDMILNYNPSEGVSSSSAQDEETHKQIVIEMKR 166

Query: 667 LFKKMYMNGGCSVVPSGFLKACNSMRPDF 695
            F+ ++     SV+P   L       P F
Sbjct: 167 CFENLHNKSFKSVLPIVLLNTLRKCYPQF 195

>TBLA0A06470 Chr1 (1588461..1592423) [3963 bp, 1320 aa] {ON}
           Anc_5.443 YOR124C
          Length = 1320

 Score = 40.0 bits (92), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 21/30 (70%)

Query: 613 TGLRNLGSTCYINSMLQCLFATRKFRDIFL 642
            GL N+G+TCY+NS+LQ  F+ +  RD  L
Sbjct: 762 AGLNNIGNTCYLNSLLQYYFSIKPLRDFIL 791

>ZYRO0G01188g Chr7 (95655..95676,95759..97239) [1503 bp, 500 aa]
           {ON} highly similar to uniprot|P43593 Saccharomyces
           cerevisiae YFR010W UBP6 Ubiquitin-specific protease
           situated in the base subcomplex of the 26S proteasome
           releases free ubiquitin from branched polyubiquitin
           chains deletion causes hypersensitivity to cycloheximide
           and other toxic compounds
          Length = 500

 Score = 39.7 bits (91), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 22/30 (73%)

Query: 614 GLRNLGSTCYINSMLQCLFATRKFRDIFLS 643
           G +N+G+TCY+NS LQ L+  +  R++ LS
Sbjct: 109 GFQNMGNTCYLNSTLQALYRIKPLRELILS 138

 Score = 35.4 bits (80), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 25/46 (54%), Gaps = 7/46 (15%)

Query: 962  YRLYGIVNHFG-NLISGHYTSLVNKDLKHEIRHGQQKWYYFDDEVV 1006
            Y L G++ H G N  SGHY S +  D      + + KWY F+D+ V
Sbjct: 431  YELVGVITHQGANSESGHYQSFIRDD------YDEDKWYKFNDDKV 470

>KAFR0C04520 Chr3 complement(901847..903330,903422..903437) [1500
           bp, 499 aa] {ON} Anc_1.369 YFR010W
          Length = 499

 Score = 39.3 bits (90), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 48/110 (43%), Gaps = 11/110 (10%)

Query: 592 HQYISVPTIEQSSNVYVSLSITGLRNLGSTCYINSMLQCLFATRKFRDIFLSPKY---HD 648
           + +I   T EQ    +  + I G +N+G+TCY+N+ LQ L+     RD  L+      +D
Sbjct: 87  NHFIEDLTPEQQVQQFNDIPI-GFKNMGNTCYLNATLQALYRIDDLRDAVLNFDVSINND 145

Query: 649 YISKGYIH---RAQISRSFHMLFKKMYMNGGCSVVPSGFLKACNSMRPDF 695
              +   H     ++ R F  L  K +     SV+P   L A     P F
Sbjct: 146 KNGENETHIKLVTELKRCFEGLKNKSFK----SVMPVVLLNALRKTYPQF 191

>NDAI0E00810 Chr5 complement(163826..165307) [1482 bp, 493 aa] {ON}
            Anc_8.742
          Length = 493

 Score = 39.3 bits (90), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 50/113 (44%), Gaps = 27/113 (23%)

Query: 913  IKTFNFITMPPILVIHLSRFFYDL---TKKNSTVITYPLILNIVL----KNNEVAK---- 961
            IK      + P+LV  L RF + L   T K +  I YPL LN+       NN+  +    
Sbjct: 365  IKQLTLNKLSPLLVFQLKRFEHLLNGTTVKINDFIEYPLYLNMKTYCQSSNNDTEEEESN 424

Query: 962  --------YRLYGIVNHFGNLISGHYTSLVNKDLKHEIRHGQQKWYYFDDEVV 1006
                    Y L  I++H G +  GHY  +V      ++  GQ  W+ F+D +V
Sbjct: 425  SENVPDMIYELTSIISHKGTVNEGHYIVVV------KVNDGQ--WFKFNDSMV 469

>KNAG0C01940 Chr3 complement(375973..377472) [1500 bp, 499 aa] {ON}
           Anc_1.369 YFR010W
          Length = 499

 Score = 39.3 bits (90), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 44/88 (50%), Gaps = 10/88 (11%)

Query: 614 GLRNLGSTCYINSMLQCLFATRKFRDIFLS--PK-YHDYISKGYIHRA---QISRSFHML 667
           G +N+G+TCY+N+ LQ LF   + R++ L+  PK + +   +  +H     ++   F  L
Sbjct: 109 GFKNMGNTCYLNATLQSLFRMDQLRELILNYDPKAFTNLNPQDEMHHKLILELKHCFESL 168

Query: 668 FKKMYMNGGCSVVPSGFLKACNSMRPDF 695
            +K Y     SV+P   +     + P F
Sbjct: 169 KQKNYQ----SVLPIVLINVLRKVYPQF 192

>KLLA0F18700g Chr6 (1718738..1721050) [2313 bp, 770 aa] {ON} similar
            to uniprot|P38237 YBR058C Saccharomyces cerevisiae UBP14
            Ubiquitin-specific protease that specifically
            disassembles unanchored ubiquitin chains
          Length = 770

 Score = 39.3 bits (90), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 34/58 (58%), Gaps = 6/58 (10%)

Query: 960  AKYRLYGIVNHFGNLI-SGHYTSLVNKDLKHEIRHGQQKWYYFDDEVVKQDNNHGDFD 1016
            AKY+L  ++ H GN + SGHY + + K     +  G+++W  ++DE +   N+  +F+
Sbjct: 703  AKYKLTAVICHKGNSVHSGHYVAFIKK-----VVEGKEQWVLYNDEKILLANDEPNFE 755

>SAKL0G02728g Chr7 complement(223607..227320) [3714 bp, 1237 aa]
           {ON} similar to uniprot|Q01476 Saccharomyces cerevisiae
           YOR124C UBP2 Ubiquitin-specific protease that removes
           ubiquitin from ubiquitinated proteins cleaves at the C
           terminus of ubiquitin fusions capable of cleaving
           polyubiquitin and possesses isopeptidase activity
          Length = 1237

 Score = 39.3 bits (90), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 22/31 (70%)

Query: 613 TGLRNLGSTCYINSMLQCLFATRKFRDIFLS 643
           TGL N+G+TCY+NS+LQ  F+    RD  L+
Sbjct: 701 TGLNNIGNTCYLNSLLQYYFSISPLRDYVLN 731

>Skud_6.94 Chr6 complement(173619..175118) [1500 bp, 499 aa] {ON}
           YFR010W (REAL)
          Length = 499

 Score = 38.9 bits (89), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 22/87 (25%), Positives = 37/87 (42%), Gaps = 4/87 (4%)

Query: 613 TGLRNLGSTCYINSMLQCLFATRKFRDIFLSPKYHDYISKGYIHRAQISRSFHMLFKKMY 672
            G +N+G+TCY+N+ LQ L+     RD+ L+       S   +   +  +   +  K+ +
Sbjct: 109 VGFKNMGNTCYLNATLQALYRVDDLRDMILNYNPSQEASNSGVQDEETHKQIIIEMKRCF 168

Query: 673 MN----GGCSVVPSGFLKACNSMRPDF 695
            N       SV+P   L       P F
Sbjct: 169 ENLQNKSFKSVLPIVLLNTLRKCYPQF 195

>KLLA0E02377g Chr5 complement(218647..222309) [3663 bp, 1220 aa]
           {ON} uniprot|O42726 Kluyveromyces lactis UBP2 Ubiquitin
           carboxyl-terminal hydrolase 2
          Length = 1220

 Score = 39.3 bits (90), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 21/31 (67%)

Query: 613 TGLRNLGSTCYINSMLQCLFATRKFRDIFLS 643
            G+ N+G+TCY+NS+LQ  F  +  RD  L+
Sbjct: 698 AGINNVGNTCYLNSLLQFFFTIKPLRDFILN 728

>CAGL0A04477g Chr1 (442089..444401) [2313 bp, 770 aa] {ON} similar
           to uniprot|P38187 Saccharomyces cerevisiae YBL067c UBP13
           or uniprot|P39967 Saccharomyces cerevisiae YER098w UBP9
           ubiquitin carboxyl-terminal hydrolase
          Length = 770

 Score = 39.3 bits (90), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 21/31 (67%)

Query: 612 ITGLRNLGSTCYINSMLQCLFATRKFRDIFL 642
           I G  N G+TCY NS+LQCL+   +FR+  L
Sbjct: 149 IFGYENFGNTCYCNSVLQCLYNLPEFRNDML 179

>Kpol_1018.93 s1018 (248094..250361) [2268 bp, 755 aa] {ON}
           (248094..250361) [2268 nt, 756 aa]
          Length = 755

 Score = 38.9 bits (89), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 24/38 (63%), Gaps = 1/38 (2%)

Query: 609 SLSITGLRNLGSTCYINSMLQCLFATRKFRD-IFLSPK 645
           S  + G  N G+TCY NS+LQCL+   + RD + L P+
Sbjct: 123 STKVFGFENFGNTCYCNSVLQCLYNFSELRDNLILYPE 160

 Score = 38.1 bits (87), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 36/123 (29%), Positives = 54/123 (43%), Gaps = 17/123 (13%)

Query: 921  MPPILVIHLSRFFYDLTKKNSTV-----ITYPLILNI--VLKNNEVAKYRLYGIVNHFG- 972
            +P IL +HL RF Y   + N+ +     ITYP  L++      +   KY L GI+ H G 
Sbjct: 549  LPKILSLHLKRFKYS-EENNANIKLFNKITYPSELHVRSTFDRSISKKYELSGIIIHLGA 607

Query: 973  NLISGHYTSLVNKDLKHEIRHGQQKWYYFDDEVVKQDNNHGDFDAGIASVSSSDVYVLFY 1032
                GHY ++   +     + G   W  +DDE V+             S   +  Y+LFY
Sbjct: 608  GPQHGHYVAMCKTE-----KFG---WLLYDDETVEAVLEKDVLRHVGDSNDLATAYILFY 659

Query: 1033 ERI 1035
            + I
Sbjct: 660  KTI 662

>TDEL0C01570 Chr3 complement(269169..271466) [2298 bp, 765 aa] {ON}
           Anc_7.390 YBL067C
          Length = 765

 Score = 38.9 bits (89), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 21/31 (67%)

Query: 612 ITGLRNLGSTCYINSMLQCLFATRKFRDIFL 642
           + G  N G+TCY NS+LQCL+   +FR + L
Sbjct: 123 VFGYENFGNTCYCNSVLQCLYNLTEFRLLLL 153

>Kpol_1064.48 s1064 (88495..89895) [1401 bp, 466 aa] {ON}
            (88495..89895) [1401 nt, 467 aa]
          Length = 466

 Score = 38.9 bits (89), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 30/99 (30%), Positives = 49/99 (49%), Gaps = 21/99 (21%)

Query: 921  MPPILVIHLSRFFYDLTK---KNSTVITYPLILN------IVLKNNEVAK----YRLYGI 967
            + P+L+    RF + L+    K + VI +PL LN      +  +++  +K    Y L GI
Sbjct: 352  LSPVLLFQFKRFEHLLSGSSIKLNDVIEFPLYLNMKDYCDVEQRDDSNSKPDLIYELIGI 411

Query: 968  VNHFGNLISGHYTSLVNKDLKHEIRHGQQKWYYFDDEVV 1006
            + H G +  GHYT++       +I  GQ  W  F+D +V
Sbjct: 412  ICHTGTVNEGHYTAIC------KIPEGQ--WIKFNDSMV 442

 Score = 33.5 bits (75), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 11/21 (52%), Positives = 18/21 (85%)

Query: 611 SITGLRNLGSTCYINSMLQCL 631
            ++GL N+GSTCY++ ++QCL
Sbjct: 135 GLSGLVNMGSTCYVSCIIQCL 155

>ZYRO0B11044g Chr2 complement(869260..871740) [2481 bp, 826 aa] {ON}
            similar to uniprot|Q01477 Saccharomyces cerevisiae
            YER151C UBP3 Ubiquitin-specific protease that interacts
            with Bre5p to co-regulate anterograde and retrograde
            transport between endoplasmic reticulum and Golgi
            compartments inhibitor of gene silencing cleaves
            ubiquitin fusions but not polyubiquitin
          Length = 826

 Score = 38.9 bits (89), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 37/141 (26%), Positives = 59/141 (41%), Gaps = 33/141 (23%)

Query: 921  MPPILVIHLSRF-FYDLTKKNSTVITY------------------PLILNIV------LK 955
            +P +L+I L RF F + T K+++++ Y                   LI+ I         
Sbjct: 693  LPQVLLIQLKRFQFINNTDKDNSMVNYNAYNGRIEKIRKKINYEHELIIPIESISSANAY 752

Query: 956  NNEVAKYRLYGIVNHFG-NLISGHYTSLVNKDLKHEIRHGQQKWYYFDDEVVKQDNNHGD 1014
             +E  +Y L G++ H G +   GHYT+    D+ H       KWY  DD  + +      
Sbjct: 753  KDENRRYHLTGVIYHHGVSSDGGHYTA----DVYH---RESDKWYRIDDVSIIELEKEDV 805

Query: 1015 FDAGIASVSSSDVYVLFYERI 1035
               G  S  S   Y+L Y++I
Sbjct: 806  LKGGEESGDSRTAYILMYQKI 826

>YPL072W Chr16 (418512..420011) [1500 bp, 499 aa] {ON}
            UBP16Deubiquitinating enzyme anchored to the outer
            mitochondrial membrane, probably not important for
            general mitochondrial functioning, but may perform a more
            specialized function at mitochondria
          Length = 499

 Score = 38.9 bits (89), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 46/170 (27%), Positives = 68/170 (40%), Gaps = 50/170 (29%)

Query: 913  IKTFNFITMPPILVIHLSR-FFYDLT----------KKNSTVITYPLILNIVLKNNEVAK 961
            IK    + +P IL++HLSR  F  +T           +  T+  Y L  +  +  N   K
Sbjct: 331  IKKDVVVQLPDILIVHLSRSTFNGITYSRNPCNVKFGERITLSEYTLAESGTITENRQVK 390

Query: 962  YRLYGIVNHFGNLISGHYTSLVNKDLKHEIRHGQQKWYYF------DDEVVK---QDNNH 1012
            Y L  +V H G+  SGHY     K    EIR G++    F      ++EV K   Q+  H
Sbjct: 391  YNLKSVVKHTGSHSSGHYMCYRRKT---EIRFGKEDESSFRRAPVVNNEVNKNREQNVAH 447

Query: 1013 GDF--------------------DAGIASVSSSDV-------YVLFYERI 1035
             D+                    D  I   ++S V       Y+L+YER+
Sbjct: 448  NDYKKSRYKKVKNALRYPYWQISDTAIKESTASTVLNEQKYAYMLYYERV 497

>KAFR0L01730 Chr12 (316860..318965) [2106 bp, 701 aa] {ON} Anc_7.390
           YBL067C
          Length = 701

 Score = 38.5 bits (88), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 17/32 (53%), Positives = 19/32 (59%)

Query: 612 ITGLRNLGSTCYINSMLQCLFATRKFRDIFLS 643
           I G  N G+TCY NS+LQC F    FR   LS
Sbjct: 126 IFGYENFGNTCYCNSILQCFFNHSVFRTSMLS 157

>KLLA0E20351g Chr5 (1810593..1812686) [2094 bp, 697 aa] {ON} similar
           to uniprot|P39967 Saccharomyces cerevisiae YER098W UBP9
           Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 697

 Score = 38.5 bits (88), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 21/34 (61%)

Query: 609 SLSITGLRNLGSTCYINSMLQCLFATRKFRDIFL 642
           S  + G  N G+TCY NS+LQCL+   +FR   L
Sbjct: 111 STKVFGYENFGNTCYCNSVLQCLYNLTEFRTEIL 144

 Score = 33.9 bits (76), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 42/146 (28%), Positives = 60/146 (41%), Gaps = 19/146 (13%)

Query: 899  MPGSEKWKSKKLTTI----KTFNFITMPPILVIHLSRFFY----DLTKKNSTVITYPLIL 950
            + G+ K+   K   +    +T    ++P  L IHL RF Y    +   K    I YPL L
Sbjct: 491  LTGANKFYCDKCCGLQEAERTVGLKSLPKTLAIHLKRFKYSEARNCNAKLFNRIHYPLDL 550

Query: 951  NIVLK-NNEVAK-YRLYGIV-NHFGNLISGHYTSLVNKDLKHEIRHGQQKWYYFDDEVVK 1007
             +    ++ V K Y L GIV +  G    GHY ++   DL          W  FDDE V+
Sbjct: 551  RVCSSFDSAVCKDYELNGIVIHMGGGPHHGHYVAICKNDL--------FGWLLFDDETVE 602

Query: 1008 QDNNHGDFDAGIASVSSSDVYVLFYE 1033
              N          +   +  YVL Y+
Sbjct: 603  SINEETVLKFIGDANELTTAYVLIYK 628

>ZYRO0D03982g Chr4 (324687..327152) [2466 bp, 821 aa] {ON} weakly
           similar to uniprot|Q02863 Saccharomyces cerevisiae
           YPL072W UBP16 Putative ubiquitin-specific protease
          Length = 821

 Score = 38.5 bits (88), Expect = 0.100,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 39/81 (48%), Gaps = 10/81 (12%)

Query: 909 KLTTIKTFNFITMPPILVIHLSRFFYDLTK--KNSTVITYPLILNI---VLKNNEV---- 959
           K T +K    +  P +L+IHLSR  ++ T   +N   + +  IL +   V++N+      
Sbjct: 457 KSTIVKKNVVVDAPQVLLIHLSRSMFNGTNYTRNPCAVNFDEILQLQEQVIQNDRCVGIN 516

Query: 960 -AKYRLYGIVNHFGNLISGHY 979
              Y L  IV H G+   GHY
Sbjct: 517 SVNYELKAIVKHAGSHSQGHY 537

>Skud_15.286 Chr15 complement(511346..515182) [3837 bp, 1278 aa]
           {ON} YOR124C (REAL)
          Length = 1278

 Score = 38.5 bits (88), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 35/71 (49%), Gaps = 14/71 (19%)

Query: 613 TGLRNLGSTCYINSMLQCLFATRKFRDIFLS-----PKYHDYISKG---------YIHRA 658
           TG+ N+G+TCY+NS+LQ  F+    R   L        ++D++S            I R 
Sbjct: 736 TGINNIGNTCYLNSLLQYYFSIAPLRRYILEYQKTLDNFNDHLSNSGHVRRIGGREISRG 795

Query: 659 QISRSFHMLFK 669
           ++ RS   +++
Sbjct: 796 EVERSIQFIYQ 806

>SAKL0H18656g Chr8 (1658629..1660947) [2319 bp, 772 aa] {ON} some
            similarities with uniprot|Q01477 Saccharomyces cerevisiae
            YER151C UBP3 Ubiquitin-specific protease that interacts
            with Bre5p to co-regulate anterograde and retrograde
            transport between endoplasmic reticulum and Golgi
            compartments inhibitor of gene silencing cleaves
            ubiquitin fusions but not polyubiquitin
          Length = 772

 Score = 38.5 bits (88), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 36/76 (47%), Gaps = 8/76 (10%)

Query: 961  KYRLYGIVNHFGNLISG-HYTSLVNKDLKHEIRHGQQKWYYFDDEVVKQDNNHGDFDAGI 1019
            KY+L G+V H G   SG HYT+    D+ H+      KW+  DD  + + N       G 
Sbjct: 704  KYKLVGVVYHHGVSPSGGHYTA----DVYHQ---EMDKWFRIDDVNIAELNKEEVLKGGE 756

Query: 1020 ASVSSSDVYVLFYERI 1035
                S   Y+L Y++I
Sbjct: 757  DGFDSRTAYILMYQKI 772

>TPHA0A02510 Chr1 (536076..536097,536233..537728) [1518 bp, 505 aa]
           {ON} Anc_1.369 YFR010W
          Length = 505

 Score = 38.1 bits (87), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 22/32 (68%)

Query: 614 GLRNLGSTCYINSMLQCLFATRKFRDIFLSPK 645
           G +N+G+TCY+NS LQ LF     +D+ L+ K
Sbjct: 110 GFQNMGNTCYMNSTLQALFRVDVLKDMILNYK 141

 Score = 33.5 bits (75), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 26/48 (54%), Gaps = 7/48 (14%)

Query: 962  YRLYGIVNHFG-NLISGHYTSLVNKDLKHEIRHGQQKWYYFDDEVVKQ 1008
            Y L GI+ H G N  SGHY S +  +      + + KWY F+D+ V +
Sbjct: 436  YDLIGIITHQGANSESGHYQSFIRDE------NDEDKWYKFNDDKVSE 477

>KLLA0A10791g Chr1 complement(934135..935573,935718..935733) [1455
           bp, 484 aa] {ON} similar to uniprot|P43593 Saccharomyces
           cerevisiae YFR010W UBP6 Ubiquitin-specific protease
           situated in the base subcomplex of the 26S proteasome
           releases free ubiquitin from branched polyubiquitin
           chains deletion causes hypersensitivity to cycloheximide
           and other toxic compounds
          Length = 484

 Score = 38.1 bits (87), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 21/30 (70%)

Query: 614 GLRNLGSTCYINSMLQCLFATRKFRDIFLS 643
           GLRN+G+TCY N+ LQ L+  +  R+  L+
Sbjct: 107 GLRNMGNTCYFNASLQALYRIKPLREKVLA 136

>YOR124C Chr15 complement(554824..558642) [3819 bp, 1272 aa] {ON}
           UBP2Ubiquitin-specific protease that removes ubiquitin
           from ubiquitinated proteins; interacts with Rsp5p and is
           required for MVB sorting of membrane proteins; can
           cleave polyubiquitin and has isopeptidase activity
          Length = 1272

 Score = 38.5 bits (88), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 37/71 (52%), Gaps = 14/71 (19%)

Query: 613 TGLRNLGSTCYINSMLQCLFATRKFRDIFLS-----PKYHDYISK-GYIH--------RA 658
           TG+ N+G+TCY+NS+LQ  F+    R   L        ++D++S  G+I         R 
Sbjct: 736 TGINNIGNTCYLNSLLQYYFSIAPLRRYVLEYQKTVENFNDHLSNSGHIRRIGGREISRG 795

Query: 659 QISRSFHMLFK 669
           ++ RS   +++
Sbjct: 796 EVERSIQFIYQ 806

>TPHA0J02620 Chr10 complement(580898..584575) [3678 bp, 1225 aa]
           {ON} Anc_5.443 YOR124C
          Length = 1225

 Score = 38.5 bits (88), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 21/27 (77%)

Query: 613 TGLRNLGSTCYINSMLQCLFATRKFRD 639
           TG+ N+G+TCY+NS+LQ  F+   FR+
Sbjct: 758 TGINNIGNTCYLNSLLQYYFSITLFRE 784

>AGR370W Chr7 (1416579..1418801) [2223 bp, 740 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YER098W (UBP9) and
           YBL067C (UBP13)
          Length = 740

 Score = 38.1 bits (87), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 20/27 (74%)

Query: 612 ITGLRNLGSTCYINSMLQCLFATRKFR 638
           + GL N G+TCY NS+LQCL+  ++ R
Sbjct: 98  VFGLENYGNTCYCNSVLQCLYNLKELR 124

 Score = 37.4 bits (85), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 38/75 (50%), Gaps = 8/75 (10%)

Query: 763 IDSIFQGQMENCLQCQRCGHSSYNYSTFYVLSLAIPTPGTSTFGKTKKVLLEDCINLFTS 822
           I ++FQG M N ++C  C + + N   F+    AIP        + +++ ++D +  F  
Sbjct: 464 IHTLFQGTMNNSIKCLTCDNITSNEEPFF--DFAIPV------SEDEELNVQDILRDFHQ 515

Query: 823 DEVLSGENAWDCPRC 837
            E+L+G N + C  C
Sbjct: 516 REMLNGANKFYCDSC 530

>NDAI0C01550 Chr3 (327953..331840) [3888 bp, 1295 aa] {ON} Anc_5.443
           YOR124C
          Length = 1295

 Score = 38.1 bits (87), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 25/39 (64%), Gaps = 2/39 (5%)

Query: 613 TGLRNLGSTCYINSMLQCLFATRKFRDIFL--SPKYHDY 649
           TG+ N+G+TCY+NS+LQ  F+    R+  L  S  Y D+
Sbjct: 752 TGINNIGNTCYLNSLLQYYFSISPLREYVLGYSKTYEDF 790

>NDAI0A07410 Chr1 complement(1691853..1694285) [2433 bp, 810 aa]
           {ON} Anc_3.270
          Length = 810

 Score = 38.1 bits (87), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 52/234 (22%), Positives = 90/234 (38%), Gaps = 53/234 (22%)

Query: 613 TGLRNLGSTCYINSMLQCLF--ATRKFRDIFLSPKYHDYISKGYIH-----RAQISRSFH 665
            GL NLG++CY+NS++QCL       + D   +   HD+  K  I+     R Q+ +  +
Sbjct: 342 CGLINLGNSCYLNSVMQCLLNGGVPNWSDKLGNIIGHDF-PKDVIYPTGNLRCQMIKLLN 400

Query: 666 M--LFKKMYMNGGCSVVPSGFLKACNSMRPDFKIPNXXXXXXXXXXXXXXXXXXXXSDPE 723
              L  + Y  G   + P  F +       +FK  N                       +
Sbjct: 401 AFKLNPEDYEEG---IRPRSFKECVGKHNAEFKTNN-----------------------Q 434

Query: 724 QVANDYPQLLLHDDDNLQVDGKEYDKWFEDSISKNGLSPIDSIFQGQMENCLQCQRCGHS 783
           Q + ++          L    +E +K     I    ++P +++ +  ME+ LQC  C + 
Sbjct: 435 QDSMEF----------LTFVTEELEKGLFPKIQDASINP-NNLLKFIMEDKLQCVECKNV 483

Query: 784 SYNYSTFYVLSLAIPTPGTSTFGKTKKVLLEDCINLFTSDEVLSGENAWDCPRC 837
            Y Y     + L +   G    G T + L+E   + F  +E+      + CP C
Sbjct: 484 KYTYQPNECIQLPL-KEGNDLVGTTTQNLMELITDYFQGEEI-----EFSCPTC 531

>Kwal_55.21393 s55 (816177..819878) [3702 bp, 1233 aa] {ON} YOR124C
           (UBP2) - Ubiquitin-specific protease [contig 130] FULL
          Length = 1233

 Score = 38.1 bits (87), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 31/60 (51%), Gaps = 9/60 (15%)

Query: 613 TGLRNLGSTCYINSMLQCLFATRKFRDIFLS-----PKYHDYI----SKGYIHRAQISRS 663
           TGL N+G+TCY+NS+LQ  F     R   +       ++HD I    SK  I   ++S S
Sbjct: 703 TGLNNIGNTCYLNSLLQYYFCISPLRQFIVDYQKTLAEFHDSIGNLGSKRRIGGREVSES 762

>TDEL0A01620 Chr1 (291670..294057) [2388 bp, 795 aa] {ON} Anc_8.202
            YER151C
          Length = 795

 Score = 37.7 bits (86), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 36/140 (25%), Positives = 59/140 (42%), Gaps = 33/140 (23%)

Query: 921  MPPILVIHLSRF-FYDLTKKNSTVITY----------------------PL--ILNIVLK 955
            +P +L+I L RF F + T K++++I Y                      P+  I +    
Sbjct: 662  LPQVLLIQLKRFQFINNTDKDNSMINYNAYNGRIEKIRKKINYEHELMIPIESISSTNAL 721

Query: 956  NNEVAKYRLYGIVNHFG-NLISGHYTSLVNKDLKHEIRHGQQKWYYFDDEVVKQDNNHGD 1014
             +E  +Y L G++ H G +   GHYT+    D+ H+      KWY  DD  + +      
Sbjct: 722  RDEDRQYSLSGVIYHHGLSSDGGHYTA----DVYHK---ETDKWYRIDDINITEVQKDSV 774

Query: 1015 FDAGIASVSSSDVYVLFYER 1034
               G   V S   Y+L Y++
Sbjct: 775  LKGGEDGVDSRTAYILMYQK 794

>Ecym_4514 Chr4 complement(1025172..1028912) [3741 bp, 1246 aa] {ON}
           similar to Ashbya gossypii ACL164C
          Length = 1246

 Score = 37.7 bits (86), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 15/27 (55%), Positives = 19/27 (70%)

Query: 613 TGLRNLGSTCYINSMLQCLFATRKFRD 639
           TGL N+G+TCY+NS+LQ  F     RD
Sbjct: 696 TGLNNIGNTCYLNSLLQYYFTISPLRD 722

>YER151C Chr5 complement(469686..472424) [2739 bp, 912 aa] {ON}
            UBP3Ubiquitin-specific protease involved in transport and
            osmotic response; interacts with Bre5p to co-regulate
            anterograde and retrograde transport between the ER and
            Golgi; involved in transcription elongation in response
            to osmostress through phosphorylation at Ser695 by Hog1p;
            inhibitor of gene silencing; cleaves ubiquitin fusions
            but not polyubiquitin; also has mRNA binding activity
          Length = 912

 Score = 37.7 bits (86), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 35/145 (24%), Positives = 60/145 (41%), Gaps = 39/145 (26%)

Query: 921  MPPILVIHLSRF-FYDLTKKNSTVITY------------------PLIL------NIVLK 955
            +P +L+I   RF F +   K++ +  Y                   LI+      +I LK
Sbjct: 774  LPQVLLIQFKRFSFINNVNKDNAMTNYNAYNGRIEKIRKKIKYGHELIIPEESMSSITLK 833

Query: 956  NNEVA----KYRLYGIVNHFG-NLISGHYTSLVNKDLKHEIRHGQ-QKWYYFDDEVVKQD 1009
            NN       +Y+L G++ H G +   GHYT+        ++ H +  KWY  DD  + + 
Sbjct: 834  NNTSGIDDRRYKLTGVIYHHGVSSDGGHYTA--------DVYHSEHNKWYRIDDVNITEL 885

Query: 1010 NNHGDFDAGIASVSSSDVYVLFYER 1034
             +      G  +  S   Y+L Y++
Sbjct: 886  EDDDVLKGGEEASDSRTAYILMYQK 910

>CAGL0K10252g Chr11 complement(998144..1001947) [3804 bp, 1267 aa]
           {ON} similar to uniprot|Q01476 Saccharomyces cerevisiae
           YOR124c UBP2 ubiquitin-specific proteinase
          Length = 1267

 Score = 37.7 bits (86), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 20/27 (74%)

Query: 613 TGLRNLGSTCYINSMLQCLFATRKFRD 639
           TG+ N+G+TCY+NS+LQ  FA    R+
Sbjct: 722 TGINNIGNTCYLNSLLQFYFAISPLRE 748

>Smik_15.301 Chr15 complement(515941..519759) [3819 bp, 1272 aa]
           {ON} YOR124C (REAL)
          Length = 1272

 Score = 37.7 bits (86), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 37/71 (52%), Gaps = 14/71 (19%)

Query: 613 TGLRNLGSTCYINSMLQCLFATRKFRDIFLS-----PKYHDYISK-GYIHR--------A 658
           TG+ N+G+TCY+NS+LQ  F+    R   L        ++D++S  G++ R         
Sbjct: 735 TGINNIGNTCYLNSLLQYYFSIAPLRRYILDYQKTVENFNDHLSNSGHVRRIGGRKISKG 794

Query: 659 QISRSFHMLFK 669
           ++ RS   +++
Sbjct: 795 EVERSVQFIYQ 805

>ZYRO0F01276g Chr6 (102883..105213) [2331 bp, 776 aa] {ON} similar
           to uniprot|P38237 YBR058C Saccharomyces cerevisiae UBP14
           Ubiquitin-specific protease that specifically
           disassembles unanchored ubiquitin chains
          Length = 776

 Score = 37.4 bits (85), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 14/20 (70%), Positives = 18/20 (90%)

Query: 613 TGLRNLGSTCYINSMLQCLF 632
            GL NLG++CY+NS+LQCLF
Sbjct: 323 CGLINLGNSCYLNSVLQCLF 342

 Score = 36.2 bits (82), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 27/48 (56%), Gaps = 6/48 (12%)

Query: 960  AKYRLYGIVNHFGNLI-SGHYTSLVNKDLKHEIRHGQQKWYYFDDEVV 1006
            A Y L GIV H GN + SGHY + +      +I   ++KW  ++DE +
Sbjct: 711  APYELTGIVCHKGNSVHSGHYVAFI-----RQIVENEKKWVLYNDEKI 753

 Score = 32.0 bits (71), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 39/89 (43%), Gaps = 12/89 (13%)

Query: 751 FEDSISKNGLSPIDSIFQGQMENCLQCQRCGHSSYNYSTFYVLSLAIPTPGTSTFGKTKK 810
            +  I KNG +P D + +  ME+ LQC  CG     YS+    SL +P P  +      +
Sbjct: 426 LDKKIFKNGSNPND-LMKFTMEDRLQCTNCG--KVKYSSEAAESLQLPMPENN----DPQ 478

Query: 811 VLLEDCINLFTSDEVLSGENAWDCPRCGT 839
            L+      F  +EV      + CP C T
Sbjct: 479 DLVHIIAQYFNGEEV-----EFTCPHCKT 502

>Suva_5.217 Chr5 (329688..331952) [2265 bp, 754 aa] {ON} YER098W
           (REAL)
          Length = 754

 Score = 37.4 bits (85), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 19/27 (70%)

Query: 612 ITGLRNLGSTCYINSMLQCLFATRKFR 638
           + G  N G+TCY NS+LQCL+   +FR
Sbjct: 135 VFGYENFGNTCYCNSVLQCLYNIPEFR 161

>SAKL0F12430g Chr6 (969369..971633) [2265 bp, 754 aa] {ON} similar
           to uniprot|P39967 Saccharomyces cerevisiae YER098W UBP9
           Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 754

 Score = 37.4 bits (85), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 19/27 (70%)

Query: 612 ITGLRNLGSTCYINSMLQCLFATRKFR 638
           + G  N G+TCY NS+LQCL+   +FR
Sbjct: 145 VFGYENFGNTCYCNSVLQCLYNLTEFR 171

 Score = 37.0 bits (84), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 44/151 (29%), Positives = 70/151 (46%), Gaps = 25/151 (16%)

Query: 899  MPGSEKWKSKKLTTIKTFNFIT----MPPILVIHLSRFFYDLTKKNSTV-----ITYPLI 949
            + GS K+   K   ++    I     +P IL +HL RF Y  T +N  +     I YPL 
Sbjct: 532  LNGSNKFYCDKCCGLQEAERIVGLKQLPHILALHLKRFKYSET-QNCNIKLFNKIRYPLY 590

Query: 950  LNIV--LKNNEVAKYRLYGI-VNHFGNLISGHYTSLVNKDLKHEIRHGQQKWYYFDDEVV 1006
            L +     ++   +Y L GI V+  G    GHY SL         ++ +  W  FDDE V
Sbjct: 591  LKVCSTFDSSICKRYELTGIVVHMGGGPHHGHYVSLC--------KNEKFGWLLFDDETV 642

Query: 1007 KQ--DNNHGDFDAGIASVSSSDVYVLFYERI 1035
            +   +++   F   +  ++++  YVLFY+ I
Sbjct: 643  ESVDESSVMKFCGDLHDLTTA--YVLFYKEI 671

>Kwal_26.9598 s26 complement(1283781..1287356) [3576 bp, 1191 aa]
           {ON} YMR304W (UBP15) - putative deubiquitinating enzyme
           [contig 363] FULL
          Length = 1191

 Score = 37.4 bits (85), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 20/27 (74%)

Query: 614 GLRNLGSTCYINSMLQCLFATRKFRDI 640
           G +N G+TCY+NS+LQ  F T+ FR +
Sbjct: 203 GFKNQGATCYLNSLLQSYFFTKLFRKM 229

 Score = 37.0 bits (84), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 27/115 (23%), Positives = 51/115 (44%), Gaps = 19/115 (16%)

Query: 918  FITMPPILVIHLSRFFYDLTKKNSTVIT----YPLILNIV------LKNN--EVAKYRLY 965
            F + PP+L + L RF YD        I     +P  +++       +K+N      Y L+
Sbjct: 383  FESFPPVLHLQLKRFEYDFNYDQLVKINDRHEFPESIDLSPYLDPDVKDNYPNTCIYNLH 442

Query: 966  GIVNHFGNLISGHYTSLVNKDLKHEIRHGQQKWYYFDDEVVKQDNNHGDFDAGIA 1020
             ++ H G++ +GHY +++  ++         +W+ FDD+ V +      FD    
Sbjct: 443  CVLVHSGDISAGHYYAMIKPNV-------TDQWFRFDDDKVWKVTKTQAFDENFG 490

>NCAS0I01620 Chr9 complement(299269..301656) [2388 bp, 795 aa] {ON}
            Anc_3.270 YBR058C
          Length = 795

 Score = 37.4 bits (85), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 38/84 (45%), Gaps = 14/84 (16%)

Query: 952  IVLKNNEVAKYRLYGIVNHFGNLI-SGHYTSLVNKDLKHEIRHGQQKWYYFDDEVVKQDN 1010
            I+  N +   YRL  +V H GN   SGHY + + K +  E+     KW  ++DE +   +
Sbjct: 724  IIYGNLDAKPYRLTAVVCHKGNSAHSGHYVAFIRKMIDDEL-----KWVLYNDEKIVVSD 778

Query: 1011 NHGDFDAGIASVSSSDVYVLFYER 1034
            N  +           D Y+ FY R
Sbjct: 779  NIDEI--------KKDGYIYFYSR 794

 Score = 37.0 bits (84), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 29/100 (29%), Positives = 47/100 (47%), Gaps = 15/100 (15%)

Query: 764 DSIFQGQMENCLQCQRCGHSSYNYS-TFYVLSLAIPTPGTSTFGKTKKVLLEDCINLFTS 822
           ++I +  ME+ +QCQ CG+  Y+Y  T Y+    +P  GT+      + L+E   N F  
Sbjct: 451 NNIMKFIMEDKIQCQSCGNVKYSYEPTEYI---QLPLDGTN----NPQNLVETLTNFF-- 501

Query: 823 DEVLSGENA-WDCPRCGTSMSGSGPGEGKAKKKRKFLLPH 861
               +GEN  +DCP C  ++  +     K       + PH
Sbjct: 502 ----NGENIDFDCPTCKKTVVATKRQRFKTSPNTLVISPH 537

 Score = 35.8 bits (81), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 13/19 (68%), Positives = 17/19 (89%)

Query: 614 GLRNLGSTCYINSMLQCLF 632
           G  NLG++CY+NS+LQCLF
Sbjct: 334 GFINLGNSCYLNSVLQCLF 352

>Kpol_1024.44 s1024 (118060..119550) [1491 bp, 496 aa] {ON}
           (118060..119550) [1491 nt, 497 aa]
          Length = 496

 Score = 37.0 bits (84), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 40/82 (48%), Gaps = 11/82 (13%)

Query: 909 KLTTIKTFNFITMPPILVIHLSRFFYD--LTKKNSTVITYPLILNIVLKNN--------- 957
           K T IK  + I  P IL+IHLSR  Y+  +  +NS  + +   ++I  +           
Sbjct: 331 KSTIIKKNSIIETPKILMIHLSRSIYNGMVAVRNSCRVRFEEKMSIERQTTDEKNENLKI 390

Query: 958 EVAKYRLYGIVNHFGNLISGHY 979
           E+  Y+L  I+ H G   SGHY
Sbjct: 391 ELVDYQLQSIIKHTGTHNSGHY 412

 Score = 32.3 bits (72), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 36/77 (46%), Gaps = 6/77 (7%)

Query: 723 EQVANDYPQLLLHDDDNLQVDGKEYDKWFEDSISKNGLSPIDSIFQGQMENCLQCQRCGH 782
           +Q AN+  Q++L    N     K+Y    E SI           F+G++ + L C  CG 
Sbjct: 170 QQDANELTQIVLEVLQNELESLKKYVNRMELSIEVPRFP-----FEGKLASYLSCLNCGQ 224

Query: 783 SSY-NYSTFYVLSLAIP 798
           +S  N STF +L +  P
Sbjct: 225 TSIPNISTFNILPIQTP 241

>ZYRO0G01606g Chr7 complement(123893..127810) [3918 bp, 1305 aa]
           {ON} similar to uniprot|Q01476 Saccharomyces cerevisiae
           YOR124C UBP2 Ubiquitin-specific protease that removes
           ubiquitin from ubiquitinated proteins cleaves at the C
           terminus of ubiquitin fusions capable of cleaving
           polyubiquitin and possesses isopeptidase activity
          Length = 1305

 Score = 37.0 bits (84), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 20/30 (66%)

Query: 613 TGLRNLGSTCYINSMLQCLFATRKFRDIFL 642
           TGL N+G+TCY+NS+LQ  F+    R   L
Sbjct: 733 TGLNNIGNTCYLNSLLQYYFSISSLRQYVL 762

>ACL164C Chr3 complement(67792..71961) [4170 bp, 1389 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR124C
           (UBP2)
          Length = 1389

 Score = 37.0 bits (84), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 21/31 (67%)

Query: 613 TGLRNLGSTCYINSMLQCLFATRKFRDIFLS 643
           TG+ N+G+TCY+NS+LQ  F     R+  L+
Sbjct: 677 TGINNIGNTCYLNSLLQYYFTISPLREYILA 707

>SAKL0D10120g Chr4 complement(845029..846491,846566..846581) [1479
           bp, 492 aa] {ON} highly similar to uniprot|P43593
           Saccharomyces cerevisiae YFR010W UBP6 Ubiquitin-specific
           protease situated in the base subcomplex of the 26S
           proteasome releases free ubiquitin from branched
           polyubiquitin chains deletion causes hypersensitivity to
           cycloheximide and other toxic compounds
          Length = 492

 Score = 37.0 bits (84), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 21/30 (70%)

Query: 614 GLRNLGSTCYINSMLQCLFATRKFRDIFLS 643
           GL+N+G+TCY+N+ LQ L+     R+  L+
Sbjct: 105 GLKNMGNTCYMNATLQALYQITPLREAILN 134

>Kpol_1016.1 s1016 (585..4340) [3756 bp, 1251 aa] {ON} (585..4340)
           [3756 nt, 1252 aa]
          Length = 1251

 Score = 37.0 bits (84), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 21/31 (67%)

Query: 613 TGLRNLGSTCYINSMLQCLFATRKFRDIFLS 643
            GL N+G+TCY+NS+LQ  FA    R+  ++
Sbjct: 762 VGLNNIGNTCYLNSLLQYYFAISPLREYLIN 792

>CAGL0H10186g Chr8 complement(993354..995690) [2337 bp, 778 aa] {ON}
           similar to uniprot|P38237 Saccharomyces cerevisiae
           YBR058c UBP14 ubiquitin specific protease
          Length = 778

 Score = 37.0 bits (84), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 14/20 (70%), Positives = 17/20 (85%)

Query: 613 TGLRNLGSTCYINSMLQCLF 632
            GL NLG++CY+NS LQCLF
Sbjct: 331 CGLINLGNSCYLNSTLQCLF 350

 Score = 32.3 bits (72), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 28/101 (27%), Positives = 42/101 (41%), Gaps = 15/101 (14%)

Query: 741 QVDGKEYDKWFEDSISKNGLSPID----SIFQGQMENCLQCQRCGHSSYNYSTFYVLSLA 796
           Q D  E+  +F D + K      D     + +  ME+ LQCQ C    Y+  T  V+ L 
Sbjct: 420 QQDALEFFTYFVDELDKKLFKNSDYNPNDLMKFMMEDRLQCQECHGVKYSTETSNVIQLP 479

Query: 797 IPTPGTSTFGKTKKVLLEDCINLFTSDEVLSGENAWDCPRC 837
           +     +         LE+ IN + S EV+     + CP C
Sbjct: 480 LQESNDAQD-------LEERINAYFSGEVIE----FKCPNC 509

>TDEL0B03060 Chr2 (545366..547570) [2205 bp, 734 aa] {ON} Anc_8.540
           YPL072W
          Length = 734

 Score = 37.0 bits (84), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 40/81 (49%), Gaps = 10/81 (12%)

Query: 909 KLTTIKTFNFITMPPILVIHLSRFFYDLT--KKNSTVITYPLILNI---VLKNNEVA--- 960
           K T +K    +  P  LV+HLSR  +D    ++NS  + +  IL     V+++N+     
Sbjct: 420 KSTIVKKTVVVESPKTLVMHLSRSMFDGISYQRNSCGVAFDEILESREQVIRHNKCVGIN 479

Query: 961 --KYRLYGIVNHFGNLISGHY 979
              Y+L  IV H G+   GHY
Sbjct: 480 PISYKLKAIVAHSGSHSQGHY 500

>Kpol_219.1 s219 (1..750) [750 bp, 249 aa] {ON} (1..750) [750 nt, 250
            aa]
          Length = 249

 Score = 35.8 bits (81), Expect = 0.36,   Method: Composition-based stats.
 Identities = 19/56 (33%), Positives = 34/56 (60%), Gaps = 8/56 (14%)

Query: 957  NEVAKYRLYGIVNHFGNLI-SGHYTSLVNKDLKHEIRHGQQKWYYFDDE--VVKQD 1009
            NE  KY+L  +V H GN + SGHY + + K++++      ++W  ++DE  V+ +D
Sbjct: 182  NEPGKYKLTSVVCHKGNSVQSGHYVAFIKKEIEN-----VERWVLYNDEKIVIAED 232

>KLLA0E23387g Chr5 complement(2079405..2081753) [2349 bp, 782 aa]
           {ON} some similarities with uniprot|Q02863 Saccharomyces
           cerevisiae YPL072W UBP16 Putative ubiquitin-specific
           protease
          Length = 782

 Score = 36.6 bits (83), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 47/89 (52%), Gaps = 10/89 (11%)

Query: 901 GSEKWKSKKLTTIKTFNFITMPPILVIHLSRFFYDLT--KKNSTVITY--PLILN-IVLK 955
           G  K    K T +K    +  P +L++HLSR  +D    +KN+  +++   L++N  V++
Sbjct: 427 GGIKTSEIKSTIVKKTVVVDSPDVLILHLSRSVFDGMGYQKNTCNVSFEEELVVNRQVIE 486

Query: 956 NNEVA-----KYRLYGIVNHFGNLISGHY 979
           NN+        Y+L  ++ H G+  +GHY
Sbjct: 487 NNKCVGIRKDSYKLRSMLRHQGSHSTGHY 515

>KNAG0J00800 Chr10 complement(134836..137133) [2298 bp, 765 aa] {ON}
           Anc_3.270 YBR058C
          Length = 765

 Score = 36.6 bits (83), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 13/20 (65%), Positives = 18/20 (90%)

Query: 613 TGLRNLGSTCYINSMLQCLF 632
            GL N+G++CY+NS+LQCLF
Sbjct: 320 CGLINMGNSCYLNSVLQCLF 339

>TDEL0D03550 Chr4 (653772..656114) [2343 bp, 780 aa] {ON} Anc_3.270
           YBR058C
          Length = 780

 Score = 36.6 bits (83), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 14/20 (70%), Positives = 17/20 (85%)

Query: 613 TGLRNLGSTCYINSMLQCLF 632
            GL NLG++CYINS+LQCL 
Sbjct: 322 CGLINLGNSCYINSVLQCLL 341

>NCAS0C02110 Chr3 (398702..400186) [1485 bp, 494 aa] {ON} Anc_8.540
           YPL072W
          Length = 494

 Score = 36.2 bits (82), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 82/380 (21%), Positives = 135/380 (35%), Gaps = 74/380 (19%)

Query: 613 TGLRNLGSTCYINSMLQCLFATRKFRDIFLSPKYHDYISKGYIHRAQISRSFHMLFKKMY 672
           TGL N G+ C+INS +Q L    K    +LS    D        +   +   H       
Sbjct: 76  TGLVNPGNDCFINSSIQALVPLDKL-TTYLSATLED-------EKTASTLPLH------- 120

Query: 673 MNGGCSVVPSGFLKACNSMRPDFKIPNXXXXXXXXXXXXXXXXXXXXSDPEQVANDYPQL 732
            NG  ++     L     +R D K  +                    +D    A+++ QL
Sbjct: 121 -NGLATM-----LLELQQLRSDPKSVSSKRFIQQLETIFGGKISRQQND----AHEFTQL 170

Query: 733 LLH--DDDNLQVDGKEYDKWFEDSISKNGLSPIDSIFQGQMENCLQCQRCGHSSY-NYST 789
           +L   +++NL +D  +                +   F+G + N L C +CG +S+ N   
Sbjct: 171 ILERLNEENLTLDHAD----------------LTVPFKGIVGNHLVCLQCGRTSHVNEQP 214

Query: 790 FYVLSLAIPTPGTSTFGKTKKVLLEDCINLFTSDEVLSGENAWDCPRCGTSMSGSGPGEG 849
           FY+  L +P  G+        V L D +N    +++ + EN + C  C T    +   E 
Sbjct: 215 FYIYELTLPQQGS--------VKLSDLVN---GEQMETIEN-YSCMYCKTVAMLTNEREE 262

Query: 850 KAKKKRKFLLPHDHVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPGSEKWKSKK 909
           K+   R      D                                       + + KS  
Sbjct: 263 KSNVSRT-----DAELNILKFLKGKLSTLLINEELPEHITHYINSYNKGYCNTSEIKS-- 315

Query: 910 LTTIKTFNFITMPPILVIHLSRFFYDLTK--KNSTVITYP---LILNIVLKNN-----EV 959
              ++   F   P I +IHLSR  ++     +N   + +    L+   +LK++     E 
Sbjct: 316 -VIVRKSTFAEFPEIFLIHLSRSVFNGMNYSRNPCQVEFEEEILLPRQILKDHQCVGFET 374

Query: 960 AKYRLYGIVNHFGNLISGHY 979
            KY+L  IV H G+   GHY
Sbjct: 375 VKYKLKSIVKHTGSHYQGHY 394

>KAFR0D05070 Chr4 complement(996195..999878) [3684 bp, 1227 aa] {ON}
           Anc_5.443 YOR124C
          Length = 1227

 Score = 36.6 bits (83), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 22/32 (68%)

Query: 614 GLRNLGSTCYINSMLQCLFATRKFRDIFLSPK 645
           GL N+G+TCY+NS+LQ  F+    R+  L+ K
Sbjct: 711 GLNNIGNTCYLNSLLQYYFSIAPLREYILNYK 742

>KNAG0B04190 Chr2 (795803..799591) [3789 bp, 1262 aa] {ON} Anc_5.443
           YOR124C
          Length = 1262

 Score = 36.6 bits (83), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 20/30 (66%)

Query: 614 GLRNLGSTCYINSMLQCLFATRKFRDIFLS 643
           GL N+G+TCY+NS+LQ  FA    R+   S
Sbjct: 726 GLNNIGNTCYLNSLLQYYFAIAPLRNYICS 755

>Ecym_1166 Chr1 (339106..341196) [2091 bp, 696 aa] {ON} similar to
           Ashbya gossypii AEL242W
          Length = 696

 Score = 36.2 bits (82), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 43/83 (51%), Gaps = 10/83 (12%)

Query: 907 SKKLTTIKTFNFITMPPILVIHLSRFFYDLT--KKNSTVITYP--LILN--IVLKNNEVA 960
           S K   +K    ++ P +L++HLSR  +D     KNS  + +P  LILN   + ++  +A
Sbjct: 389 SLKSRILKRTVVVSSPKVLLLHLSRSVFDGVTYTKNSCNVLFPEDLILNEQEIKEDRCIA 448

Query: 961 ----KYRLYGIVNHFGNLISGHY 979
               +Y+L  ++ H G    GHY
Sbjct: 449 VHCVRYKLQAMIKHTGTHFQGHY 471

>Suva_8.176 Chr8 complement(312595..316407) [3813 bp, 1270 aa] {ON}
           YOR124C (REAL)
          Length = 1270

 Score = 36.2 bits (82), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 21/31 (67%)

Query: 613 TGLRNLGSTCYINSMLQCLFATRKFRDIFLS 643
           TG+ N+G+TCY+NS+LQ  F+    R   L+
Sbjct: 736 TGINNIGNTCYLNSLLQYYFSIAPLRSYILN 766

>TPHA0G00560 Chr7 complement(105403..106794) [1392 bp, 463 aa] {ON}
            Anc_8.742 YMR223W
          Length = 463

 Score = 35.8 bits (81), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 26/110 (23%), Positives = 45/110 (40%), Gaps = 23/110 (20%)

Query: 912  TIKTFNFITMPPILVIHLSRFFYDLTKKNSTV---ITYPLILNI----VLKNNEVAK--- 961
             +K      +PP+L++ L RF + L  ++S +   I YP  L +       +NE      
Sbjct: 338  ALKQLTISKLPPVLLLQLKRFEHKLNGQSSKLNDSIEYPPYLRMNDYCQTSSNETIDSPD 397

Query: 962  -----YRLYGIVNHFGNLISGHYTSLVNKDLKHEIRHGQQKWYYFDDEVV 1006
                 Y L G++ H G +  GHY            +    +W  F+D ++
Sbjct: 398  DSDIIYELIGVICHTGTVNEGHYIC--------SCKLANNQWVKFNDSMI 439

 Score = 32.7 bits (73), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 11/21 (52%), Positives = 18/21 (85%)

Query: 611 SITGLRNLGSTCYINSMLQCL 631
            ++GL N+GSTCY++ ++QCL
Sbjct: 135 GLSGLVNMGSTCYMSCIIQCL 155

>KAFR0C00410 Chr3 complement(85302..87611) [2310 bp, 769 aa] {ON}
           Anc_3.270 YBR058C
          Length = 769

 Score = 36.2 bits (82), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 25/39 (64%), Gaps = 2/39 (5%)

Query: 613 TGLRNLGSTCYINSMLQCLFA--TRKFRDIFLSPKYHDY 649
            GL NLG++CY+NS+LQ LFA    ++ D+ +     D+
Sbjct: 319 CGLINLGNSCYLNSILQALFAQDVSQWADVLMDTIGKDF 357

>SAKL0H10076g Chr8 (863358..865661) [2304 bp, 767 aa] {ON} similar
           to gnl|GLV|KLLA0E23463g Kluyveromyces lactis
           KLLA0E23463g and some similarites with YPL072W
           uniprot|Q02863 Saccharomyces cerevisiae YPL072W UBP16
           Putative ubiquitin-specific protease
          Length = 767

 Score = 36.2 bits (82), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 38/81 (46%), Gaps = 10/81 (12%)

Query: 909 KLTTIKTFNFITMPPILVIHLSRFFYDLTK--KNSTVITYPLILN----IVLKNNEVA-- 960
           K T +K    +  P +L+IHLSR  ++     +NS  + +   L     I+ KN  V   
Sbjct: 440 KSTIVKKTVVVDSPELLIIHLSRSVFNGMNYTRNSCNVAFEEDLGLQEQIIEKNKCVGVN 499

Query: 961 --KYRLYGIVNHFGNLISGHY 979
             KYRL   V H G   +GHY
Sbjct: 500 NVKYRLRATVRHQGTHSAGHY 520

>TBLA0D00620 Chr4 complement(159706..163221) [3516 bp, 1171 aa] {ON}
           Anc_7.390 YBL067C
          Length = 1171

 Score = 36.2 bits (82), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 17/29 (58%)

Query: 614 GLRNLGSTCYINSMLQCLFATRKFRDIFL 642
           G  N G+TCY NS+LQCL+     R   L
Sbjct: 517 GYENFGNTCYCNSVLQCLYNMTNLRTNIL 545

>TDEL0D02580 Chr4 (493355..497173) [3819 bp, 1272 aa] {ON} Anc_5.443
           YOR124C
          Length = 1272

 Score = 36.2 bits (82), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 14/26 (53%), Positives = 19/26 (73%)

Query: 613 TGLRNLGSTCYINSMLQCLFATRKFR 638
           TGL N+G+TCY+NS+LQ  F+    R
Sbjct: 732 TGLNNIGNTCYLNSLLQYYFSLAPLR 757

>TDEL0B03670 Chr2 complement(656511..657902) [1392 bp, 463 aa] {ON}
            Anc_8.742 YMR223W
          Length = 463

 Score = 35.8 bits (81), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 48/106 (45%), Gaps = 19/106 (17%)

Query: 912  TIKTFNFITMPPILVIHLSRFFYDLTK---KNSTVITYPLILNI----VLKNNEV----A 960
             IK  +   +P +LV+ L RF + L     K +  I YP  LN+       +++V     
Sbjct: 342  AIKRLSIYKLPSVLVLQLKRFEHLLNGNSLKLNDFIEYPPYLNMRDYCSSGDSDVDVPDL 401

Query: 961  KYRLYGIVNHFGNLISGHYTSLVNKDLKHEIRHGQQKWYYFDDEVV 1006
             Y L G+V H G +  GHY +          +   ++W+ F+D +V
Sbjct: 402  IYELIGVVAHKGTVNEGHYVATT--------KVAGRQWFKFNDSMV 439

>KLTH0F15862g Chr6 (1288742..1292467) [3726 bp, 1241 aa] {ON}
           similar to uniprot|Q01476 Saccharomyces cerevisiae
           YOR124C UBP2 Ubiquitin-specific protease that removes
           ubiquitin from ubiquitinated proteins cleaves at the C
           terminus of ubiquitin fusions capable of cleaving
           polyubiquitin and possesses isopeptidase activity
          Length = 1241

 Score = 36.2 bits (82), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 14/26 (53%), Positives = 18/26 (69%)

Query: 613 TGLRNLGSTCYINSMLQCLFATRKFR 638
           TGL N+G+TCY+NS+LQ  F     R
Sbjct: 703 TGLNNIGNTCYLNSLLQYYFCISPLR 728

>NCAS0A14370 Chr1 (2830136..2832325) [2190 bp, 729 aa] {ON}
           Anc_7.390
          Length = 729

 Score = 35.8 bits (81), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 19/30 (63%)

Query: 609 SLSITGLRNLGSTCYINSMLQCLFATRKFR 638
           S  + G  N G+TCY NS+LQCL+   + R
Sbjct: 133 SNKVFGYENFGNTCYCNSVLQCLYNLTELR 162

>KLLA0E08801g Chr5 (784991..787306) [2316 bp, 771 aa] {ON} similar
           to uniprot|P25037 Saccharomyces cerevisiae YDL122W UBP1
           Ubiquitin-specific protease that removes ubiquitin from
           ubiquitinated proteins cleaves at the C terminus of
           ubiquitin fusions irrespective of their size capable of
           cleaving polyubiquitin chains
          Length = 771

 Score = 35.8 bits (81), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 24/34 (70%), Gaps = 3/34 (8%)

Query: 612 ITGLRNLGSTCYINSMLQCLFATR---KFRDIFL 642
           + GL N G+TC++NS+LQCL +++   KF D  +
Sbjct: 83  VGGLVNDGNTCFMNSVLQCLASSKELHKFMDTII 116

>Suva_4.295 Chr4 complement(520439..522787) [2349 bp, 782 aa] {ON}
           YBR058C (REAL)
          Length = 782

 Score = 35.8 bits (81), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 42/197 (21%), Positives = 71/197 (36%), Gaps = 56/197 (28%)

Query: 613 TGLRNLGSTCYINSMLQCLF--ATRKFRDIFLSPKYH-DYISKGYIHRAQISRSFHML-- 667
            GL NLG++CY+NS++Q L       +   FL  ++  D +      + Q  +  + +  
Sbjct: 323 CGLINLGNSCYLNSVMQSLLNGGVPSWSLDFLGSEFPLDVVYPANNLKCQWIKLLNAMKH 382

Query: 668 FKKMYMNGGCSVVPSGFLKACNSMRPDFKIPNXXXXXXXXXXXXXXXXXXXXSDPEQVAN 727
             K+Y NG   + P+ F K       +F                                
Sbjct: 383 EPKLYANG---IKPTTFKKCIGKNHEEFS------------------------------- 408

Query: 728 DYPQLLLHDDDNLQVDGKEYDKWFEDSISKN-------GLSPIDSIFQGQMENCLQCQRC 780
                      N Q D  E+  +  DS+ +N       G S  + + +  ME+ LQC +C
Sbjct: 409 ----------SNRQQDAMEFLTFLLDSLDRNFFSDNSAGASNPNDLMRFMMEDRLQCNKC 458

Query: 781 GHSSYNYSTFYVLSLAI 797
           G   Y+Y     + L +
Sbjct: 459 GKVKYSYEPAEAIQLPL 475

>Skud_4.133 Chr4 (238225..240588) [2364 bp, 787 aa] {ON} YDL122W
           (REAL)
          Length = 787

 Score = 35.4 bits (80), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 21/30 (70%)

Query: 612 ITGLRNLGSTCYINSMLQCLFATRKFRDIF 641
           I GL N G+TC++NS+LQ L ++R+  D  
Sbjct: 100 IAGLVNDGNTCFMNSVLQSLASSRELMDFL 129

>Suva_4.125 Chr4 (231011..233392) [2382 bp, 793 aa] {ON} YDL122W
           (REAL)
          Length = 793

 Score = 35.4 bits (80), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 21/30 (70%)

Query: 612 ITGLRNLGSTCYINSMLQCLFATRKFRDIF 641
           I GL N G+TC++NS+LQ L ++R+  D  
Sbjct: 100 IAGLVNDGNTCFMNSVLQSLASSRELMDFL 129

>Kwal_56.23084 s56 complement(392398..394686) [2289 bp, 762 aa] {ON}
            YBR058C (UBP14) - Ubiquitin-specific protease [contig
            183] FULL
          Length = 762

 Score = 35.4 bits (80), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 31/53 (58%), Gaps = 8/53 (15%)

Query: 960  AKYRLYGIVNHFGNLI-SGHYTSLVNKDLKHEIRHGQQKWYYFDDE--VVKQD 1009
            A +RL  ++ H G+ + SGHY + + KD+++E      KW  ++DE  VV  D
Sbjct: 696  ANFRLSAVICHKGSSVHSGHYVAFIKKDVENET-----KWVLYNDEKMVVADD 743

>Kwal_27.12030 s27 complement(1056215..1058464) [2250 bp, 749 aa]
           {ON} YPL072W (UBP16) - putative deubiquitinating enzyme
           [contig 24] FULL
          Length = 749

 Score = 35.0 bits (79), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 30/98 (30%), Positives = 44/98 (44%), Gaps = 11/98 (11%)

Query: 909 KLTTIKTFNFITMPPILVIHLSRFFYDLTK--KNSTVITYPLILNI---VLKNNEVA--- 960
           K T +K       P IL++HLSR  ++     +NS  +T+   L+     ++NN      
Sbjct: 434 KSTIVKKTVVTESPDILILHLSRSVFNGMNYTRNSCYVTFEEELHTQEQEIENNRCVGVK 493

Query: 961 --KYRLYGIVNHFGNLISGHYTSLVNK-DLKHEIRHGQ 995
             KY+L  +V H G    GHY     K DL  +   GQ
Sbjct: 494 PIKYKLKAMVKHEGTHSQGHYECYKRKPDLVKDAVSGQ 531

>Kwal_14.1957 s14 (549510..550844) [1335 bp, 444 aa] {ON} YER151C
            (UBP3) - Ubiquitin-specific protease [contig 231] PARTIAL
          Length = 444

 Score = 34.7 bits (78), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 35/77 (45%), Gaps = 8/77 (10%)

Query: 960  AKYRLYGIVNHFGNLISG-HYTSLVNKDLKHEIRHGQQKWYYFDDEVVKQDNNHGDFDAG 1018
            + Y+L G+V H G   SG HYT  V        +  Q+KW+  DD  V++         G
Sbjct: 375  STYKLIGVVYHHGVSSSGGHYTCDV-------YQEAQKKWFRIDDINVQEIEMEEVLQPG 427

Query: 1019 IASVSSSDVYVLFYERI 1035
                 S   Y+L Y+++
Sbjct: 428  EEGSDSRTAYILIYQKL 444

>Skud_5.289 Chr5 complement(460660..463392) [2733 bp, 910 aa] {ON}
            YER151C (REAL)
          Length = 910

 Score = 34.7 bits (78), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 34/145 (23%), Positives = 58/145 (40%), Gaps = 39/145 (26%)

Query: 921  MPPILVIHLSRF-FYDLTKKNSTVITY------------------PLIL------NIVLK 955
            +P +L+I   RF F +   K++ +  Y                   LI+      +I LK
Sbjct: 772  LPQVLLIQFKRFSFINNVNKDNAMTNYNAYNGRIEKIRKKIKYDHELIIPEESMSSITLK 831

Query: 956  NNEVAK----YRLYGIVNHFG-NLISGHYTSLVNKDLKHEIRHGQQ-KWYYFDDEVVKQD 1009
            N+        Y+L G++ H G     GHYT+        ++ H +  KWY  DD  + + 
Sbjct: 832  NHTSGADDRIYKLTGVIYHHGVGSDGGHYTA--------DVYHSEHNKWYRIDDVNITEL 883

Query: 1010 NNHGDFDAGIASVSSSDVYVLFYER 1034
             +      G  +  S   Y+L Y++
Sbjct: 884  EDDDVLKGGEEASDSRTAYILMYQK 908

>NCAS0H02100 Chr8 complement(406897..410706) [3810 bp, 1269 aa] {ON}
           Anc_5.443 YOR124C
          Length = 1269

 Score = 34.7 bits (78), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 20/30 (66%)

Query: 613 TGLRNLGSTCYINSMLQCLFATRKFRDIFL 642
            G+ N+G+TCY+NS+LQ  F+    R+  L
Sbjct: 713 AGINNIGNTCYLNSLLQYYFSIAPLRNYVL 742

>Suva_5.280 Chr5 complement(441123..443840) [2718 bp, 905 aa] {ON}
            YER151C (REAL)
          Length = 905

 Score = 34.7 bits (78), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 34/145 (23%), Positives = 59/145 (40%), Gaps = 39/145 (26%)

Query: 921  MPPILVIHLSRF-FYDLTKKNSTVITY------------------PLIL------NIVLK 955
            +P +L+I   RF F +   K++ +  Y                   LI+      +I LK
Sbjct: 767  LPQVLLIQFKRFSFINNVDKDNAMTNYNAYNGRIEKIRKKIKYGHELIIPEESMSSITLK 826

Query: 956  NNEVA----KYRLYGIVNHFG-NLISGHYTSLVNKDLKHEIRHGQ-QKWYYFDDEVVKQD 1009
            N+        Y+L G++ H G +   GHYT+        ++ H +  KWY  DD  + + 
Sbjct: 827  NHATGIADRNYKLTGVIYHHGISSDGGHYTA--------DVYHSEHNKWYRIDDVNIIEL 878

Query: 1010 NNHGDFDAGIASVSSSDVYVLFYER 1034
             +      G  +  S   Y+L Y++
Sbjct: 879  EDDDVLKGGEEASDSRTAYILMYQK 903

>Kpol_1062.23 s1062 (51365..55165) [3801 bp, 1266 aa] {ON}
           (51365..55165) [3801 nt, 1267 aa]
          Length = 1266

 Score = 34.7 bits (78), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 27/111 (24%), Positives = 46/111 (41%), Gaps = 24/111 (21%)

Query: 613 TGLRNLGSTCYINSMLQCLFATRKFRDIFLS-----PKYHDYISKGY---------IHRA 658
            GL N+G+TCY+NS+LQ  F     R+             + +  G+         I++ 
Sbjct: 726 AGLNNIGNTCYLNSLLQYYFCISPLRNYVADYQKTLEAVENCLEDGWDKRRIGGREINKV 785

Query: 659 QISRSFHM------LFKKMYMNGGCSVVPSGFLK----ACNSMRPDFKIPN 699
           ++ RS         LF +M  +    V P+  L     A +++  +F  PN
Sbjct: 786 EVERSVQFVYQLRDLFNEMIHSSSRCVTPTKELAYLAFAPSNVEVEFDQPN 836

>TBLA0E02570 Chr5 complement(646995..649352) [2358 bp, 785 aa] {ON}
           Anc_3.270 YBR058C
          Length = 785

 Score = 34.3 bits (77), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 12/19 (63%), Positives = 17/19 (89%)

Query: 614 GLRNLGSTCYINSMLQCLF 632
           GL NLG++CY+NS+LQC +
Sbjct: 327 GLINLGNSCYLNSILQCFY 345

>KLTH0E12540g Chr5 complement(1111576..1113834) [2259 bp, 752 aa]
           {ON} some similarities with uniprot|Q02863 Saccharomyces
           cerevisiae YPL072W UBP16 Putative ubiquitin- specific
           protease
          Length = 752

 Score = 34.3 bits (77), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 40/85 (47%), Gaps = 11/85 (12%)

Query: 922 PPILVIHLSRFFYDLTK--KNSTVITYPLILNI---VLKNNEVA-----KYRLYGIVNHF 971
           P IL++HLSR  ++ T   +NS  + +   L+     ++NN        KY+L  +V H 
Sbjct: 445 PEILILHLSRSVFNGTNYTRNSCYVNFDEELHTQEQTIENNRCVGVKPIKYKLKSMVKHQ 504

Query: 972 GNLISGHYTSLVNK-DLKHEIRHGQ 995
           G    GHY     K DL  +   GQ
Sbjct: 505 GTHSQGHYECFRRKPDLVKDSLSGQ 529

>KAFR0E00930 Chr5 (198914..200410) [1497 bp, 498 aa] {ON} Anc_8.540
           YPL072W
          Length = 498

 Score = 34.3 bits (77), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 37/81 (45%), Gaps = 10/81 (12%)

Query: 909 KLTTIKTFNFITMPPILVIHLSRFFYD---LTKKNSTV-------ITYPLILNIVLKNNE 958
           K   IK    I  P  L++HLSR  ++   +T+    V       +   +++N   +  E
Sbjct: 324 KSNIIKKNAVIKEPASLIVHLSRSIFNGATITRSACRVEYEQSLNLQRQVMINDAFERTE 383

Query: 959 VAKYRLYGIVNHFGNLISGHY 979
             KY L  +V H G+ + GHY
Sbjct: 384 PIKYELKSVVKHTGSHVQGHY 404

>CAGL0H05335g Chr8 complement(512683..514134) [1452 bp, 483 aa] {ON}
           weakly similar to uniprot|Q02863 Saccharomyces
           cerevisiae YPL072w UBP16
          Length = 483

 Score = 33.9 bits (76), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 29/86 (33%), Positives = 39/86 (45%), Gaps = 11/86 (12%)

Query: 911 TTIKTFNFITMPPILVIHLSRFFYD--LTKKNSTVITYPLILNIV------LKNNEVAK- 961
           + +K   F+  P I VIHLSR  Y+     +N   + +   L+          +NE  K 
Sbjct: 324 SILKQCKFVNAPDIFVIHLSRSTYNGMTFTRNGCKVHFGETLDAFETVACSTSSNEFTKR 383

Query: 962 --YRLYGIVNHFGNLISGHYTSLVNK 985
             YRL  IV H G+  SGHY  L  K
Sbjct: 384 VRYRLKSIVIHTGSHYSGHYQVLRRK 409

>SAKL0D03322g Chr4 (270137..272434) [2298 bp, 765 aa] {ON} similar
           to uniprot|P38237 YBR058C Saccharomyces cerevisiae UBP14
           Ubiquitin-specific protease that specifically
           disassembles unanchored ubiquitin chains
          Length = 765

 Score = 33.9 bits (76), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 13/20 (65%), Positives = 17/20 (85%)

Query: 613 TGLRNLGSTCYINSMLQCLF 632
            GL NLG++CY+NS+LQ LF
Sbjct: 313 CGLNNLGNSCYMNSVLQVLF 332

>AFR551W Chr6 (1427498..1428907) [1410 bp, 469 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YMR223W (UBP8)
          Length = 469

 Score = 33.9 bits (76), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 26/108 (24%), Positives = 47/108 (43%), Gaps = 25/108 (23%)

Query: 913  IKTFNFITMPPILVIHLSRFFYDLTKKNSTVITYPLILNIVLKNNEVAK----------- 961
            I+  +   +PP+L++ L RF + L    S  I   +  ++ L   +  K           
Sbjct: 352  IRQLSMAKLPPVLMLQLKRFEH-LINGTSVKINDYIFFSVDLNMKDYCKPMDDQHPVPNL 410

Query: 962  -YRLYGIVNHFGNLISGHYTSL--VNKDLKHEIRHGQQKWYYFDDEVV 1006
             ++L  I+ H G +  GHYT++  +N D+          W  F+D +V
Sbjct: 411  TFKLSAIIPHQGTVDKGHYTTICRINGDV----------WAKFNDSMV 448

>KAFR0B02370 Chr2 complement(460558..463047) [2490 bp, 829 aa] {ON}
            Anc_8.202 YER151C
          Length = 829

 Score = 33.9 bits (76), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 36/141 (25%), Positives = 55/141 (39%), Gaps = 37/141 (26%)

Query: 921  MPPILVIHLSRFFY--------DLTKKNS---------TVITY--PLIL-------NIVL 954
            +P +L+I L RF +        D+T  N+           I Y   LI+       N  +
Sbjct: 698  LPEVLLIQLKRFSFVSNVGKSNDMTNYNAYNGRIEKIRKKINYGHELIIPSESVSSNATM 757

Query: 955  KNNEVAKYRLYGIVNHFG-NLISGHYTSLVNKDLKHEIRHGQQKWYYFDDEVVKQDNNHG 1013
             N E   Y L G++ H G +   GHYT+ V       +    +KWY  DD  + +     
Sbjct: 758  SNRE---YSLTGVIYHHGLSPDGGHYTADV-------LHSESKKWYRIDDVNINELEEDD 807

Query: 1014 DFDAGIASVSSSDVYVLFYER 1034
                G     S   Y+L Y++
Sbjct: 808  VLKGGEEDNDSRTAYILMYQK 828

>KLTH0H07370g Chr8 (655985..658330) [2346 bp, 781 aa] {ON} some
            similarities with uniprot|Q01477 Saccharomyces cerevisiae
            YER151C UBP3 Ubiquitin-specific protease that interacts
            with Bre5p to co-regulate anterograde and retrograde
            transport between endoplasmic reticulum and Golgi
            compartments inhibitor of gene silencing cleaves
            ubiquitin fusions but not polyubiquitin
          Length = 781

 Score = 33.9 bits (76), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 34/75 (45%), Gaps = 8/75 (10%)

Query: 962  YRLYGIVNHFG-NLISGHYTSLVNKDLKHEIRHGQQKWYYFDDEVVKQDNNHGDFDAGIA 1020
            Y+L G+V H G +   GHYT     D+  E  +   KWY  DD  V++         G  
Sbjct: 714  YKLIGVVYHHGVSPSGGHYTC----DVYQETLN---KWYRIDDTNVQEIEKDEVLKGGEE 766

Query: 1021 SVSSSDVYVLFYERI 1035
               S   Y+L Y+++
Sbjct: 767  GNDSRTAYILIYQKL 781

>Skud_16.209 Chr16 (389855..391366) [1512 bp, 503 aa] {ON} YPL072W
            (REAL)
          Length = 503

 Score = 33.1 bits (74), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 26/107 (24%), Positives = 44/107 (41%), Gaps = 14/107 (13%)

Query: 919  ITMPPILVIHLSRFFYDLT-----------KKNSTVITYPLILNIVLKNNEVAKYRLYGI 967
            + +P +LVIHLSR  ++             ++   +  Y  I N+ L  N    Y L  +
Sbjct: 345  VKLPKVLVIHLSRSTFNGVTYSRNPCNVKFQEEIKLTEYTSIENMKLTENRQIVYNLKSV 404

Query: 968  VNHFGNLISGHYTSLVNKDLKHEIRHGQQKWYYFDDEVVKQDNNHGD 1014
            V H G+   GHY     K    +I   ++   + D   +  + NH +
Sbjct: 405  VKHTGSHSRGHYMCYRRKG---DILFDKEDESFVDSRSIITNRNHNE 448

>Smik_16.163 Chr16 (301703..303208) [1506 bp, 501 aa] {ON} YPL072W
           (REAL)
          Length = 501

 Score = 33.1 bits (74), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 32/72 (44%), Gaps = 11/72 (15%)

Query: 919 ITMPPILVIHLSR-FFYDLT----------KKNSTVITYPLILNIVLKNNEVAKYRLYGI 967
           + +P ILV+HLSR  F  +T           +   +  Y L  N  +  N   KY L  +
Sbjct: 337 VQLPDILVVHLSRSTFNGITYCRNPCNVEFGERVKLPEYTLAENRAITENRQVKYNLKSV 396

Query: 968 VNHFGNLISGHY 979
           V H G+   GHY
Sbjct: 397 VKHTGSHSRGHY 408

>TBLA0H03600 Chr8 complement(877069..878517) [1449 bp, 482 aa] {ON}
           Anc_8.540 YPL072W
          Length = 482

 Score = 32.3 bits (72), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 84/394 (21%), Positives = 138/394 (35%), Gaps = 89/394 (22%)

Query: 613 TGLRNLGSTCYINSMLQCLFATRKFRDIFLSPKYHDYISKGYIHRAQISRSFHMLFKKMY 672
           TGL N G+ C+INS LQ L  +++F         + Y++        + R    L +   
Sbjct: 69  TGLINKGNDCFINSSLQGLAGSQRF---------NHYLN-------SVLRCLKFLNENPK 112

Query: 673 MNGGCSVVPSGFLKACNSMRPDFKIP---NXXXXXXXXXXXXXXXXXXXXSDPEQVANDY 729
             G    +P   + A      D + P   N                    S  +  A ++
Sbjct: 113 QEGNRYALPLHQVMA--EFIYDLQAPTFLNTVESSDKIIVTMESIFKQKMSRRQNDAQEF 170

Query: 730 PQLLLHDDDNLQVDGKEYDKWFE-DSISKNGLSPIDSIFQGQMENCLQCQRCGHSS-YNY 787
            QLLL      +V   EY +     +   N L      F+G+  + L C +CG +S    
Sbjct: 171 TQLLL------EVLHNEYQELIRLMNFITNNLDIPTYPFEGKYCHELTCLKCGRNSEVKM 224

Query: 788 STFYVLSLAIPTPGTSTFGKTKKVLLEDCINLFTSDEVLSGENA-----WDCPRCGTS-- 840
             F +L+L +P   + +                  DE++SG N+     + C  C  S  
Sbjct: 225 FDFDILTLNLPAQPSISL-----------------DELISGSNSDVIEGFSCTVCKVSAI 267

Query: 841 MSGSG---PGEGKAKKKRKFLLPHDHVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 897
           + G+G   P      K  K + P   +                                 
Sbjct: 268 LGGTGTHNPNTRSLIKSLKEIFPELKINTELDEPLNSFVDSYSHDGVIT----------- 316

Query: 898 XMPGSEKWKSKKLTTIKTFNFITMPPILVIHLSRFFYDLTK--KNSTVITY--PLILN-- 951
                   ++ K T +K   F+ +P IL+IHL+R  ++     +N+  I Y   L+L   
Sbjct: 317 --------RNIKSTIVKKTVFVEVPDILLIHLTRSMFNGMSYTRNACKIAYDEKLLLEHQ 368

Query: 952 ------IVLKNNEVAKYRLYGIVNHFGNLISGHY 979
                  V++NN   +Y L   + H G+   GHY
Sbjct: 369 LVMDGVSVMRNN--IQYTLSSAIKHSGSHSMGHY 400

>Smik_2.189 Chr2 complement(335612..337960) [2349 bp, 782 aa] {ON}
           YBR058C (REAL)
          Length = 782

 Score = 32.7 bits (73), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 42/190 (22%), Positives = 76/190 (40%), Gaps = 42/190 (22%)

Query: 613 TGLRNLGSTCYINSMLQCLF--ATRKFRDIFLSPKYH-DYISKGYIHRAQISRSFHMLF- 668
            GL NLG++CY+NS++Q L       +   FL  ++  D +  G   + Q  + F+ +  
Sbjct: 323 CGLINLGNSCYLNSVMQSLLNGGIPNWSLDFLGSEFPLDVVYPGNNLKCQWIKLFNAMRC 382

Query: 669 -KKMYMNGGCSVVPSGFLKACNSMRPDFKIPNXXXXXXXXXXXXXXXXXXXXSDPEQVAN 727
             + Y NG   + P+ F K       +F                        S+ +Q A 
Sbjct: 383 EPEFYPNG---IKPTTFKKCIGQNHEEFS-----------------------SNRQQDAM 416

Query: 728 DYPQLLLHDDDNLQVDGKEYDKWFEDSISKNGLSPIDSIFQGQMENCLQCQRCGHSSYNY 787
           ++            +      K+F  SI  +G S ++ + +  ME+ LQC +CG   Y+Y
Sbjct: 417 EF---------LTFLLDLLDRKFF--SIGSSGASNVNDLVRFIMEDRLQCNKCGKVKYSY 465

Query: 788 STFYVLSLAI 797
                + + +
Sbjct: 466 EPAEAIQIPL 475

>TPHA0D04350 Chr4 complement(934597..937161) [2565 bp, 854 aa] {ON}
            Anc_8.202 YER151C
          Length = 854

 Score = 32.3 bits (72), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 32/76 (42%), Gaps = 8/76 (10%)

Query: 961  KYRLYGIVNHFG-NLISGHYTSLVNKDLKHEIRHGQQKWYYFDDEVVKQDNNHGDFDAGI 1019
            KY+L G++ H G +   GHYT+ V             KWY  DD  + +         G 
Sbjct: 786  KYQLTGVIYHHGLSSDGGHYTADV-------FNKTADKWYRIDDINITELKKDDVLKGGE 838

Query: 1020 ASVSSSDVYVLFYERI 1035
                +   Y+L Y+++
Sbjct: 839  DGTDTRTAYILMYQKL 854

>Kpol_251.7 s251 (12280..13719) [1440 bp, 480 aa] {ON}
           (12280..13719) [1440 nt, 480 aa]
          Length = 480

 Score = 32.3 bits (72), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 13/20 (65%), Positives = 17/20 (85%)

Query: 613 TGLRNLGSTCYINSMLQCLF 632
            GL NLG++CY+NS+LQ LF
Sbjct: 322 CGLINLGNSCYMNSVLQLLF 341

>YOR022C Chr15 complement(373710..375857) [2148 bp, 715 aa] {ON}
           Protein with similarity to bovine phospholipase A1; the
           authentic, non-tagged protein is detected in highly
           purified mitochondria in high-throughput studies
          Length = 715

 Score = 32.3 bits (72), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 16/54 (29%), Positives = 29/54 (53%)

Query: 371 DPRDLWDVDRKVPISSDVELEKKMGSYQTFQSRSKFKYIVYYTDMKTFLNIDFD 424
           + +D++ +  K P+  + E E+K GS    ++ S FK+I++      FL  D D
Sbjct: 150 ESQDIFRLKGKYPVDKENEGEQKNGSSNKDENESTFKFILFANKQTAFLLSDLD 203

>NDAI0G00780 Chr7 (164452..165912) [1461 bp, 486 aa] {ON} 
          Length = 486

 Score = 32.0 bits (71), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 44/91 (48%), Gaps = 20/91 (21%)

Query: 946  YPLI-LNIVLKNNEVAKYRLYGIVNHFGNLISGHYTSLVNKDLKHEIRHGQQKWYYFDDE 1004
            +PL  L  ++ NN+   Y L  IV H+G+   GHY S          R  + +W+   DE
Sbjct: 412  FPLKELGHIIGNNKCV-YSLKSIVVHYGSHDYGHYISY---------RRFEDQWWRISDE 461

Query: 1005 -VVKQDNNHGDFDAGIASVSSSDVYVLFYER 1034
             V+K D +           S+S ++++FYE+
Sbjct: 462  SVLKVDEDE--------VFSASGIFIVFYEQ 484

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.134    0.399 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 108,354,397
Number of extensions: 4789548
Number of successful extensions: 16963
Number of sequences better than 10.0: 270
Number of HSP's gapped: 17056
Number of HSP's successfully gapped: 525
Length of query: 1037
Length of database: 53,481,399
Length adjustment: 120
Effective length of query: 917
Effective length of database: 39,721,479
Effective search space: 36424596243
Effective search space used: 36424596243
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 71 (32.0 bits)