Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0E15114g5.711ON64964933100.0
KLLA0A00418g5.711ON64262026310.0
Kwal_55.196495.711ON64162025940.0
KLTH0E00836g5.711ON64162025830.0
TDEL0B020905.711ON64361325070.0
CAGL0H06699g5.711ON65062024670.0
Ecym_40105.711ON64463124220.0
TPHA0E001505.711ON64661524010.0
ZYRO0B16522g5.711ON64362423920.0
Kpol_1043.775.711ON65762623850.0
AFR295W5.711ON63159623840.0
KAFR0D021705.711ON66062423790.0
NCAS0G001805.711ON65465623110.0
TBLA0E017505.711ON66560322160.0
NDAI0F002105.711ON65361421890.0
YIL155C (GUT2)5.711ON64963121690.0
Skud_9.135.711ON64963121670.0
Smik_9.145.711ON65263121460.0
Suva_9.325.711ON53854220160.0
KNAG0L021905.711ON64559720020.0
Suva_10.5264.276ON114446790.69
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0E15114g
         (649 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0E15114g Chr5 (1256624..1258573) [1950 bp, 649 aa] {ON} high...  1279   0.0  
KLLA0A00418g Chr1 complement(33084..35012) [1929 bp, 642 aa] {ON...  1018   0.0  
Kwal_55.19649 s55 complement(65706..67631) [1926 bp, 641 aa] {ON...  1003   0.0  
KLTH0E00836g Chr5 complement(83201..85126) [1926 bp, 641 aa] {ON...   999   0.0  
TDEL0B02090 Chr2 complement(372755..374686) [1932 bp, 643 aa] {O...   970   0.0  
CAGL0H06699g Chr8 (665295..667247) [1953 bp, 650 aa] {ON} simila...   954   0.0  
Ecym_4010 Chr4 complement(24630..26564) [1935 bp, 644 aa] {ON} s...   937   0.0  
TPHA0E00150 Chr5 complement(11922..13862) [1941 bp, 646 aa] {ON}...   929   0.0  
ZYRO0B16522g Chr2 (1340223..1342154) [1932 bp, 643 aa] {ON} high...   926   0.0  
Kpol_1043.77 s1043 (168788..170761) [1974 bp, 657 aa] {ON} (1687...   923   0.0  
AFR295W Chr6 (970178..972073) [1896 bp, 631 aa] {ON} Syntenic ho...   922   0.0  
KAFR0D02170 Chr4 complement(435640..437622) [1983 bp, 660 aa] {O...   920   0.0  
NCAS0G00180 Chr7 complement(25495..27459) [1965 bp, 654 aa] {ON}...   894   0.0  
TBLA0E01750 Chr5 (427657..429654) [1998 bp, 665 aa] {ON} Anc_5.7...   858   0.0  
NDAI0F00210 Chr6 complement(39658..41619) [1962 bp, 653 aa] {ON}...   847   0.0  
YIL155C Chr9 complement(51759..53708) [1950 bp, 649 aa] {ON}  GU...   840   0.0  
Skud_9.13 Chr9 complement(28747..30696) [1950 bp, 649 aa] {ON} Y...   839   0.0  
Smik_9.14 Chr9 complement(29383..31341) [1959 bp, 652 aa] {ON} Y...   831   0.0  
Suva_9.32 Chr9 complement(46397..48013) [1617 bp, 538 aa] {ON} Y...   781   0.0  
KNAG0L02190 Chr12 (391987..393924) [1938 bp, 645 aa] {ON} Anc_5....   775   0.0  
Suva_10.526 Chr10 (903294..906728) [3435 bp, 1144 aa] {ON} YLR41...    35   0.69 

>SAKL0E15114g Chr5 (1256624..1258573) [1950 bp, 649 aa] {ON} highly
           similar to gnl|GLV|KLLA0A00418g Kluyveromyces lactis
           KLLA0A00418g and similar to YIL155C uniprot|P32191
           Saccharomyces cerevisiae YIL155C GUT2 Mitochondrial
           glycerol-3-phosphate dehydrogenase expression is
           repressed by both glucose and cAMP and derepressed by
           non-fermentable carbon sources in a Snf1p Rsf1p
           Hap2/3/4/5 complex dependent manner
          Length = 649

 Score = 1279 bits (3310), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 619/649 (95%), Positives = 619/649 (95%)

Query: 1   MFANATRRMXXXXXXXXXXXXXXXILWHQQQQQKSVINNDVTVTNPVQKSKINLPTRQDL 60
           MFANATRRM               ILWHQQQQQKSVINNDVTVTNPVQKSKINLPTRQDL
Sbjct: 1   MFANATRRMVVPAAFAAATVGGATILWHQQQQQKSVINNDVTVTNPVQKSKINLPTRQDL 60

Query: 61  LSKLSKTNQFDVLIIXXXXXXXXXXXXXXXRGLNVALVEMNDFASGTSSKSTKMAHGGVR 120
           LSKLSKTNQFDVLII               RGLNVALVEMNDFASGTSSKSTKMAHGGVR
Sbjct: 61  LSKLSKTNQFDVLIIGGGATGTGSALDAATRGLNVALVEMNDFASGTSSKSTKMAHGGVR 120

Query: 121 YLEKAFWELSKAQLDLVVEALNERAHMLYTAPHLCKILPIMIPVYNYWQAPYFYVGCKMY 180
           YLEKAFWELSKAQLDLVVEALNERAHMLYTAPHLCKILPIMIPVYNYWQAPYFYVGCKMY
Sbjct: 121 YLEKAFWELSKAQLDLVVEALNERAHMLYTAPHLCKILPIMIPVYNYWQAPYFYVGCKMY 180

Query: 181 DLFAGSQNLKSSYMLTASRAAEVAPMLDASKLKAGLVYHDGSFNDSRMNATLAVTAVEKG 240
           DLFAGSQNLKSSYMLTASRAAEVAPMLDASKLKAGLVYHDGSFNDSRMNATLAVTAVEKG
Sbjct: 181 DLFAGSQNLKSSYMLTASRAAEVAPMLDASKLKAGLVYHDGSFNDSRMNATLAVTAVEKG 240

Query: 241 ATVLNYMEVKQLIKNEQTGKVEGAVAQDRETGETFRIKAKVVVNATGPFSDRILQMDEDS 300
           ATVLNYMEVKQLIKNEQTGKVEGAVAQDRETGETFRIKAKVVVNATGPFSDRILQMDEDS
Sbjct: 241 ATVLNYMEVKQLIKNEQTGKVEGAVAQDRETGETFRIKAKVVVNATGPFSDRILQMDEDS 300

Query: 301 KGLPDDRLLQSSNINATISSKVAVANPQMVVPSAGVHIVLPSFYCPKEIGLLDAKTSDGR 360
           KGLPDDRLLQSSNINATISSKVAVANPQMVVPSAGVHIVLPSFYCPKEIGLLDAKTSDGR
Sbjct: 301 KGLPDDRLLQSSNINATISSKVAVANPQMVVPSAGVHIVLPSFYCPKEIGLLDAKTSDGR 360

Query: 361 VMFFLPWQGKVLAGTTDIPMKQIPENPTATEADIQDILKELQHYIKFPVKREDVLSAWAG 420
           VMFFLPWQGKVLAGTTDIPMKQIPENPTATEADIQDILKELQHYIKFPVKREDVLSAWAG
Sbjct: 361 VMFFLPWQGKVLAGTTDIPMKQIPENPTATEADIQDILKELQHYIKFPVKREDVLSAWAG 420

Query: 421 IRPLVKDPRKRIGENPHRVAASSTQELVRSHFLFTSDNDLVTIAGGKWTTYREMSEETIN 480
           IRPLVKDPRKRIGENPHRVAASSTQELVRSHFLFTSDNDLVTIAGGKWTTYREMSEETIN
Sbjct: 421 IRPLVKDPRKRIGENPHRVAASSTQELVRSHFLFTSDNDLVTIAGGKWTTYREMSEETIN 480

Query: 481 EVVKVGKFNAKPCITRKLKLAGAENYDPNLPAMLAQEYHLSSKMAEYLANNYGTRAPLIC 540
           EVVKVGKFNAKPCITRKLKLAGAENYDPNLPAMLAQEYHLSSKMAEYLANNYGTRAPLIC
Sbjct: 481 EVVKVGKFNAKPCITRKLKLAGAENYDPNLPAMLAQEYHLSSKMAEYLANNYGTRAPLIC 540

Query: 541 ELFKDDDKNKLPMAFGGKENVTVYGNVDFDSFRYPFTIGELKYSINNEYTRTALDFLMRR 600
           ELFKDDDKNKLPMAFGGKENVTVYGNVDFDSFRYPFTIGELKYSINNEYTRTALDFLMRR
Sbjct: 541 ELFKDDDKNKLPMAFGGKENVTVYGNVDFDSFRYPFTIGELKYSINNEYTRTALDFLMRR 600

Query: 601 TRYAFLDAKQALTAVDGTVKVMGDELSWDSNRRQEEREKATEFIKTFGV 649
           TRYAFLDAKQALTAVDGTVKVMGDELSWDSNRRQEEREKATEFIKTFGV
Sbjct: 601 TRYAFLDAKQALTAVDGTVKVMGDELSWDSNRRQEEREKATEFIKTFGV 649

>KLLA0A00418g Chr1 complement(33084..35012) [1929 bp, 642 aa] {ON}
           similar to uniprot|P32191 Saccharomyces cerevisiae
           YIL155C GUT2 Mitochondrial glycerol-3-phosphate
           dehydrogenase expression is repressed by both glucose
           and cAMP and derepressed by non-fermentable carbon
           sources in a Snf1p Rsf1p Hap2/3/4/5 complex dependent
           manner
          Length = 642

 Score = 1018 bits (2631), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 477/620 (76%), Positives = 552/620 (89%), Gaps = 7/620 (1%)

Query: 30  QQQQKSVINNDVTVTNPVQKSKINLPTRQDLLSKLSKTNQFDVLIIXXXXXXXXXXXXXX 89
           Q +  + + NDV+V+  ++KS ++LP+R +LLS+LSKT++FDVLII              
Sbjct: 30  QSRDTNTLQNDVSVST-IKKSNVDLPSRANLLSRLSKTDKFDVLIIGGGATGTGCALDAS 88

Query: 90  XRGLNVALVEMNDFASGTSSKSTKMAHGGVRYLEKAFWELSKAQLDLVVEALNERAHMLY 149
            RGLNVALVEMNDFASGTSSKSTKMAHGGVRYLEKAFWELSKAQLDLV+EALNERAHML 
Sbjct: 89  TRGLNVALVEMNDFASGTSSKSTKMAHGGVRYLEKAFWELSKAQLDLVIEALNERAHMLN 148

Query: 150 TAPHLCKILPIMIPVYNYWQAPYFYVGCKMYDLFAGSQNLKSSYMLTASRAAEVAPMLDA 209
           TAPHLCKILPIMIPVYNYWQ PYFYVG KMYDLFAGSQNLKSSY+L+ SRA+EVAPMLDA
Sbjct: 149 TAPHLCKILPIMIPVYNYWQVPYFYVGTKMYDLFAGSQNLKSSYLLSPSRASEVAPMLDA 208

Query: 210 SKLKAGLVYHDGSFNDSRMNATLAVTAVEKGATVLNYMEVKQLIKNEQTGKVEGAVAQDR 269
           SKLKAGLVYHDGSFNDSRMN++LA+TA+EKGATVLNY+++KQL+KN++TGKVEGA+A DR
Sbjct: 209 SKLKAGLVYHDGSFNDSRMNSSLAITAIEKGATVLNYVQIKQLVKNKETGKVEGAIAVDR 268

Query: 270 ETGETFRIKAKVVVNATGPFSDRILQMDEDSKGLPDDRLLQSSNINATISSKVAVANPQM 329
           ETG+ ++IKAKVVVNATGP+SDR+LQMD+   GLPDD +LQ  N NAT+S+K+AV NP+M
Sbjct: 269 ETGDEYQIKAKVVVNATGPYSDRLLQMDQSPTGLPDDSVLQKINENATVSTKIAVPNPKM 328

Query: 330 VVPSAGVHIVLPSFYCPKEIGLLDAKTSDGRVMFFLPWQGKVLAGTTDIPMKQIPENPTA 389
           VVPSAGVHIVLPSFYCPKEIGLLDA+TSDGRVMFFLPWQGKVLAGTTDIPMKQIPENPTA
Sbjct: 329 VVPSAGVHIVLPSFYCPKEIGLLDAQTSDGRVMFFLPWQGKVLAGTTDIPMKQIPENPTA 388

Query: 390 TEADIQDILKELQHYIKFPVKREDVLSAWAGIRPLVKDPRKRIGENPHRVAASSTQELVR 449
           TEADIQDILKELQHYI FPVKREDVLSAWAGIRPLVKDPRK          + STQ+LVR
Sbjct: 389 TEADIQDILKELQHYINFPVKREDVLSAWAGIRPLVKDPRKA------DSGSGSTQQLVR 442

Query: 450 SHFLFTSDNDLVTIAGGKWTTYREMSEETINEVVKVGKFNAKPCITRKLKLAGAENYDPN 509
           SHFLFTS ++LVTI+GGKWTTYREM+EETI+EVVKVG+FN+KPC+T+KLKL G EN++PN
Sbjct: 443 SHFLFTSPSNLVTISGGKWTTYREMAEETIDEVVKVGQFNSKPCVTKKLKLVGGENWNPN 502

Query: 510 LPAMLAQEYHLSSKMAEYLANNYGTRAPLICELFKDDDKNKLPMAFGGKENVTVYGNVDF 569
           L A+L+Q+YHLSS M+E+LANNYGTRAPLICELF +D +NKLP+A  G+ENV+V+G+VD+
Sbjct: 503 LSALLSQKYHLSSAMSEHLANNYGTRAPLICELFNEDPRNKLPVALAGQENVSVFGHVDY 562

Query: 570 DSFRYPFTIGELKYSINNEYTRTALDFLMRRTRYAFLDAKQALTAVDGTVKVMGDELSWD 629
           DSFRYP+TIGELKYS+  EY R  LDFLMRRTRYAFLDAKQAL AV+GTVKVMGDEL WD
Sbjct: 563 DSFRYPYTIGELKYSLKYEYARNCLDFLMRRTRYAFLDAKQALNAVEGTVKVMGDELGWD 622

Query: 630 SNRRQEEREKATEFIKTFGV 649
           S +RQ+E ++ATE+IKTFGV
Sbjct: 623 SKKRQDEIQQATEYIKTFGV 642

>Kwal_55.19649 s55 complement(65706..67631) [1926 bp, 641 aa] {ON}
           YIL155C (GUT2) - glycerol-3-phosphate dehydrogenase,
           mitochondrial [contig 159] FULL
          Length = 641

 Score = 1003 bits (2594), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 476/620 (76%), Positives = 540/620 (87%), Gaps = 7/620 (1%)

Query: 32  QQKSVINNDVTVTNPVQKSKINLPTRQDLLSKLSKTNQFDVLIIXXXXXXXXXXXXXXXR 91
           Q   +  ++V VT P++     LPTR +LL K++KT QFDVLII               R
Sbjct: 27  QNDKIARSEVRVTRPLKAEAPALPTRSELLEKMAKTEQFDVLIIGGGATGTGCAVDAATR 86

Query: 92  GLNVALVEMNDFASGTSSKSTKMAHGGVRYLEKAFWELSKAQLDLVVEALNERAHMLYTA 151
           GLNVALVEMNDFASGTSSKSTKMAHGGVRYLEKAFWELSKAQLDLV+EALNER HML TA
Sbjct: 87  GLNVALVEMNDFASGTSSKSTKMAHGGVRYLEKAFWELSKAQLDLVIEALNERGHMLNTA 146

Query: 152 PHLCKILPIMIPVYNYWQAPYFYVGCKMYDLFAGSQNLKSSYMLTASRAAEVAPMLDASK 211
           PHLCK+LPIMIPVYNYWQ PYFYVGCKMYDLFAGSQNLKSSYM++A RA+EVAPMLDAS 
Sbjct: 147 PHLCKVLPIMIPVYNYWQVPYFYVGCKMYDLFAGSQNLKSSYMMSAKRASEVAPMLDASI 206

Query: 212 LKAGLVYHDGSFNDSRMNATLAVTAVEKGATVLNYMEVKQLIKNEQTGKVEGAVAQDRET 271
           LKAGLVYHDGSFNDSRMNA LAVTA+E+GATVLNYMEV QL+KN+Q+G++EGA+ +DRET
Sbjct: 207 LKAGLVYHDGSFNDSRMNAALAVTAIERGATVLNYMEVTQLVKNDQSGRIEGAMVRDRET 266

Query: 272 GETFRIKAKVVVNATGPFSDRILQMDEDSKGLPDDRLLQSSN-INATISSKVAVANPQMV 330
           GE FRIKAKVVVN+TGPFSDR+LQMD    G P + L+Q +N  + +I S++AV+NP+MV
Sbjct: 267 GEEFRIKAKVVVNSTGPFSDRLLQMDAAKDGKPRNDLVQFANEGHDSIGSRIAVSNPRMV 326

Query: 331 VPSAGVHIVLPSFYCPKEIGLLDAKTSDGRVMFFLPWQGKVLAGTTDIPMKQIPENPTAT 390
           VPSAGVHIVLP+FYCPKEIGLLDAKTSDGRVMFFLPWQGKVLAGTTDIPMKQ+PENPTAT
Sbjct: 327 VPSAGVHIVLPAFYCPKEIGLLDAKTSDGRVMFFLPWQGKVLAGTTDIPMKQVPENPTAT 386

Query: 391 EADIQDILKELQHYIKFPVKREDVLSAWAGIRPLVKDPRK-RIGENPHRVAASSTQELVR 449
           EADIQDILKELQHYIKFPVKR DVLSAWAGIRPL++DPR  + G++      SSTQ LVR
Sbjct: 387 EADIQDILKELQHYIKFPVKRGDVLSAWAGIRPLIRDPRTIKEGDD-----VSSTQGLVR 441

Query: 450 SHFLFTSDNDLVTIAGGKWTTYREMSEETINEVVKVGKFNAKPCITRKLKLAGAENYDPN 509
           +HFL+TSDN LVTIAGGKWTTYREM+EETI+EVVK GKF AKPCIT+K+KLAGAE +DPN
Sbjct: 442 NHFLYTSDNGLVTIAGGKWTTYREMAEETIDEVVKQGKFQAKPCITKKIKLAGAEGWDPN 501

Query: 510 LPAMLAQEYHLSSKMAEYLANNYGTRAPLICELFKDDDKNKLPMAFGGKENVTVYGNVDF 569
             AMLAQEYHLSSKMAE+LANNYGTR+P+ICE+FK D+KN+LP+ FGG+ENVTVY NV+F
Sbjct: 502 FVAMLAQEYHLSSKMAEHLANNYGTRSPIICEMFKRDEKNQLPVTFGGRENVTVYKNVNF 561

Query: 570 DSFRYPFTIGELKYSINNEYTRTALDFLMRRTRYAFLDAKQALTAVDGTVKVMGDELSWD 629
           DSFRYPFTIGELKYS+  EYTRTALDFLMRRTR+ FLDA+QAL AVDGTV VMGDEL W 
Sbjct: 562 DSFRYPFTIGELKYSMQYEYTRTALDFLMRRTRFGFLDARQALGAVDGTVSVMGDELGWS 621

Query: 630 SNRRQEEREKATEFIKTFGV 649
            +RRQ ER++A+EFIKTFG+
Sbjct: 622 DDRRQAERQQASEFIKTFGL 641

>KLTH0E00836g Chr5 complement(83201..85126) [1926 bp, 641 aa] {ON}
           similar to uniprot|P32191 Saccharomyces cerevisiae
           YIL155C GUT2 Mitochondrial glycerol-3-phosphate
           dehydrogenase expression is repressed by both glucose
           and cAMP and derepressed by non-fermentable carbon
           sources in a Snf1p Rsf1p Hap2/3/4/5 complex dependent
           manner
          Length = 641

 Score =  999 bits (2583), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 474/620 (76%), Positives = 540/620 (87%), Gaps = 7/620 (1%)

Query: 32  QQKSVINNDVTVTNPVQKSKINLPTRQDLLSKLSKTNQFDVLIIXXXXXXXXXXXXXXXR 91
           Q+    +N+V V+ P++     +P+R +LL K++KT+QFDVL+I               R
Sbjct: 27  QRDRSAHNEVHVSIPLKAEAPAIPSRSELLDKMAKTDQFDVLVIGGGATGTGCAVDGATR 86

Query: 92  GLNVALVEMNDFASGTSSKSTKMAHGGVRYLEKAFWELSKAQLDLVVEALNERAHMLYTA 151
           GLNVALVEMNDFASGTSSKSTKMAHGGVRYLEKAFWELSKAQLDLV+EALNER HML TA
Sbjct: 87  GLNVALVEMNDFASGTSSKSTKMAHGGVRYLEKAFWELSKAQLDLVIEALNERGHMLNTA 146

Query: 152 PHLCKILPIMIPVYNYWQAPYFYVGCKMYDLFAGSQNLKSSYMLTASRAAEVAPMLDASK 211
           PHLCK+LPIMIPVYNYWQ PYFYVGCKMYDLFAGSQNLKSSYM+TA RA+EVAPMLDAS 
Sbjct: 147 PHLCKVLPIMIPVYNYWQVPYFYVGCKMYDLFAGSQNLKSSYMMTARRASEVAPMLDASI 206

Query: 212 LKAGLVYHDGSFNDSRMNATLAVTAVEKGATVLNYMEVKQLIKNEQTGKVEGAVAQDRET 271
           LKAGLVYHDGSFNDSRMNA LAVTA+E+GATVLNYMEV +L+KNE+TG+VEGA+A+DRET
Sbjct: 207 LKAGLVYHDGSFNDSRMNAALAVTAIERGATVLNYMEVTRLLKNEKTGRVEGAMARDRET 266

Query: 272 GETFRIKAKVVVNATGPFSDRILQMDEDSKGLPDDRLLQSSN-INATISSKVAVANPQMV 330
           G+ FRI AKVVVN+TGPFSDRILQMD    GLP + L+Q +N  + +I S+VAV+NP+MV
Sbjct: 267 GKEFRINAKVVVNSTGPFSDRILQMDNAKDGLPRNDLVQFANEGHDSIGSRVAVSNPRMV 326

Query: 331 VPSAGVHIVLPSFYCPKEIGLLDAKTSDGRVMFFLPWQGKVLAGTTDIPMKQIPENPTAT 390
           VPSAGVHIVLP+FYCPK+IGLLDAKTSDGRVMFFLPWQGKVLAGTTDIPMKQ+PENPTAT
Sbjct: 327 VPSAGVHIVLPAFYCPKQIGLLDAKTSDGRVMFFLPWQGKVLAGTTDIPMKQVPENPTAT 386

Query: 391 EADIQDILKELQHYIKFPVKREDVLSAWAGIRPLVKDPRK-RIGENPHRVAASSTQELVR 449
           EADIQDILKELQHYIKFPVKREDVLSAWAGIRPLV+DPR  + G++      SSTQ LVR
Sbjct: 387 EADIQDILKELQHYIKFPVKREDVLSAWAGIRPLVRDPRTLKEGDD-----VSSTQGLVR 441

Query: 450 SHFLFTSDNDLVTIAGGKWTTYREMSEETINEVVKVGKFNAKPCITRKLKLAGAENYDPN 509
           +HFLFTSDN LVTIAGGKWTTYREM+EETI+EVVK G F AKPCIT+K+KLAGAE +DPN
Sbjct: 442 NHFLFTSDNGLVTIAGGKWTTYREMAEETIDEVVKQGHFQAKPCITKKIKLAGAEGWDPN 501

Query: 510 LPAMLAQEYHLSSKMAEYLANNYGTRAPLICELFKDDDKNKLPMAFGGKENVTVYGNVDF 569
             AMLAQEYHLSSKMAE+LANNYGTR+P+ICE+F+ D+KN+LP+ FGG+ENVTVY NV+F
Sbjct: 502 FVAMLAQEYHLSSKMAEHLANNYGTRSPIICEMFRRDEKNQLPVTFGGRENVTVYKNVNF 561

Query: 570 DSFRYPFTIGELKYSINNEYTRTALDFLMRRTRYAFLDAKQALTAVDGTVKVMGDELSWD 629
           DSFRYPFTI ELKYS+  EYTRTALDFLMRRTR+ FLDAKQAL AV GTV +MGDEL WD
Sbjct: 562 DSFRYPFTIAELKYSVKYEYTRTALDFLMRRTRFGFLDAKQALEAVKGTVSIMGDELGWD 621

Query: 630 SNRRQEEREKATEFIKTFGV 649
            N+R  E ++A++FIKTFGV
Sbjct: 622 ENKRLSEIQQASDFIKTFGV 641

>TDEL0B02090 Chr2 complement(372755..374686) [1932 bp, 643 aa] {ON}
           Anc_5.711 YIL155C
          Length = 643

 Score =  970 bits (2507), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 457/613 (74%), Positives = 525/613 (85%), Gaps = 8/613 (1%)

Query: 37  INNDVTVTNPVQKSKINLPTRQDLLSKLSKTNQFDVLIIXXXXXXXXXXXXXXXRGLNVA 96
           I NDV + + V    + LP+R+DLLSKLSKT+QFDVL+I               RGLNVA
Sbjct: 39  IANDVALQSAVDTPNVKLPSREDLLSKLSKTDQFDVLVIGGGATGTGCAVDAATRGLNVA 98

Query: 97  LVEMNDFASGTSSKSTKMAHGGVRYLEKAFWELSKAQLDLVVEALNERAHMLYTAPHLCK 156
           LVEM+DFASGTSSKSTKMAHGGVRYLEKA ++LSKAQLDLV+EALNER HML TAPHLCK
Sbjct: 99  LVEMHDFASGTSSKSTKMAHGGVRYLEKAVFQLSKAQLDLVIEALNERGHMLNTAPHLCK 158

Query: 157 ILPIMIPVYNYWQAPYFYVGCKMYDLFAGSQNLKSSYMLTASRAAEVAPMLDASKLKAGL 216
           ILPIMIPVY YWQ PYFYVGCKMYDLFAGSQNLK+SY+LT  +AA++APMLD + LKAGL
Sbjct: 159 ILPIMIPVYTYWQIPYFYVGCKMYDLFAGSQNLKNSYLLTKRQAADIAPMLDPTTLKAGL 218

Query: 217 VYHDGSFNDSRMNATLAVTAVEKGATVLNYMEVKQLIKNEQTGKVEGAVAQDRETGETFR 276
           VYHDGSFNDSRMN  LAVTA+E GATVLNYMEVKQLIK+++TGKV+GA+  +RETGE F 
Sbjct: 219 VYHDGSFNDSRMNTALAVTAIENGATVLNYMEVKQLIKDKETGKVQGALVTNRETGEQFT 278

Query: 277 IKAKVVVNATGPFSDRILQMDEDSKGLPDDRLLQSSNINATISSKVAVANPQMVVPSAGV 336
           +KAKV VNATGP+SD++LQMDE+  G PD         NATIS+KVAV NP+MVVPSAGV
Sbjct: 279 VKAKVTVNATGPYSDKLLQMDENKDGKPDP---TKPLPNATISTKVAVENPKMVVPSAGV 335

Query: 337 HIVLPSFYCPKEIGLLDAKTSDGRVMFFLPWQGKVLAGTTDIPMKQIPENPTATEADIQD 396
           HI+LPSFYCP+E+GLLD KTSDGRVMFFLPWQGKVLAGTTDIPMKQ+P+ PTA E+DIQD
Sbjct: 336 HIILPSFYCPREMGLLDVKTSDGRVMFFLPWQGKVLAGTTDIPMKQVPQTPTAAESDIQD 395

Query: 397 ILKELQHYIKFPVKREDVLSAWAGIRPLVKDPRKRIGENPHRVAASSTQELVRSHFLFTS 456
           IL+ELQHYIKFPVKREDVLSAWAGIRPLV DPRK  G         STQ LVRSH  FT+
Sbjct: 396 ILQELQHYIKFPVKREDVLSAWAGIRPLVIDPRKSQGN-----TGGSTQGLVRSHLCFTT 450

Query: 457 DNDLVTIAGGKWTTYREMSEETINEVVKVGKFNAKPCITRKLKLAGAENYDPNLPAMLAQ 516
           DN +VTIAGGKWTTYREM+EETINEVVKVGKFN KPCITRKLKL+GAEN++PNL A+LAQ
Sbjct: 451 DNGMVTIAGGKWTTYREMAEETINEVVKVGKFNVKPCITRKLKLSGAENWNPNLAALLAQ 510

Query: 517 EYHLSSKMAEYLANNYGTRAPLICELFKDDDKNKLPMAFGGKENVTVYGNVDFDSFRYPF 576
           +YHLS  M+ +L+ NYGTRAPLICE+F++D++N+LP+ FGG+ENVTVYGNV+FDSFRYPF
Sbjct: 511 KYHLSGAMSNHLSENYGTRAPLICEMFQEDERNQLPVTFGGRENVTVYGNVNFDSFRYPF 570

Query: 577 TIGELKYSINNEYTRTALDFLMRRTRYAFLDAKQALTAVDGTVKVMGDELSWDSNRRQEE 636
           TIGEL YS++ EYTRTALDFLMRRTR+AFLDA+QAL AV+GTV VMGD+L+WDS RR+ E
Sbjct: 571 TIGELNYSVDYEYTRTALDFLMRRTRFAFLDARQALDAVEGTVTVMGDKLNWDSTRRKHE 630

Query: 637 REKATEFIKTFGV 649
            EK+ EFI+TFGV
Sbjct: 631 IEKSKEFIRTFGV 643

>CAGL0H06699g Chr8 (665295..667247) [1953 bp, 650 aa] {ON} similar
           to uniprot|P32191 Saccharomyces cerevisiae YIL155c GUT2
          Length = 650

 Score =  954 bits (2467), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 459/620 (74%), Positives = 522/620 (84%), Gaps = 13/620 (2%)

Query: 36  VINNDVTVTNPVQKSKINLPTRQDLLSKLSKTNQFDVLIIXXXXXXXXXXXXXXXRGLNV 95
           +I+NDV++ +PV+K  + LPTR +LL KLS+TNQFDVLII               RGLNV
Sbjct: 38  LISNDVSLISPVEKPDVKLPTRDELLDKLSRTNQFDVLIIGGGATGTGCALDAATRGLNV 97

Query: 96  ALVEMNDFASGTSSKSTKMAHGGVRYLEKAFWELSKAQLDLVVEALNERAHMLYTAPHLC 155
           ALVE NDFASGTSSKSTKMAHGGVRYLEKAFWE+SKAQLDLV+EALNERAH+L TAPHLC
Sbjct: 98  ALVEKNDFASGTSSKSTKMAHGGVRYLEKAFWEMSKAQLDLVIEALNERAHLLNTAPHLC 157

Query: 156 KILPIMIPVYNYWQAPYFYVGCKMYDLFAGSQNLKSSYMLTASRAAEVAPMLDASKLKAG 215
           K+LPI+IPVYNYWQ PYFY GCKMYDLFAGSQNLK SY+++ +   EVAPMLD S LKAG
Sbjct: 158 KLLPIIIPVYNYWQVPYFYAGCKMYDLFAGSQNLKGSYLMSKNATMEVAPMLDGSNLKAG 217

Query: 216 LVYHDGSFNDSRMNATLAVTAVEKGATVLNYMEVKQLIKNEQTGKVEGAVAQDRETGETF 275
           LVYHDGSFND+RMNATLAVTA+E  ATVLNYMEVKQL+K++  GKV GAV +DRETG+T+
Sbjct: 218 LVYHDGSFNDTRMNATLAVTAIENSATVLNYMEVKQLVKDKD-GKVAGAVVEDRETGKTY 276

Query: 276 RIKAKVVVNATGPFSDRILQMDEDSKGLPDDRLLQSSNI---NAT---ISSKVAVANPQM 329
            ++AKVVVNATGP+SDR+LQMD +  GLPD+ + ++  I   NAT   I S+VAV  P M
Sbjct: 277 SVRAKVVVNATGPYSDRLLQMDANPDGLPDEVVQKTEPIIDGNATVKSIMSQVAVTKPNM 336

Query: 330 VVPSAGVHIVLPSFYCPKEIGLLDAKTSDGRVMFFLPWQGKVLAGTTDIPMKQIPENPTA 389
           VVPSAGVHI+LPSFYCPKE+GLLDAKTSDGRVMFFLPWQGKVLAGTTDIP+KQ+PENPTA
Sbjct: 337 VVPSAGVHIILPSFYCPKEMGLLDAKTSDGRVMFFLPWQGKVLAGTTDIPLKQVPENPTA 396

Query: 390 TEADIQDILKELQHYIKFPVKREDVLSAWAGIRPLVKDPRKRIGENPHRVAASSTQELVR 449
           TEADIQDILKELQ YIKFPVKREDVLSAWAGIRPLV DPRK+        A  STQ LVR
Sbjct: 397 TEADIQDILKELQPYIKFPVKREDVLSAWAGIRPLVTDPRKK------SKADGSTQGLVR 450

Query: 450 SHFLFTSDNDLVTIAGGKWTTYREMSEETINEVVKVGKFNAKPCITRKLKLAGAENYDPN 509
           SHF+FTSD+ LVTIAGGKWTTYR M+EETI+EVVK GKF+AKPCITRKLKLAGAEN+DPN
Sbjct: 451 SHFIFTSDHGLVTIAGGKWTTYRAMAEETIDEVVKNGKFDAKPCITRKLKLAGAENWDPN 510

Query: 510 LPAMLAQEYHLSSKMAEYLANNYGTRAPLICELFKDDDKNKLPMAFGGKENVTVYGNVDF 569
           LPA+LAQ+YHLS KM+ YLA NYGTRAPLICE+F +D +N+LP+    KE   V G+VDF
Sbjct: 511 LPALLAQKYHLSQKMSHYLAENYGTRAPLICEMFHEDPENRLPLLLADKEQTPVLGHVDF 570

Query: 570 DSFRYPFTIGELKYSINNEYTRTALDFLMRRTRYAFLDAKQALTAVDGTVKVMGDELSWD 629
           DSFRYP TI ELKY+I  EY RTALDFLMRRTR+AFLDAKQAL AV+GTV++MGD L WD
Sbjct: 571 DSFRYPITIAELKYAIKYEYARTALDFLMRRTRFAFLDAKQALNAVEGTVRLMGDSLGWD 630

Query: 630 SNRRQEEREKATEFIKTFGV 649
             RRQ+E   +TEFIKTFGV
Sbjct: 631 EQRRQDEIRYSTEFIKTFGV 650

>Ecym_4010 Chr4 complement(24630..26564) [1935 bp, 644 aa] {ON}
           similar to Ashbya gossypii AFR295W
          Length = 644

 Score =  937 bits (2422), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 449/631 (71%), Positives = 526/631 (83%), Gaps = 18/631 (2%)

Query: 25  ILWHQQQQQKSVIN-----NDVTVTNPVQKSKINLPTRQDLLSKLSKTNQFDVLIIXXXX 79
           + W    QQ ++ N     N++     ++K     P+R  LL KL KT+QFDVL+I    
Sbjct: 26  VSWQFVSQQHAISNTGFVANELPAELKLEKHAPAPPSRAQLLEKLQKTDQFDVLVIGGGA 85

Query: 80  XXXXXXXXXXXRGLNVALVEMNDFASGTSSKSTKMAHGGVRYLEKAFWELSKAQLDLVVE 139
                      RGLNVAL+EMND+ASGTSSKSTKMAHGGVRYLEKAFWELSKAQLDLV+E
Sbjct: 86  SGTGSALDAATRGLNVALLEMNDYASGTSSKSTKMAHGGVRYLEKAFWELSKAQLDLVIE 145

Query: 140 ALNERAHMLYTAPHLCKILPIMIPVYNYWQAPYFYVGCKMYDLFAGSQNLKSSYMLTASR 199
           ALNERAHML+TAPHLCKILPIMIPVY +WQ PYFYVG KMYD FAG QNLKSSY+L+A+ 
Sbjct: 146 ALNERAHMLHTAPHLCKILPIMIPVYKWWQVPYFYVGTKMYDFFAGKQNLKSSYLLSATG 205

Query: 200 AAEVAPMLDASKLKAGLVYHDGSFNDSRMNATLAVTAVEKGATVLNYMEVKQLIKNEQTG 259
           A++VAPMLDASKLKAGLVYHDGSFNDSRMN+TLAVTA+E GAT+LNYMEVKQL+KN +TG
Sbjct: 206 ASQVAPMLDASKLKAGLVYHDGSFNDSRMNSTLAVTAIENGATLLNYMEVKQLLKNPETG 265

Query: 260 KVEGAVAQDRETGETFRIKAKVVVNATGPFSDRILQMDEDSKGLPDDRLLQSSNINATIS 319
           KVEGA+A DRETG+ + +KAKVVV+ATGPFSDRILQM+   KGLPDD  L  +N  ATI+
Sbjct: 266 KVEGAIAVDRETGKQYSVKAKVVVSATGPFSDRILQMENHPKGLPDDLSLSKANEGATIT 325

Query: 320 SKVAVANPQMVVPSAGVHIVLPSFYCPKEIGLLDAKTSDGRVMFFLPWQGKVLAGTTDIP 379
           +KVAVA+P+MVVPS+GVHI+LPSFYCPK++GLLDA+TSDGRVMFFLPWQGKVLAGTTDIP
Sbjct: 326 TKVAVADPKMVVPSSGVHIILPSFYCPKDMGLLDAETSDGRVMFFLPWQGKVLAGTTDIP 385

Query: 380 MKQIPENPTATEADIQDILKELQHYIKFPVKREDVLSAWAGIRPLVKDPRKRIGENPHRV 439
           MKQ+PENPTATEADIQDILKELQHYIKFPVKREDV SAWAGIRPLVKDPRK   +N    
Sbjct: 386 MKQVPENPTATEADIQDILKELQHYIKFPVKREDVQSAWAGIRPLVKDPRK---DN---- 438

Query: 440 AASSTQELVRSHFLFTSDNDLVTIAGGKWTTYREMSEETINEVVKVGKF-NAKPCITRKL 498
             S TQ+LVRSHFLFTSD+ LVTI+GGKWTTYREM++ETI+EVVKVG F NAKPCITRK+
Sbjct: 439 --SDTQDLVRSHFLFTSDSGLVTISGGKWTTYREMAQETIDEVVKVGNFVNAKPCITRKI 496

Query: 499 KLAGAENYDPNLPAMLAQEYHLSSKMAEYLANNYGTRAPLICELFKDDDKNKLPMAFGGK 558
           KL G+EN+DPNLPA+L+Q+Y+L   ++EYL+ NYGT+A  ICE+F+ D +N+LP++   +
Sbjct: 497 KLVGSENWDPNLPAILSQQYNLPPVLSEYLSENYGTKAAAICEIFQSDKRNQLPVSLAAE 556

Query: 559 ENVTVYGNVDFDSFRYPFTIGELKYSINNEYTRTALDFLMRRTRYAFLDAKQALTAVDGT 618
           +      NVD+D+FRYPFT+GELKY+I NEY R  LDFLMRRTRYAFLDAKQA+ AV GT
Sbjct: 557 KAA---ANVDYDAFRYPFTVGELKYNIRNEYARKPLDFLMRRTRYAFLDAKQAVAAVPGT 613

Query: 619 VKVMGDELSWDSNRRQEEREKATEFIKTFGV 649
           VK+MGDEL WDS +R+ E + A EFIKTFGV
Sbjct: 614 VKIMGDELGWDSAKREMETKYAIEFIKTFGV 644

>TPHA0E00150 Chr5 complement(11922..13862) [1941 bp, 646 aa] {ON}
           Anc_5.711 YIL155C
          Length = 646

 Score =  929 bits (2401), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 436/615 (70%), Positives = 514/615 (83%), Gaps = 10/615 (1%)

Query: 35  SVINNDVTVTNPVQKSKINLPTRQDLLSKLSKTNQFDVLIIXXXXXXXXXXXXXXXRGLN 94
           S+I N+  + NPV    +N+PTR +L++ L  T+QFDVLII               RGLN
Sbjct: 42  SIIQNEAVLANPVDSPNVNIPTRSELVNNLKTTDQFDVLIIGGGATGSGSALDAATRGLN 101

Query: 95  VALVEMNDFASGTSSKSTKMAHGGVRYLEKAFWELSKAQLDLVVEALNERAHMLYTAPHL 154
           VALVE +DFASGTSSKSTKMAHGGVRYLEKA ++LSKAQLDLV+EALNERAH+LYTAPHL
Sbjct: 102 VALVEKDDFASGTSSKSTKMAHGGVRYLEKAVFQLSKAQLDLVIEALNERAHLLYTAPHL 161

Query: 155 CKILPIMIPVYNYWQAPYFYVGCKMYDLFAGSQNLKSSYMLTASRAAEVAPMLDASKLKA 214
           CKILPIMIPVY YWQ PYFY G KMYD+FAGSQNLKSSY+++ + A E+APMLD SKLKA
Sbjct: 162 CKILPIMIPVYKYWQVPYFYAGVKMYDIFAGSQNLKSSYLVSKANACEIAPMLDESKLKA 221

Query: 215 GLVYHDGSFNDSRMNATLAVTAVEKGATVLNYMEVKQLIKNEQTGKVEGAVAQDRETGET 274
           GLVYHDG+FNDSRMN+TLA+TA+E GATVLNYMEVKQL+K+  + ++ GA+ +D ETGE 
Sbjct: 222 GLVYHDGTFNDSRMNSTLAITAIENGATVLNYMEVKQLLKDPSSDQLTGAIVEDIETGEK 281

Query: 275 FRIKAKVVVNATGPFSDRILQMDEDSKGLPDDRLLQSSNINATISSKVAVANPQMVVPSA 334
            +I AKV+VNATGP+SD+ILQMD +  G PD+   QS+    +I++KVAV NP MVVPSA
Sbjct: 282 IQINAKVIVNATGPYSDKILQMDNNKNGKPDE-FTQSA--ETSIATKVAVQNPHMVVPSA 338

Query: 335 GVHIVLPSFYCPKEIGLLDAKTSDGRVMFFLPWQGKVLAGTTDIPMKQIPENPTATEADI 394
           GVHI+LPSFYCP+E+GLLDA TSDGRVMFFLPWQGKVLAGTTDIPMK +PENPTATEADI
Sbjct: 339 GVHIILPSFYCPREMGLLDANTSDGRVMFFLPWQGKVLAGTTDIPMKTVPENPTATEADI 398

Query: 395 QDILKELQHYIKFPVKREDVLSAWAGIRPLVKDPRKRIGENPHRVAASSTQELVRSHFLF 454
           QDILKELQHYIKFPVKREDVLSAWAGIRPLV+DPRK   E        +TQELVRSHF+F
Sbjct: 399 QDILKELQHYIKFPVKREDVLSAWAGIRPLVQDPRKTPKE-------GATQELVRSHFIF 451

Query: 455 TSDNDLVTIAGGKWTTYREMSEETINEVVKVGKFNAKPCITRKLKLAGAENYDPNLPAML 514
           TSD+ LVTIAGGKWTTYREM+EETI+ VVK GKFN KPC TRKLKLAG ENYDPNL A+L
Sbjct: 452 TSDHGLVTIAGGKWTTYREMAEETIDTVVKNGKFNVKPCSTRKLKLAGGENYDPNLAALL 511

Query: 515 AQEYHLSSKMAEYLANNYGTRAPLICELFKDDDKNKLPMAFGGKENVTVYGNVDFDSFRY 574
           AQ+YHL SK++E+LANNYGTR+PLIC++F  DD N+LP+   GKE   VYG VDFDSFRY
Sbjct: 512 AQKYHLPSKLSEHLANNYGTRSPLICDMFVADDHNRLPIYLAGKEENKVYGTVDFDSFRY 571

Query: 575 PFTIGELKYSINNEYTRTALDFLMRRTRYAFLDAKQALTAVDGTVKVMGDELSWDSNRRQ 634
           P++I E+KY +++EY RT LDFLMRR+R+AFLDAKQAL +V+GTVK+MGDEL+WD  RR+
Sbjct: 572 PYSIAEVKYCVHHEYARTTLDFLMRRSRFAFLDAKQALKSVEGTVKIMGDELNWDEERRK 631

Query: 635 EEREKATEFIKTFGV 649
           +E + + E+IKTFGV
Sbjct: 632 QETDYSIEYIKTFGV 646

>ZYRO0B16522g Chr2 (1340223..1342154) [1932 bp, 643 aa] {ON} highly
           similar to gnl|GLV|KLLA0A00418g Kluyveromyces lactis
           KLLA0A00418g and similar to YIL155C uniprot|P32191
           Saccharomyces cerevisiae YIL155C GUT2 Mitochondrial
           glycerol-3-phosphate dehydrogenase expression is
           repressed by both glucose and cAMP and derepressed by
           non-fermentable carbon sources in a Snf1p Rsf1p
           Hap2/3/4/5 complex dependent manner
          Length = 643

 Score =  926 bits (2392), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 432/624 (69%), Positives = 523/624 (83%), Gaps = 9/624 (1%)

Query: 27  WHQQQQQKSVINNDVTVTNPVQ-KSKINLPTRQDLLSKLSKTNQFDVLIIXXXXXXXXXX 85
           +   ++Q S ++N+V V +P+  +  +NLP+R+DLLS L KT++FDVLII          
Sbjct: 28  YMDSRRQSSALSNEVPVVSPIDPRPSVNLPSREDLLSNLQKTDKFDVLIIGGGASGAGSA 87

Query: 86  XXXXXRGLNVALVEMNDFASGTSSKSTKMAHGGVRYLEKAFWELSKAQLDLVVEALNERA 145
                RGLNVA VE NDFASGTSSKSTKMAHGGVRYLEKA +ELS+AQLDLV+EALNER 
Sbjct: 88  LDAATRGLNVACVEANDFASGTSSKSTKMAHGGVRYLEKAVFELSRAQLDLVIEALNERG 147

Query: 146 HMLYTAPHLCKILPIMIPVYNYWQAPYFYVGCKMYDLFAGSQNLKSSYMLTASRAAEVAP 205
           HML TAPHLCKILPIMIPVY+YWQ PYF+ GCK+YD FAG QNL+SSY+L+ + A+E+AP
Sbjct: 148 HMLETAPHLCKILPIMIPVYSYWQVPYFFAGCKLYDWFAGKQNLRSSYLLSKTYASELAP 207

Query: 206 MLDASKLKAGLVYHDGSFNDSRMNATLAVTAVEKGATVLNYMEVKQLIKNEQTGKVEGAV 265
           MLD SKLKAGLVYHDGSFNDSRMN+TLA++A+E GATVLNY++V QL+K+  T KVEGA+
Sbjct: 208 MLDESKLKAGLVYHDGSFNDSRMNSTLAISAIEHGATVLNYVKVTQLLKDSSTNKVEGAI 267

Query: 266 AQDRETGETFRIKAKVVVNATGPFSDRILQMDEDSKGLPDDRLLQSSNINATISSKVAVA 325
            +D+ETG+ +++KAKV VNATGP+SD ILQMD++  GLPD +  Q +N+  +I+++VAV 
Sbjct: 268 VEDQETGKQYQVKAKVTVNATGPYSDLILQMDKNKNGLPDPQPPQPANV--SIATEVAVN 325

Query: 326 NPQMVVPSAGVHIVLPSFYCPKEIGLLDAKTSDGRVMFFLPWQGKVLAGTTDIPMKQIPE 385
            P MVVPSAGVHI+LPS+YCPK +GLLD KT+DGRVMFFLPWQGKVLAGTTDIPMK +P+
Sbjct: 326 KPNMVVPSAGVHIILPSYYCPKTVGLLDVKTADGRVMFFLPWQGKVLAGTTDIPMKTVPQ 385

Query: 386 NPTATEADIQDILKELQHYIKFPVKREDVLSAWAGIRPLVKDPRKRIGENPHRVAASSTQ 445
           NPTATEADIQDIL+ELQHYIKFPV+REDVLSAWAGIRPLV DPRKR      +    ST+
Sbjct: 386 NPTATEADIQDILRELQHYIKFPVRREDVLSAWAGIRPLVMDPRKR------KDTGGSTE 439

Query: 446 ELVRSHFLFTSDNDLVTIAGGKWTTYREMSEETINEVVKVGKFNAKPCITRKLKLAGAEN 505
            LVR+H +FTS+  L+T+AGGKWTTYREM+E+TI+EVVK G F+ KPCITRK+KLAG EN
Sbjct: 440 GLVRNHLIFTSETGLITLAGGKWTTYREMAEQTIDEVVKEGGFSVKPCITRKIKLAGGEN 499

Query: 506 YDPNLPAMLAQEYHLSSKMAEYLANNYGTRAPLICELFKDDDKNKLPMAFGGKENVTVYG 565
           + PNL A+LAQ Y LS  M+++L+NNYGTRAP+ICELFK+D++N+LP+AFGG+ENVTV  
Sbjct: 500 WTPNLSALLAQHYKLSQAMSQHLSNNYGTRAPIICELFKEDERNQLPVAFGGRENVTVLH 559

Query: 566 NVDFDSFRYPFTIGELKYSINNEYTRTALDFLMRRTRYAFLDAKQALTAVDGTVKVMGDE 625
           +V+FDSFRYPFTIGE  YSI +EY+R A DFLMRRTRYAFLDA  ALTAV+GTVKVMGDE
Sbjct: 560 HVNFDSFRYPFTIGEFLYSIRHEYSRKATDFLMRRTRYAFLDAANALTAVEGTVKVMGDE 619

Query: 626 LSWDSNRRQEEREKATEFIKTFGV 649
           L+WDS RRQ E E+ TEFIKTFGV
Sbjct: 620 LNWDSARRQREIEECTEFIKTFGV 643

>Kpol_1043.77 s1043 (168788..170761) [1974 bp, 657 aa] {ON}
           (168788..170761) [1974 nt, 658 aa]
          Length = 657

 Score =  923 bits (2385), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 448/626 (71%), Positives = 529/626 (84%), Gaps = 19/626 (3%)

Query: 35  SVINNDVTVTNPVQKSKINLPTRQDLLSKLSKTNQFDVLIIXXXXXXXXXXXXXXXRGLN 94
           + + ND +  +PV  + + LP+R DLLSKL KT QFDVLII               RGLN
Sbjct: 40  NAVYNDPSKPSPVDTTDVRLPSRTDLLSKLKKTYQFDVLIIGGGATGTGCAIDAATRGLN 99

Query: 95  VALVEMNDFASGTSSKSTKMAHGGVRYLEKAFWELSKAQLDLVVEALNERAHMLYTAPHL 154
           VALVE ND+ASGTSSKSTKMAHGGVRYLEKA ++LSKAQLDLV+EALNERAH+LYTAPHL
Sbjct: 100 VALVEKNDYASGTSSKSTKMAHGGVRYLEKAVFQLSKAQLDLVIEALNERAHLLYTAPHL 159

Query: 155 CKILPIMIPVYNYWQAPYFYVGCKMYDLFAGSQNLKSSYMLTASRAAEVAPMLDASKLKA 214
           CKILPIMIPVY YWQ PYFYVG KMYDLFAGSQNLKSSY+L+ S A E+APMLD+SKLKA
Sbjct: 160 CKILPIMIPVYQYWQVPYFYVGTKMYDLFAGSQNLKSSYLLSKSSACEIAPMLDSSKLKA 219

Query: 215 GLVYHDGSFNDSRMNATLAVTAVEKGATVLNYMEVKQLIKNEQTGKVEGAVAQDRETGET 274
           GLVYHDGSFNDSRMNATLA++A+EKGATVLNYMEVKQL+K+E+T K+ GA+ +D ETGET
Sbjct: 220 GLVYHDGSFNDSRMNATLAISAIEKGATVLNYMEVKQLVKDEKTQKLTGAIVEDTETGET 279

Query: 275 FRIKAKVVVNATGPFSDRILQMDEDSKGLPD--DRLLQSSNINA--------TISSKVAV 324
           ++IKAKV+VNATGP+SD ILQMD +  GLPD   + +++ N+          +IS +VAV
Sbjct: 280 YQIKAKVIVNATGPYSDTILQMDNNKNGLPDMFKKEIETGNLKTPLNVITPESISKEVAV 339

Query: 325 ANPQMVVPSAGVHIVLPSFYCPKEIGLLDAKTSDGRVMFFLPWQGKVLAGTTDIPMKQIP 384
            NP MVVPSAGVHI+LPS+YCP E+GLLDA T+DGRVMFFLPWQGKVLAGTTDIPMK +P
Sbjct: 340 QNPNMVVPSAGVHIILPSYYCPSEMGLLDANTADGRVMFFLPWQGKVLAGTTDIPMKTVP 399

Query: 385 ENPTATEADIQDILKELQHYIKFPVKREDVLSAWAGIRPLVKDPRKRIGENPHRVAASST 444
           ENPTATEADIQDILKELQHYIKFPVKREDVLSAWAGIRPLV+DPR + G         +T
Sbjct: 400 ENPTATEADIQDILKELQHYIKFPVKREDVLSAWAGIRPLVQDPRVQKG--------GAT 451

Query: 445 QELVRSHFLFTSDNDLVTIAGGKWTTYREMSEETINEVVKVGKFNAKPCITRKLKLAGAE 504
           QE+VRSHF+FTSDN LVTIAGGKWTTYREM+EETI+EVVK GKFNAKPCITRKLKLAGAE
Sbjct: 452 QEVVRSHFIFTSDNGLVTIAGGKWTTYREMAEETIDEVVKQGKFNAKPCITRKLKLAGAE 511

Query: 505 NYDPNLPAMLAQEYHLSSKMAEYLANNYGTRAPLICELFKDDDKNKLPMAFGGKENVTVY 564
           N+D NL A+L+Q+Y++S+ MAE+LANNYGTR+P+ICE+ K+ D+NKLP+   G+EN ++ 
Sbjct: 512 NWDANLAALLSQKYNVSTPMAEHLANNYGTRSPIICEMMKESDENKLPVNLAGRENESIS 571

Query: 565 -GNVDFDSFRYPFTIGELKYSINNEYTRTALDFLMRRTRYAFLDAKQALTAVDGTVKVMG 623
             +V +DSFRYP+TI ELKYS++ EYTRTALDFLMRRTRYAFLDAK+AL AV+GTVK+MG
Sbjct: 572 NAHVGYDSFRYPYTIAELKYSMDYEYTRTALDFLMRRTRYAFLDAKEALDAVNGTVKIMG 631

Query: 624 DELSWDSNRRQEEREKATEFIKTFGV 649
           D L+WD++RR+ E+  AT++IKTFGV
Sbjct: 632 DHLNWDNDRREREKVYATDYIKTFGV 657

>AFR295W Chr6 (970178..972073) [1896 bp, 631 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL155C (GUT2)
          Length = 631

 Score =  922 bits (2384), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 436/596 (73%), Positives = 507/596 (85%), Gaps = 14/596 (2%)

Query: 55  PTRQDLLSKLSKTNQFDVLIIXXXXXXXXXXXXXXXRGLNVALVEMNDFASGTSSKSTKM 114
           P+R +LL KL KTNQFDVL+I               RGLNVAL+EMNDFASGTSSKSTKM
Sbjct: 49  PSRSELLEKLQKTNQFDVLVIGGGASGAGSALDASTRGLNVALLEMNDFASGTSSKSTKM 108

Query: 115 AHGGVRYLEKAFWELSKAQLDLVVEALNERAHMLYTAPHLCKILPIMIPVYNYWQAPYFY 174
           AHGGVRYLEKA WELSKAQLDLV+EALNERAH+LYTAPHLCK+LPIMIPVY +WQ PYFY
Sbjct: 109 AHGGVRYLEKAVWELSKAQLDLVIEALNERAHLLYTAPHLCKVLPIMIPVYKWWQVPYFY 168

Query: 175 VGCKMYDLFAGSQNLKSSYMLTASRAAEVAPMLDASKLKAGLVYHDGSFNDSRMNATLAV 234
           VG KMYD FAGSQNLKSSY+L+AS A EVAPMLDASKLKAGLVYHDGSFNDSRMNAT+AV
Sbjct: 169 VGTKMYDFFAGSQNLKSSYLLSASAAGEVAPMLDASKLKAGLVYHDGSFNDSRMNATIAV 228

Query: 235 TAVEKGATVLNYMEVKQLIKNEQTGKVEGAVAQDRETGETFRIKAKVVVNATGPFSDRIL 294
           TA+E GATVLNYMEVK+LIKN + GKVEGAVA DRETG+ + ++AKVVVNATGPFSDR+L
Sbjct: 229 TAIENGATVLNYMEVKRLIKNPEDGKVEGAVAMDRETGKEYAVRAKVVVNATGPFSDRLL 288

Query: 295 QMDEDSKGLPDDRLLQSSNINATISSKVAVANPQMVVPSAGVHIVLPSFYCPKEIGLLDA 354
           QMD   +GLPDD++L + N ++TI+++VAVANP+MVVPS+GVHI+LPS+YCPK +GLLDA
Sbjct: 289 QMDNHPEGLPDDKILDAINKDSTIATEVAVANPKMVVPSSGVHIILPSYYCPKNMGLLDA 348

Query: 355 KTSDGRVMFFLPWQGKVLAGTTDIPMKQIPENPTATEADIQDILKELQHYIKFPVKREDV 414
           +TSDGRVMFFLPWQGKVLAGTTDIPMKQ+P NPTATEADIQDILKELQHYIKFPVKREDV
Sbjct: 349 ETSDGRVMFFLPWQGKVLAGTTDIPMKQVPANPTATEADIQDILKELQHYIKFPVKREDV 408

Query: 415 LSAWAGIRPLVKDPRKRIGENPHRVAASSTQELVRSHFLFTSDNDLVTIAGGKWTTYREM 474
            SAWAGIRPLVKDPRK +         S TQ LVRSH +FTS N +VTI+GGKWTTYREM
Sbjct: 409 QSAWAGIRPLVKDPRKNL---------SDTQGLVRSHLVFTSKNGMVTISGGKWTTYREM 459

Query: 475 SEETINEVVKVGKF-NAKPCITRKLKLAGAENYDPNLPAMLAQEYHLSSKMAEYLANNYG 533
           +EET+NEVVKVGKF NAKPCITRKLKL+GAE++D NLPA+L+ +Y++   +AE+L+ NYG
Sbjct: 460 AEETVNEVVKVGKFVNAKPCITRKLKLSGAEHWDANLPALLSHQYNIPPLLAEHLSQNYG 519

Query: 534 TRAPLICELFKDDDKNKLPMAFGGKENVTVYGNVDFDSFRYPFTIGELKYSINNEYTRTA 593
           T+A  +CELF+DD  N LP++    +  +    +D+++FRYP+TIGELK+++ +EY RT 
Sbjct: 520 TKAAQVCELFEDDRANMLPVSLAADKPTS----IDYNAFRYPYTIGELKFTMTHEYARTP 575

Query: 594 LDFLMRRTRYAFLDAKQALTAVDGTVKVMGDELSWDSNRRQEEREKATEFIKTFGV 649
           LDFLMRRTRYAFLDAKQAL AVDGTVKVMGD L WDS +R  E + A E+IKTFGV
Sbjct: 576 LDFLMRRTRYAFLDAKQALKAVDGTVKVMGDALGWDSAKRVAETKYAIEYIKTFGV 631

>KAFR0D02170 Chr4 complement(435640..437622) [1983 bp, 660 aa] {ON}
           Anc_5.711 YIL155C
          Length = 660

 Score =  920 bits (2379), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 440/624 (70%), Positives = 515/624 (82%), Gaps = 20/624 (3%)

Query: 40  DVTVTNPVQKSKINLPTRQDLLSKLSKTNQFDVLIIXXXXXXXXXXXXXXXRGLNVALVE 99
           D  + +P+ K  +NLPTR DL+SKL+KTNQFDVL+I               RGLNVALVE
Sbjct: 43  DGKLISPLDKRSVNLPTRNDLISKLNKTNQFDVLVIGGGATGAGCALDATTRGLNVALVE 102

Query: 100 MNDFASGTSSKSTKMAHGGVRYLEKAFWELSKAQLDLVVEALNERAHMLYTAPHLCKILP 159
             DFASGTSSKSTKMAHGGVRYLEKAFWELSKAQLDLV+EALNERAH+L TAPHLCKILP
Sbjct: 103 KYDFASGTSSKSTKMAHGGVRYLEKAFWELSKAQLDLVIEALNERAHLLNTAPHLCKILP 162

Query: 160 IMIPVYNYWQAPYFYVGCKMYDLFAGSQNLKSSYMLTASRAAEVAPMLDASKLKAGLVYH 219
           IMIPVYNYWQ PYFY GCKMYDLFAGSQNLKSSY+L+   AA+VAPMLD +KLKAGLVYH
Sbjct: 163 IMIPVYNYWQIPYFYAGCKMYDLFAGSQNLKSSYLLSKRSAADVAPMLDTTKLKAGLVYH 222

Query: 220 DGSFNDSRMNATLAVTAVEKGATVLNYMEVKQLIKNEQTGKVEGAVAQDRETGETFRIKA 279
           DG+FNDSRMN+TLAVTA+E G+TVLNYMEVKQL+K + +GK+EGA+ +D ETG+ + IKA
Sbjct: 223 DGTFNDSRMNSTLAVTAIENGSTVLNYMEVKQLLKEKGSGKIEGAIVEDLETGKQYNIKA 282

Query: 280 KVVVNATGPFSDRILQMDEDSKGLPDDRLLQSSNINATISSKVAVANPQMVVPSAGVHIV 339
           KVV+NATGP+SD ILQMD++  GLPD  L  +   N  I++KV+V+NP+MVVPSAGVHI+
Sbjct: 283 KVVINATGPYSDAILQMDQNPTGLPDP-LNVNLKTNNDIATKVSVSNPKMVVPSAGVHII 341

Query: 340 LPSFYCPKEIGLLDAKTSDGRVMFFLPWQGKVLAGTTDIPMKQIPENPTATEADIQDILK 399
           LPSFYCPK+IGLLDAKTSDGRVMFFLPWQGKVLAGTTD+PMKQIPENPTATEADIQDILK
Sbjct: 342 LPSFYCPKDIGLLDAKTSDGRVMFFLPWQGKVLAGTTDVPMKQIPENPTATEADIQDILK 401

Query: 400 ELQHYIKFPVKREDVLSAWAGIRPLVKDPRKRIGENPHRVAASSTQELVRSHFLFTSDND 459
           ELQHYI+FPVKREDVLSAWAGIRPLVKDPR        +    STQ LVRSHF+FTSD+ 
Sbjct: 402 ELQHYIRFPVKREDVLSAWAGIRPLVKDPRTL-----DKNGDGSTQGLVRSHFIFTSDHG 456

Query: 460 LVTIAGGKWTTYREMSEETINEVVKVGKF-NAKPCITRKLKLAGAENYDPNLPAMLAQEY 518
           LVTIAGGKWTTYR M+EET++E +KVGKF N KPCITR +KLAG EN++PNL A+LAQ Y
Sbjct: 457 LVTIAGGKWTTYRAMAEETVDEAIKVGKFANVKPCITRDIKLAGGENWNPNLQALLAQRY 516

Query: 519 HLSSKMAEYLANNYGTRAPLICELFKDDDKNKLPMAFGG----------KENVTVYGNVD 568
           HLSSK++++LA+NYGTRAP+ICE++  D KNKLP+A               N  +Y N  
Sbjct: 517 HLSSKLSQHLADNYGTRAPIICEMYAKDRKNKLPIALAANYNEHEDEIENANDLIYNNER 576

Query: 569 ---FDSFRYPFTIGELKYSINNEYTRTALDFLMRRTRYAFLDAKQALTAVDGTVKVMGDE 625
              F+ FRYPFT+GE+KYS+N EY  TALDFLMRR+R+AFLDAK+A+ AV+GTVK+MGDE
Sbjct: 577 GDVFECFRYPFTVGEVKYSVNYEYAITALDFLMRRSRFAFLDAKEAVHAVEGTVKIMGDE 636

Query: 626 LSWDSNRRQEEREKATEFIKTFGV 649
           L+WD +RR +E E   ++IKTFGV
Sbjct: 637 LNWDESRRHKEIENTIKYIKTFGV 660

>NCAS0G00180 Chr7 complement(25495..27459) [1965 bp, 654 aa] {ON}
           Anc_5.711 YIL155C
          Length = 654

 Score =  894 bits (2311), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 429/656 (65%), Positives = 521/656 (79%), Gaps = 9/656 (1%)

Query: 1   MFANATRRMXXXXXXXXXXXXXXXILWHQQQQQKSVINNDVT-----VTNPVQKSKINLP 55
           MF+  ++ M                ++  Q+ +K+  +N  +     + +PV   +++LP
Sbjct: 1   MFSRGSKSMLSKGLAVVTVVSLGTGVYFLQRSKKTSFHNFQSQHTPGLVSPVDTLQVSLP 60

Query: 56  TRQDLLSKLSKTNQFDVLIIXXXXXXXXXXXXXXXRGLNVALVEMNDFASGTSSKSTKMA 115
           TR  LL +L +  QFDVLII               RGL VALVE NDFASGTSSKSTKMA
Sbjct: 61  TRSKLLQQLKEKGQFDVLIIGGGATGTGCAVDAATRGLQVALVEQNDFASGTSSKSTKMA 120

Query: 116 HGGVRYLEKAFWELSKAQLDLVVEALNERAHMLYTAPHLCKILPIMIPVYNYWQAPYFYV 175
           HGGVRYLEKAF++LSK+QLDLV+EALNERAH+L TAPHLCKILPI+IPVY YWQ PYFY 
Sbjct: 121 HGGVRYLEKAFFQLSKSQLDLVIEALNERAHLLNTAPHLCKILPILIPVYTYWQVPYFYA 180

Query: 176 GCKMYDLFAGSQNLKSSYMLTASRAAEVAPMLDASKLKAGLVYHDGSFNDSRMNATLAVT 235
           GCK+YDLFAG+QNLK+SY+L+ S A E+APML+A+ LKA LVYHDGSFNDSR+NATLA+T
Sbjct: 181 GCKLYDLFAGNQNLKNSYLLSRSNAIELAPMLEATNLKAALVYHDGSFNDSRLNATLAIT 240

Query: 236 AVEKGATVLNYMEVKQLIKNEQTGKVEGAVAQDRETGETFRIKAKVVVNATGPFSDRILQ 295
           A+E+GATVLNY+EV++L+K+ +TG + G   +D ETG+T  + +KVVVNATGPFSD+ILQ
Sbjct: 241 AIERGATVLNYVEVQKLLKDSETGTINGVTVRDIETGDTMDVLSKVVVNATGPFSDKILQ 300

Query: 296 MDEDSKGLPDDRLLQSSNINAT-ISSKVAVANPQMVVPSAGVHIVLPSFYCPKEIGLLDA 354
           MD++  GLPDD  L    IN   ISSK+AV NP MVVPS+GVHI+LPS+YCPK++GLLD 
Sbjct: 301 MDKNPTGLPDDMNLNPKMINPEDISSKIAVKNPNMVVPSSGVHIILPSYYCPKQMGLLDV 360

Query: 355 KTSDGRVMFFLPWQGKVLAGTTDIPMKQIPENPTATEADIQDILKELQHYIKFPVKREDV 414
           +TSDGRVMFFLPWQGKV+AGTTDIPM Q+PE P A EADIQDILKELQHYIKFPVKREDV
Sbjct: 361 RTSDGRVMFFLPWQGKVIAGTTDIPMNQVPETPVAKEADIQDILKELQHYIKFPVKREDV 420

Query: 415 LSAWAGIRPLVKDPRKRIGENPHRVAASSTQELVRSHFLFTSDNDLVTIAGGKWTTYREM 474
           LSAWAGIRPLV+DPR  +  +  +V   STQ LVRSHF+FTSDN LVTIAGGKWTTYREM
Sbjct: 421 LSAWAGIRPLVRDPR-LVSPDEKKVLG-STQGLVRSHFIFTSDNGLVTIAGGKWTTYREM 478

Query: 475 SEETINEVVKVGKF-NAKPCITRKLKLAGAENYDPNLPAMLAQEYHLSSKMAEYLANNYG 533
           +EETI+EVVK G F +AKPCITR+LKLAGAE +DPN+ A+L+Q+Y+L S MA YL++NYG
Sbjct: 479 AEETIDEVVKNGAFVDAKPCITRELKLAGAEFWDPNISALLSQKYNLPSMMANYLSDNYG 538

Query: 534 TRAPLICELFKDDDKNKLPMAFGGKENVTVYGNVDFDSFRYPFTIGELKYSINNEYTRTA 593
           TR+P+ICELF +D+ NKLP+   G+E   + GN DF++FRYP TIGELKYS+  EY RTA
Sbjct: 539 TRSPIICELFLNDEINKLPVLLAGEEKEQILGNTDFNTFRYPITIGELKYSMRYEYARTA 598

Query: 594 LDFLMRRTRYAFLDAKQALTAVDGTVKVMGDELSWDSNRRQEEREKATEFIKTFGV 649
           LDFLMRRTR+AFLDAK+AL AV GTVK+MGDE +W S RRQEE+EK  +FIK+FGV
Sbjct: 599 LDFLMRRTRFAFLDAKEALRAVSGTVKIMGDEFNWSSERRQEEKEKTIQFIKSFGV 654

>TBLA0E01750 Chr5 (427657..429654) [1998 bp, 665 aa] {ON} Anc_5.711
           YIL155C
          Length = 665

 Score =  858 bits (2216), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/603 (66%), Positives = 488/603 (80%), Gaps = 13/603 (2%)

Query: 55  PTRQDLLSKLSKTNQFDVLIIXXXXXXXXXXXXXXXRGLNVALVEMNDFASGTSSKSTKM 114
           P+R +LLS L KT +FDVLII               RGLNVAL+EMNDFAS TSSKSTKM
Sbjct: 68  PSRSELLSNLEKTKKFDVLIIGGGATGTGCAVDASTRGLNVALMEMNDFASATSSKSTKM 127

Query: 115 AHGGVRYLEKAFWELSKAQLDLVVEALNERAHMLYTAPHLCKILPIMIPVYNYWQAPYFY 174
           AHGGVRYLEKA ++LSKAQLDLV+EALNER HML TAPHLCKILPIMIPVYNYW+ PYFY
Sbjct: 128 AHGGVRYLEKAVFQLSKAQLDLVIEALNERKHMLQTAPHLCKILPIMIPVYNYWEVPYFY 187

Query: 175 VGCKMYDLFAGSQNLKSSYMLTASRAAEVAPMLDASKLKAGLVYHDGSFNDSRMNATLAV 234
            GCKMYD FAGSQNLKS+Y+L+ + A ++APMLD  KLKA LVYHDGSFND+RMN +LAV
Sbjct: 188 AGCKMYDFFAGSQNLKSAYLLSKTSAGQIAPMLDVPKLKAALVYHDGSFNDARMNVSLAV 247

Query: 235 TAVEKGATVLNYMEVKQLIKNEQTGKVEGAVAQDRETGETFRIKAKVVVNATGPFSDRIL 294
           TA+E GATVLNYMEV++LIK+ +TGK++GA  +DRET + + + AKVVVN+TGPFSD IL
Sbjct: 248 TAIENGATVLNYMEVEKLIKDPKTGKIQGATVRDRETDKKYDVMAKVVVNSTGPFSDNIL 307

Query: 295 QMDEDSKGLPDDRLLQSSNINATI--------SSKVAVANPQMVVPSAGVHIVLPSFYCP 346
           QMD +  G PD  +   +NI+ +          S++AV NP+MVVPSAGVHI+LPS+YCP
Sbjct: 308 QMDRNKSGYPD--IFDKANIDTSKLPSIDHDNLSRIAVDNPKMVVPSAGVHIILPSYYCP 365

Query: 347 KEIGLLDAKTSDGRVMFFLPWQGKVLAGTTDIPMKQIPENPTATEADIQDILKELQHYIK 406
           K++G+LD KT+DGRVMFFLPWQ KVLAGTTDIPMK++PENP ATEADI+DIL ELQHY K
Sbjct: 366 KDMGILDVKTADGRVMFFLPWQDKVLAGTTDIPMKKVPENPVATEADIEDILSELQHYCK 425

Query: 407 FPVKREDVLSAWAGIRPLVKDPRKRIGENPHRVAASSTQELVRSHFLFTSDNDLVTIAGG 466
           FPVKREDVLSAWAGIRPLV+DPRK    +P+     STQ LVRSHF+FTS+N+LVTIAGG
Sbjct: 426 FPVKREDVLSAWAGIRPLVRDPRKL---SPNSKGDDSTQGLVRSHFIFTSENNLVTIAGG 482

Query: 467 KWTTYREMSEETINEVVKVGKFNAKPCITRKLKLAGAENYDPNLPAMLAQEYHLSSKMAE 526
           KWTTYR M+EETI+E +KVG+   KP +T+ L L+G EN+ PN  A+L+Q+YH+ S +++
Sbjct: 483 KWTTYRRMAEETIDEAIKVGQLPNKPSVTKDLILSGGENWTPNTAALLSQKYHIPSSLSK 542

Query: 527 YLANNYGTRAPLICELFKDDDKNKLPMAFGGKENVTVYGNVDFDSFRYPFTIGELKYSIN 586
           YL+ NYGTRAP+ICEL K D KN+LP+   GKE+  + GNVDF + RYP+T+ E+KY I+
Sbjct: 543 YLSENYGTRAPIICELLKKDKKNELPVTLAGKEHNEILGNVDFQALRYPYTVAEVKYCID 602

Query: 587 NEYTRTALDFLMRRTRYAFLDAKQALTAVDGTVKVMGDELSWDSNRRQEEREKATEFIKT 646
           NEY+RTALDFL+RRTR+ FLDAK+A+ AV+GTV +MGDEL+WDS +R  E +K+ E+IKT
Sbjct: 603 NEYSRTALDFLLRRTRFGFLDAKEAMNAVEGTVSIMGDELNWDSEKRSLEIKKSKEYIKT 662

Query: 647 FGV 649
            GV
Sbjct: 663 LGV 665

>NDAI0F00210 Chr6 complement(39658..41619) [1962 bp, 653 aa] {ON}
           Anc_5.711 YIL155C
          Length = 653

 Score =  847 bits (2189), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/614 (65%), Positives = 497/614 (80%), Gaps = 12/614 (1%)

Query: 43  VTNPVQKSKINLPTRQDLLSKLS-KTNQFDVLIIXXXXXXXXXXXXXXXRGLNVALVEMN 101
           + +PV+  +INLP+R  L ++L+ K +QFD+LII               RGLNVALVE +
Sbjct: 45  LISPVEDVEINLPSRSQLWNQLTTKDHQFDLLIIGGGATGTGCALDAATRGLNVALVERD 104

Query: 102 DFASGTSSKSTKMAHGGVRYLEKAFWELSKAQLDLVVEALNERAHMLYTAPHLCKILPIM 161
           DFASGTSSKSTKMAHGGVRYLEKAF + SK+QLDLV+EALNERAH+L TAPHLCKILPI+
Sbjct: 105 DFASGTSSKSTKMAHGGVRYLEKAFLQFSKSQLDLVIEALNERAHLLNTAPHLCKILPIL 164

Query: 162 IPVYNYWQAPYFYVGCKMYDLFAGSQNLKSSYMLTASRAAEVAPMLDASKLKAGLVYHDG 221
           IPVYNYWQ PYFY GCK YD FAG QNLKSSY+++   A E+APMLDA+ LKA LVYHDG
Sbjct: 165 IPVYNYWQLPYFYAGCKFYDFFAGDQNLKSSYLISRKNAIEIAPMLDAANLKAALVYHDG 224

Query: 222 SFNDSRMNATLAVTAVEKGATVLNYMEVKQLIKNEQTGKVEGAVAQDRETGETFRIKAKV 281
           SFNDSR+N+++A+TA+E GATVLNY+EV++L+K+  + K+ G   QD+ETGE   +K+KV
Sbjct: 225 SFNDSRLNSSIAITAIENGATVLNYVEVRKLLKDPNSNKIIGVTVQDKETGEISNVKSKV 284

Query: 282 VVNATGPFSDRILQMDEDSKGLPD----DRLLQSSNINATISSKVAVANPQMVVPSAGVH 337
           +VNATGP+SD ILQMD++  GLPD    D  +   N    ISSK+AV+NP+MVVPS+GVH
Sbjct: 285 IVNATGPYSDTILQMDKNLSGLPDLANIDPKMYDPN---DISSKIAVSNPKMVVPSSGVH 341

Query: 338 IVLPSFYCPKEIGLLDAKTSDGRVMFFLPWQGKVLAGTTDIPMKQIPENPTATEADIQDI 397
           I+LPS+YCPK++GLLDA+T+DGRVMFFLPWQGKV+AGTTDIPM Q+P+ P A E DIQDI
Sbjct: 342 IILPSYYCPKQMGLLDARTTDGRVMFFLPWQGKVIAGTTDIPMSQVPDTPVAKETDIQDI 401

Query: 398 LKELQHYIKFPVKREDVLSAWAGIRPLVKDPRKRIGENPHRVAASSTQELVRSHFLFTSD 457
           LKELQHYIKFPV+REDVLSAWAGIRPLV+DPR  + +   ++   +TQ LVRSHFLFTSD
Sbjct: 402 LKELQHYIKFPVRREDVLSAWAGIRPLVRDPRLIMDDATQKLG--TTQGLVRSHFLFTSD 459

Query: 458 NDLVTIAGGKWTTYREMSEETINEVVKVGKFN--AKPCITRKLKLAGAENYDPNLPAMLA 515
           N L+TIAGGKWTTYREM+EETI+EVVK G F   AKPC T+ LKL GAEN+DPNL A+L+
Sbjct: 460 NGLITIAGGKWTTYREMAEETIDEVVKYGHFANFAKPCKTKDLKLIGAENWDPNLVALLS 519

Query: 516 QEYHLSSKMAEYLANNYGTRAPLICELFKDDDKNKLPMAFGGKENVTVYGNVDFDSFRYP 575
           Q+++LSS MA+YL+ NYGTR+ +IC+LF+ ++ NKLP+   G E+  + GNVDF++FRYP
Sbjct: 520 QKFNLSSMMAKYLSENYGTRSTIICQLFEREEMNKLPVQLAGIEDKPILGNVDFNTFRYP 579

Query: 576 FTIGELKYSINNEYTRTALDFLMRRTRYAFLDAKQALTAVDGTVKVMGDELSWDSNRRQE 635
            TI ELKY++  EY RT LDFLMRRTR+A+LDA QAL AV GTVKVMGDE  WDS RR++
Sbjct: 580 ITIAELKYAMKYEYARTPLDFLMRRTRFAYLDAYQALLAVKGTVKVMGDEFGWDSKRREQ 639

Query: 636 EREKATEFIKTFGV 649
           E + AT FI++FGV
Sbjct: 640 EIKNATLFIESFGV 653

>YIL155C Chr9 complement(51759..53708) [1950 bp, 649 aa] {ON}
           GUT2Mitochondrial glycerol-3-phosphate dehydrogenase;
           expression is repressed by both glucose and cAMP and
           derepressed by non-fermentable carbon sources in a
           Snf1p, Rsf1p, Hap2/3/4/5 complex dependent manner
          Length = 649

 Score =  840 bits (2169), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 408/631 (64%), Positives = 486/631 (77%), Gaps = 10/631 (1%)

Query: 25  ILWHQQQQQKSVINNDVTVTNPVQKSKINLPTRQDLLSKLSKTNQFDVLIIXXXXXXXXX 84
           + W   Q  + +++ND +       +     +R+DLL +L+KT+QFDVLII         
Sbjct: 23  LYWMTSQGDRPLVHNDPSYMVQFPTAAPPQVSRRDLLDRLAKTHQFDVLIIGGGATGTGC 82

Query: 85  XXXXXXRGLNVALVEMNDFASGTSSKSTKMAHGGVRYLEKAFWELSKAQLDLVVEALNER 144
                 RGLNVALVE  DFASGTSSKSTKM HGGVRYLEKAFWE SKAQLDLV+EALNER
Sbjct: 83  ALDAATRGLNVALVEKGDFASGTSSKSTKMIHGGVRYLEKAFWEFSKAQLDLVIEALNER 142

Query: 145 AHMLYTAPHLCKILPIMIPVYNYWQAPYFYVGCKMYDLFAGSQNLKSSYMLTASRAAEVA 204
            H++ TAPHLC +LPI+IP+Y+ WQ PY Y+GCK YD FAGSQNLK SY+L+ S   E A
Sbjct: 143 KHLINTAPHLCTVLPILIPIYSTWQVPYIYMGCKFYDFFAGSQNLKKSYLLSKSATVEKA 202

Query: 205 PMLDASKLKAGLVYHDGSFNDSRMNATLAVTAVEKGATVLNYMEVKQLIKNEQTGKVEGA 264
           PML    LKA LVYHDGSFNDSR+NATLA+TAVE GATVLNY+EV++LIK+  +GKV GA
Sbjct: 203 PMLTTDNLKASLVYHDGSFNDSRLNATLAITAVENGATVLNYVEVQKLIKDPTSGKVIGA 262

Query: 265 VAQDRETGETFRIKAKVVVNATGPFSDRILQMDEDSKGLPDDRLLQSSNINATISSKVAV 324
            A+D ET E  RI AK VVNATGP+SD ILQMD +  GLPD  L  +S I +T  +++AV
Sbjct: 263 EARDVETNELVRINAKCVVNATGPYSDAILQMDRNPSGLPDSPLNDNSKIKSTF-NQIAV 321

Query: 325 ANPQMVVPSAGVHIVLPSFYCPKEIGLLDAKTSDGRVMFFLPWQGKVLAGTTDIPMKQIP 384
            +P+MV+PS GVHIVLPSFYCPK++GLLD +TSDGRVMFFLPWQGKVLAGTTDIP+KQ+P
Sbjct: 322 MDPKMVIPSIGVHIVLPSFYCPKDMGLLDVRTSDGRVMFFLPWQGKVLAGTTDIPLKQVP 381

Query: 385 ENPTATEADIQDILKELQHYIKFPVKREDVLSAWAGIRPLVKDPRKRIGENPHRVAASST 444
           ENP  TEADIQDILKELQHYI+FPVKREDVLSAWAG+RPLV+DPR    +       S+T
Sbjct: 382 ENPMPTEADIQDILKELQHYIEFPVKREDVLSAWAGVRPLVRDPRTIPADGKK---GSAT 438

Query: 445 QELVRSHFLFTSDNDLVTIAGGKWTTYREMSEETINEVVKVGKF-NAKPCITRKLKLAGA 503
           Q +VRSHFLFTSDN L+TIAGGKWTTYR+M+EET+++VV+VG F N KPC TR +KLAGA
Sbjct: 439 QGVVRSHFLFTSDNGLITIAGGKWTTYRQMAEETVDKVVEVGGFHNLKPCHTRDIKLAGA 498

Query: 504 ENYDPNLPAMLAQEYHLSSKMAEYLANNYGTRAPLICELFKDDDKNKLPMAFGGKENVTV 563
           E +  N  A+LAQ YHLSSKM+ YL  NYGTR+ +ICE FK+  +NKLP++   KEN  +
Sbjct: 499 EEWTQNYVALLAQNYHLSSKMSNYLVQNYGTRSSIICEFFKESMENKLPLSLADKENNVI 558

Query: 564 YGN-----VDFDSFRYPFTIGELKYSINNEYTRTALDFLMRRTRYAFLDAKQALTAVDGT 618
           Y +     V+FD+FRYPFTIGELKYS+  EY RT LDFL+RRTR+AFLDAK+AL AV  T
Sbjct: 559 YSSEENNLVNFDTFRYPFTIGELKYSMQYEYCRTPLDFLLRRTRFAFLDAKEALNAVHAT 618

Query: 619 VKVMGDELSWDSNRRQEEREKATEFIKTFGV 649
           VKVMGDE +W   +RQ E EK   FIKTFGV
Sbjct: 619 VKVMGDEFNWSEKKRQWELEKTVNFIKTFGV 649

>Skud_9.13 Chr9 complement(28747..30696) [1950 bp, 649 aa] {ON}
           YIL155C (REAL)
          Length = 649

 Score =  839 bits (2167), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 405/631 (64%), Positives = 485/631 (76%), Gaps = 10/631 (1%)

Query: 25  ILWHQQQQQKSVINNDVTVTNPVQKSKINLPTRQDLLSKLSKTNQFDVLIIXXXXXXXXX 84
           + W   Q  + ++ ND +   P   +     +R+DLL +L+KT+QFDVLII         
Sbjct: 23  VYWATTQGDRRLVRNDASYMVPFPTAAPPQVSRRDLLDRLAKTHQFDVLIIGGGATGTGC 82

Query: 85  XXXXXXRGLNVALVEMNDFASGTSSKSTKMAHGGVRYLEKAFWELSKAQLDLVVEALNER 144
                 RGLNVALVE  DFASGTSSKSTKM HGGVRYLEKAFWE SKAQLDLV+EALNER
Sbjct: 83  ALDAATRGLNVALVEKGDFASGTSSKSTKMIHGGVRYLEKAFWEFSKAQLDLVIEALNER 142

Query: 145 AHMLYTAPHLCKILPIMIPVYNYWQAPYFYVGCKMYDLFAGSQNLKSSYMLTASRAAEVA 204
            H++ TAPHLC +LPI+IP+YN WQ PY Y+GCK YD FAGSQNLK SY+L+ S   E A
Sbjct: 143 KHLINTAPHLCTVLPILIPIYNTWQVPYIYMGCKFYDFFAGSQNLKKSYLLSKSATVEKA 202

Query: 205 PMLDASKLKAGLVYHDGSFNDSRMNATLAVTAVEKGATVLNYMEVKQLIKNEQTGKVEGA 264
           PML    LKA LVYHDGSFNDSR+NATLA+TAVE GATVLNY+EV++LIK+  +GKV GA
Sbjct: 203 PMLTTDNLKASLVYHDGSFNDSRLNATLAITAVENGATVLNYVEVQRLIKDPASGKVVGA 262

Query: 265 VAQDRETGETFRIKAKVVVNATGPFSDRILQMDEDSKGLPDDRLLQSSNINATISSKVAV 324
            A+D ET E  +I AK VVNATGP+SD ILQMD +  G P+  L  +S I +T  +++AV
Sbjct: 263 EARDVETNELVKINAKCVVNATGPYSDAILQMDRNPSGQPNSPLNDNSLIKSTF-NQIAV 321

Query: 325 ANPQMVVPSAGVHIVLPSFYCPKEIGLLDAKTSDGRVMFFLPWQGKVLAGTTDIPMKQIP 384
            +P+MV+PS GVHIVLPSFYCPK++GLLD +TSDGRVMFFLPWQGKVLAGTTDIP+KQ+P
Sbjct: 322 TDPKMVIPSIGVHIVLPSFYCPKDMGLLDVRTSDGRVMFFLPWQGKVLAGTTDIPLKQVP 381

Query: 385 ENPTATEADIQDILKELQHYIKFPVKREDVLSAWAGIRPLVKDPRKRIGENPHRVAASST 444
           ENP  TEADIQDILKELQHYI+FPVKREDVLSAWAG+RPLV+DPR    +       S+T
Sbjct: 382 ENPMPTEADIQDILKELQHYIEFPVKREDVLSAWAGVRPLVRDPRTIPADGKK---GSAT 438

Query: 445 QELVRSHFLFTSDNDLVTIAGGKWTTYREMSEETINEVVKVGKF-NAKPCITRKLKLAGA 503
           Q +VRSHFLFTSDN L+TIAGGKWTTYR+M+EET+++VV+VG+F N KPC TR +KLAGA
Sbjct: 439 QGVVRSHFLFTSDNGLITIAGGKWTTYRQMAEETVDKVVEVGRFHNLKPCHTRDIKLAGA 498

Query: 504 ENYDPNLPAMLAQEYHLSSKMAEYLANNYGTRAPLICELFKDDDKNKLPMAFGGKENVTV 563
           E +  N  A+LAQ YHLSSKM+ YL  NYGTR+ +ICE FK+  +NKLP++   KEN  +
Sbjct: 499 EEWTQNYVALLAQNYHLSSKMSNYLVQNYGTRSSIICEFFKESMENKLPLSLADKENNVI 558

Query: 564 YGN-----VDFDSFRYPFTIGELKYSINNEYTRTALDFLMRRTRYAFLDAKQALTAVDGT 618
           Y +     V+FD+FRYPFTIGELKYS+  EY RT LDFL+RRTR+AFLDAK+AL +   T
Sbjct: 559 YSSEENNLVNFDTFRYPFTIGELKYSMQYEYCRTPLDFLLRRTRFAFLDAKEALNSAHAT 618

Query: 619 VKVMGDELSWDSNRRQEEREKATEFIKTFGV 649
           VKVMGDE +W   +RQ E EK   FIKTFGV
Sbjct: 619 VKVMGDEFNWSEKKRQWELEKTINFIKTFGV 649

>Smik_9.14 Chr9 complement(29383..31341) [1959 bp, 652 aa] {ON}
           YIL155C (REAL)
          Length = 652

 Score =  831 bits (2146), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 405/631 (64%), Positives = 482/631 (76%), Gaps = 10/631 (1%)

Query: 25  ILWHQQQQQKSVINNDVTVTNPVQKSKINLPTRQDLLSKLSKTNQFDVLIIXXXXXXXXX 84
           + W   Q ++  ++ND +       +     +R+DLL +L KT+QFDVLII         
Sbjct: 26  LYWVATQGERPCVHNDASYMVQFPTAAPPQVSRRDLLERLGKTHQFDVLIIGGGATGTGC 85

Query: 85  XXXXXXRGLNVALVEMNDFASGTSSKSTKMAHGGVRYLEKAFWELSKAQLDLVVEALNER 144
                 RGLNVALVE  DFASGTSSKSTKM HGGVRYLEKAFWE SKAQLDLV+EALNER
Sbjct: 86  ALDAATRGLNVALVEKGDFASGTSSKSTKMIHGGVRYLEKAFWEFSKAQLDLVIEALNER 145

Query: 145 AHMLYTAPHLCKILPIMIPVYNYWQAPYFYVGCKMYDLFAGSQNLKSSYMLTASRAAEVA 204
            H++ TAPHLC +LPI+IP+Y+  Q PY Y+GCK YD FAGSQNLK SY+L+ S   E A
Sbjct: 146 KHLINTAPHLCTVLPILIPIYSTLQVPYIYMGCKFYDFFAGSQNLKKSYLLSKSATVEKA 205

Query: 205 PMLDASKLKAGLVYHDGSFNDSRMNATLAVTAVEKGATVLNYMEVKQLIKNEQTGKVEGA 264
           PML    LKA LVYHDGSFNDSR+NATLA+TAVE GATVLNY+EV++LIK+  +GKV GA
Sbjct: 206 PMLTTDNLKASLVYHDGSFNDSRLNATLAITAVENGATVLNYVEVQKLIKDPASGKVIGA 265

Query: 265 VAQDRETGETFRIKAKVVVNATGPFSDRILQMDEDSKGLPDDRLLQSSNINATISSKVAV 324
            A+D ET E  RIKAK VVNATGP+SD ILQMD +  G PD  L  +S   +   +++AV
Sbjct: 266 EARDVETNELIRIKAKCVVNATGPYSDAILQMDRNPSGQPDSPLNDNSKAKSAF-NQIAV 324

Query: 325 ANPQMVVPSAGVHIVLPSFYCPKEIGLLDAKTSDGRVMFFLPWQGKVLAGTTDIPMKQIP 384
            +P+MV+PS GVHIVLPSFYCPK++GLLD +TSDGRVMFFLPWQGKVLAGTTDIP+KQ+P
Sbjct: 325 MDPKMVIPSIGVHIVLPSFYCPKDMGLLDVRTSDGRVMFFLPWQGKVLAGTTDIPLKQVP 384

Query: 385 ENPTATEADIQDILKELQHYIKFPVKREDVLSAWAGIRPLVKDPRKRIGENPHRVAASST 444
           ENP  TEADIQDILKELQHYI+FPVKREDVLSAWAG+RPLV+DPR    +       S+T
Sbjct: 385 ENPMPTEADIQDILKELQHYIEFPVKREDVLSAWAGVRPLVRDPRTIPADGKK---GSAT 441

Query: 445 QELVRSHFLFTSDNDLVTIAGGKWTTYREMSEETINEVVKVGKF-NAKPCITRKLKLAGA 503
           Q +VRSHFLFTSDNDL+TIAGGKWTTYR+M+EETI++VV+VG F N  PC TR +KLAGA
Sbjct: 442 QGVVRSHFLFTSDNDLITIAGGKWTTYRQMAEETIDKVVEVGGFHNLTPCHTRDIKLAGA 501

Query: 504 ENYDPNLPAMLAQEYHLSSKMAEYLANNYGTRAPLICELFKDDDKNKLPMAFGGKENVTV 563
           E +  N  A+LAQ YHLSSKM+ YL  NYGTR+ +ICE FK+  +NKLP++   KEN  +
Sbjct: 502 EEWTQNYVALLAQNYHLSSKMSNYLVQNYGTRSSIICEYFKESMENKLPLSLADKENNVI 561

Query: 564 YGN-----VDFDSFRYPFTIGELKYSINNEYTRTALDFLMRRTRYAFLDAKQALTAVDGT 618
           Y +     V+FD+FRYPFTIGELKYS+  EY RT LDFL+RRTR+AFLDAK+AL +V  T
Sbjct: 562 YSSEENNLVNFDTFRYPFTIGELKYSMQYEYCRTPLDFLLRRTRFAFLDAKEALNSVHAT 621

Query: 619 VKVMGDELSWDSNRRQEEREKATEFIKTFGV 649
           VKVMGDE +W   +RQ E EK   FIKTFGV
Sbjct: 622 VKVMGDEFNWSEKKRQWELEKTVNFIKTFGV 652

>Suva_9.32 Chr9 complement(46397..48013) [1617 bp, 538 aa] {ON}
           YIL155C (REAL)
          Length = 538

 Score =  781 bits (2016), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/542 (68%), Positives = 433/542 (79%), Gaps = 10/542 (1%)

Query: 114 MAHGGVRYLEKAFWELSKAQLDLVVEALNERAHMLYTAPHLCKILPIMIPVYNYWQAPYF 173
           M HGGVRYLEKAFWE SKAQLDLV+EALNER H++ TAPHLC +LPI+IP+YN WQ PY 
Sbjct: 1   MIHGGVRYLEKAFWEFSKAQLDLVIEALNERKHLINTAPHLCTVLPILIPIYNTWQVPYI 60

Query: 174 YVGCKMYDLFAGSQNLKSSYMLTASRAAEVAPMLDASKLKAGLVYHDGSFNDSRMNATLA 233
           Y GCK YD FAG QNLKSSY+L+ S   E APML    LKA LVYHDGSFNDSR+NATLA
Sbjct: 61  YAGCKFYDFFAGKQNLKSSYLLSKSATVEKAPMLTTDNLKASLVYHDGSFNDSRLNATLA 120

Query: 234 VTAVEKGATVLNYMEVKQLIKNEQTGKVEGAVAQDRETGETFRIKAKVVVNATGPFSDRI 293
           +TAVE GATVLNY+EV++LIK+  +GKV GA A+D ET E  RI AK VVNATGP+SD I
Sbjct: 121 ITAVENGATVLNYVEVQKLIKDPASGKVVGAEARDVETNELVRINAKCVVNATGPYSDAI 180

Query: 294 LQMDEDSKGLPDDRLLQSSNINATISSKVAVANPQMVVPSAGVHIVLPSFYCPKEIGLLD 353
           LQMD ++ G P+  L  +S I +   ++VAV +P+MV+PS GVHIVLPSFYCPK+IGLLD
Sbjct: 181 LQMDRNASGQPNSPLNDNSKIKSAF-NQVAVMDPEMVIPSIGVHIVLPSFYCPKDIGLLD 239

Query: 354 AKTSDGRVMFFLPWQGKVLAGTTDIPMKQIPENPTATEADIQDILKELQHYIKFPVKRED 413
            +TSDGRVMFFLPWQGKVLAGTTDIP+KQ+PENP  TEADIQDILKELQHYI+FPVKRED
Sbjct: 240 VRTSDGRVMFFLPWQGKVLAGTTDIPLKQVPENPMPTEADIQDILKELQHYIEFPVKRED 299

Query: 414 VLSAWAGIRPLVKDPRKRIGENPHRVAASSTQELVRSHFLFTSDNDLVTIAGGKWTTYRE 473
           VLSAWAG+RPLV+DPR            S+TQ +VRSHFLFTSDN L+TIAGGKWTTYR+
Sbjct: 300 VLSAWAGVRPLVRDPRSIPAGGKK---GSATQGVVRSHFLFTSDNGLITIAGGKWTTYRQ 356

Query: 474 MSEETINEVVKVGKF-NAKPCITRKLKLAGAENYDPNLPAMLAQEYHLSSKMAEYLANNY 532
           M+EETI++VV+VG F N KPC TR +KLAGAE +  N  A+LAQ YHLSSKM+ YL  NY
Sbjct: 357 MAEETIDKVVEVGGFHNLKPCHTRDIKLAGAEEWTQNYVALLAQNYHLSSKMSNYLVENY 416

Query: 533 GTRAPLICELFKDDDKNKLPMAFGGKENVTVYGN-----VDFDSFRYPFTIGELKYSINN 587
           GTR+ +ICE FKD  +NKLP++   KEN T+Y N     V+FD+FRYPFTIGELKYS+  
Sbjct: 417 GTRSSIICEFFKDSMENKLPLSLADKENNTIYSNEENNLVNFDTFRYPFTIGELKYSMQY 476

Query: 588 EYTRTALDFLMRRTRYAFLDAKQALTAVDGTVKVMGDELSWDSNRRQEEREKATEFIKTF 647
           EY RT LDFL+RRTR+AFLDAK+AL +V  TVKVMGDE +W   +RQ E EK   FIKTF
Sbjct: 477 EYCRTPLDFLLRRTRFAFLDAKEALNSVHATVKVMGDEFNWSDKKRQWELEKTVNFIKTF 536

Query: 648 GV 649
           GV
Sbjct: 537 GV 538

>KNAG0L02190 Chr12 (391987..393924) [1938 bp, 645 aa] {ON} Anc_5.711
           YIL155C
          Length = 645

 Score =  775 bits (2002), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/597 (63%), Positives = 459/597 (76%), Gaps = 12/597 (2%)

Query: 55  PTRQDLLSKLSKTNQFDVLIIXXXXXXXXXXXXXXXRGLNVALVEMNDFASGTSSKSTKM 114
           P R  +L +L  T +FDVL++               RGL VALVE  DFA+GTSSKSTK+
Sbjct: 59  PDRAKVLQRLQDT-KFDVLVVGGGATGTGVALDASLRGLKVALVEKADFAAGTSSKSTKL 117

Query: 115 AHGGVRYLEKAFWELSKAQLDLVVEALNERAHMLYTAPHLCKILPIMIPVYNYWQAPYFY 174
           AHGGVRYLEKA +ELSK QLDLVVEALNERAH+LY APHL KILPI+IPVY YW+ PYFY
Sbjct: 118 AHGGVRYLEKAVFELSKPQLDLVVEALNERAHLLYAAPHLTKILPIIIPVYEYWKVPYFY 177

Query: 175 VGCKMYDLFAGSQNLKSSYMLTASRAAEVAPMLDASKLKAGLVYHDGSFNDSRMNATLAV 234
            GCKMYD FAG+QNLKSSY+L+    + +APMLD  KLK GLVYHDG FNDSR+ ATLA+
Sbjct: 178 AGCKMYDFFAGAQNLKSSYLLSRENLSHIAPMLDQKKLKMGLVYHDGIFNDSRLCATLAI 237

Query: 235 TAVEKGATVLNYMEVKQLIKNEQTGKVEGAVAQDRETGETFRIKAKVVVNATGPFSDRIL 294
           +AVE+GATV NY+ V+QLIK++ TG + GA  +D+ETG TF + AK+VVNATGP+SD+IL
Sbjct: 238 SAVERGATVANYVSVEQLIKDKTTGVITGAKVEDQETGGTFTVNAKIVVNATGPYSDKIL 297

Query: 295 QMDEDSKGLPDDRLLQSSNINATISSKVAVANPQMVVPSAGVHIVLPSFYCPKEIGLLDA 354
           QMD + +GLP+    +++  NA I    AV NP+MVVPS GVHI LPSFYCP E+GLLDA
Sbjct: 298 QMDANPQGLPEKEPEKATPENALI----AVRNPKMVVPSRGVHITLPSFYCPSEMGLLDA 353

Query: 355 KTSDGRVMFFLPWQGKVLAGTTDIPMKQIPENPTATEADIQDILKELQHYIKFPVKREDV 414
            TSDGRVMFFLPWQGKV+AGTTDIP+KQ+P +P+ TEADIQDIL+ELQHYI+FPV+REDV
Sbjct: 354 STSDGRVMFFLPWQGKVIAGTTDIPLKQVPRDPSPTEADIQDILQELQHYIQFPVRREDV 413

Query: 415 LSAWAGIRPLVKDPRKRIGENPHRVAASSTQELVRSHFLFTSDNDLVTIAGGKWTTYREM 474
           LSAWAGIRPLV+DPR   G       +  T+ LVRSHF+FTS   LVTIAGGKWTTYREM
Sbjct: 414 LSAWAGIRPLVRDPRVAEGS----AGSGQTEGLVRSHFIFTSPTQLVTIAGGKWTTYREM 469

Query: 475 SEETINEVVKVGKFNA-KPCITRKLKLAGAENYDPNLPAMLAQEYH-LSSKMAEYLANNY 532
           +EET++EV+KVGKF   KPC TRK KL GA++++ N  A L Q Y  L   +AE+LANNY
Sbjct: 470 AEETVDEVIKVGKFQGLKPCTTRKTKLIGAQHWNLNFQAYLQQRYAPLEDSLAEHLANNY 529

Query: 533 GTRAPLICELFKDDDKNKLPMAFGGKENVTVYGNVDFDSFRYPFTIGELKYSINNEYTRT 592
           G RAP+ICE+F+ D  +KLP+   G  +  V  N+D ++F YPFTI ELKY I  EY RT
Sbjct: 530 GDRAPIICEMFEADKSSKLPVGLYGDGDDKV-KNMDANAFDYPFTIAELKYCIRFEYVRT 588

Query: 593 ALDFLMRRTRYAFLDAKQALTAVDGTVKVMGDELSWDSNRRQEEREKATEFIKTFGV 649
           ALDFL+RR+R+AFLDA++AL AVD TV ++GDEL WD+ +R  E  K   +IKTFGV
Sbjct: 589 ALDFLLRRSRFAFLDAREALNAVDPTVNLIGDELGWDAEKRAAESAKTKAYIKTFGV 645

>Suva_10.526 Chr10 (903294..906728) [3435 bp, 1144 aa] {ON} YLR410W
           (REAL)
          Length = 1144

 Score = 35.0 bits (79), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 26/46 (56%)

Query: 339 VLPSFYCPKEIGLLDAKTSDGRVMFFLPWQGKVLAGTTDIPMKQIP 384
           VL  F CPKE G+LDA+  D  ++  LP   ++L    D+  ++ P
Sbjct: 935 VLFDFICPKEYGILDAEKLDIGLLTSLPLAKQILNDIGDMKNRETP 980

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.132    0.382 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 63,687,098
Number of extensions: 2698710
Number of successful extensions: 7794
Number of sequences better than 10.0: 27
Number of HSP's gapped: 7939
Number of HSP's successfully gapped: 27
Length of query: 649
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 533
Effective length of database: 40,180,143
Effective search space: 21416016219
Effective search space used: 21416016219
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)