Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0E15070g5.709ON38538519710.0
KLTH0E00880g5.709ON37132711381e-155
Kwal_55.196615.709ON37134211151e-151
TDEL0B021105.709ON38934010801e-146
AFR293C5.709ON36532510741e-145
Ecym_40125.709ON39536010631e-143
NCAS0G002005.709ON43833710501e-140
Suva_9.355.709ON39334610291e-138
Skud_9.155.709ON40234610291e-138
ZYRO0B16478g5.709ON39132710141e-136
YIL153W (RRD1)5.709ON39332310141e-136
Kpol_2001.775.709ON41333810131e-135
Smik_9.165.709ON39332210041e-134
NDAI0F002405.709ON4643289741e-129
TPHA0D046505.709ON4213489691e-128
CAGL0H06655g5.709ON4243149231e-121
KAFR0D021905.709ON4263529231e-121
TBLA0E016905.709ON4883539271e-121
KLLA0A00462g5.709ON3533398901e-118
KNAG0L021705.709ON3963288291e-108
NDAI0E024108.674ON3592944465e-51
Ecym_23998.674ON3512504282e-48
CAGL0M02255g8.674ON3582944264e-48
ZYRO0F07326g8.674ON3522424169e-47
Smik_6.3498.674ON3582544151e-46
YPL152W (RRD2)8.674ON3582594151e-46
ACR139C8.674ON3592694142e-46
Kpol_1013.48.674ON3583004115e-46
Kwal_26.87838.674ON3553304116e-46
TDEL0A062008.674ON3553034107e-46
Suva_16.1588.674ON3582764081e-45
KLTH0D11176g8.674ON3533024072e-45
KNAG0J016908.674ON3633014063e-45
Skud_16.1308.674ON3582244055e-45
KAFR0H024408.674ON3532384011e-44
NCAS0C016908.674ON3592463968e-44
TPHA0D012408.674ON3593043951e-43
SAKL0H06622g8.674ON3552953941e-43
KLLA0F11187g8.674ON3601863932e-43
TBLA0C018608.674ON3562673862e-42
NCAS0J002908.15ON108038731.7
Kwal_56.235838.255ON70046678.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0E15070g
         (385 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0E15070g Chr5 complement(1253760..1254917) [1158 bp, 385 aa]...   763   0.0  
KLTH0E00880g Chr5 (87353..88468) [1116 bp, 371 aa] {ON} similar ...   442   e-155
Kwal_55.19661 s55 (69740..70855) [1116 bp, 371 aa] {ON} YIL153W ...   434   e-151
TDEL0B02110 Chr2 (376429..377598) [1170 bp, 389 aa] {ON} Anc_5.7...   420   e-146
AFR293C Chr6 complement(967308..968405) [1098 bp, 365 aa] {ON} S...   418   e-145
Ecym_4012 Chr4 (29674..30861) [1188 bp, 395 aa] {ON} similar to ...   414   e-143
NCAS0G00200 Chr7 (29159..30475) [1317 bp, 438 aa] {ON} Anc_5.709      409   e-140
Suva_9.35 Chr9 (49860..51041) [1182 bp, 393 aa] {ON} YIL153W (REAL)   400   e-138
Skud_9.15 Chr9 (32255..33463) [1209 bp, 402 aa] {ON} YIL153W (REAL)   400   e-138
ZYRO0B16478g Chr2 complement(1336755..1337930) [1176 bp, 391 aa]...   395   e-136
YIL153W Chr9 (55198..56379) [1182 bp, 393 aa] {ON}  RRD1Peptidyl...   395   e-136
Kpol_2001.77 s2001 complement(211870..213111) [1242 bp, 413 aa] ...   394   e-135
Smik_9.16 Chr9 (32798..33979) [1182 bp, 393 aa] {ON} YIL153W (REAL)   391   e-134
NDAI0F00240 Chr6 (46047..47441) [1395 bp, 464 aa] {ON} Anc_5.709      379   e-129
TPHA0D04650 Chr4 complement(1015658..1016923) [1266 bp, 421 aa] ...   377   e-128
CAGL0H06655g Chr8 complement(661713..662987) [1275 bp, 424 aa] {...   360   e-121
KAFR0D02190 Chr4 (439664..440944) [1281 bp, 426 aa] {ON} Anc_5.7...   360   e-121
TBLA0E01690 Chr5 (406884..408350) [1467 bp, 488 aa] {ON} Anc_5.7...   361   e-121
KLLA0A00462g Chr1 (38766..39827) [1062 bp, 353 aa] {ON} similar ...   347   e-118
KNAG0L02170 Chr12 complement(388956..390146) [1191 bp, 396 aa] {...   323   e-108
NDAI0E02410 Chr5 complement(500623..501702) [1080 bp, 359 aa] {O...   176   5e-51
Ecym_2399 Chr2 (778448..779503) [1056 bp, 351 aa] {ON} similar t...   169   2e-48
CAGL0M02255g Chr13 (270614..271690) [1077 bp, 358 aa] {ON} highl...   168   4e-48
ZYRO0F07326g Chr6 complement(592906..593964) [1059 bp, 352 aa] {...   164   9e-47
Smik_6.349 Chr6 complement(558150..559226) [1077 bp, 358 aa] {ON...   164   1e-46
YPL152W Chr16 (265028..266104) [1077 bp, 358 aa] {ON}  RRD2Activ...   164   1e-46
ACR139C Chr3 complement(592864..593943) [1080 bp, 359 aa] {ON} S...   164   2e-46
Kpol_1013.4 s1013 complement(5948..7024) [1077 bp, 358 aa] {ON} ...   162   5e-46
Kwal_26.8783 s26 complement(941317..942384) [1068 bp, 355 aa] {O...   162   6e-46
TDEL0A06200 Chr1 complement(1085066..1086133) [1068 bp, 355 aa] ...   162   7e-46
Suva_16.158 Chr16 (274228..275304) [1077 bp, 358 aa] {ON} YPL152...   161   1e-45
KLTH0D11176g Chr4 complement(913077..914138) [1062 bp, 353 aa] {...   161   2e-45
KNAG0J01690 Chr10 complement(308576..309667) [1092 bp, 363 aa] {...   160   3e-45
Skud_16.130 Chr16 (236660..237736) [1077 bp, 358 aa] {ON} YPL152...   160   5e-45
KAFR0H02440 Chr8 (467656..468717) [1062 bp, 353 aa] {ON} Anc_8.6...   159   1e-44
NCAS0C01690 Chr3 complement(311102..312181) [1080 bp, 359 aa] {O...   157   8e-44
TPHA0D01240 Chr4 complement(259089..260168) [1080 bp, 359 aa] {O...   156   1e-43
SAKL0H06622g Chr8 (583484..584551) [1068 bp, 355 aa] {ON} simila...   156   1e-43
KLLA0F11187g Chr6 (1031839..1032921) [1083 bp, 360 aa] {ON} simi...   155   2e-43
TBLA0C01860 Chr3 complement(437987..439057) [1071 bp, 356 aa] {O...   153   2e-42
NCAS0J00290 Chr10 (40028..43270) [3243 bp, 1080 aa] {ON} Anc_8.1...    33   1.7  
Kwal_56.23583 s56 (607721..609823) [2103 bp, 700 aa] {ON} YDR108...    30   8.1  

>SAKL0E15070g Chr5 complement(1253760..1254917) [1158 bp, 385 aa]
           {ON} similar to uniprot|P40454 Saccharomyces cerevisiae
           YIL153W RRD1 Resistant to Rapamycin Deletion
          Length = 385

 Score =  763 bits (1971), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/385 (95%), Positives = 369/385 (95%)

Query: 1   MISTITTPKIDVSHTKFTEPVKKIFDTQGTQDFQSSVTMYRLQSYLHKYITLVGTKNIPS 60
           MISTITTPKIDVSHTKFTEPVKKIFDTQGTQDFQSSVTMYRLQSYLHKYITLVGTKNIPS
Sbjct: 1   MISTITTPKIDVSHTKFTEPVKKIFDTQGTQDFQSSVTMYRLQSYLHKYITLVGTKNIPS 60

Query: 61  TSNNDAVNRFTQIIDALSRTIDETPPLPGPRRFGNFACRTWHVKMRGSLDALLQAFIPEK 120
           TSNNDAVNRFTQIIDALSRTIDETPPLPGPRRFGNFACRTWHVKMRGSLDALLQAFIPEK
Sbjct: 61  TSNNDAVNRFTQIIDALSRTIDETPPLPGPRRFGNFACRTWHVKMRGSLDALLQAFIPEK 120

Query: 121 YHVCIVEIRYYLGNAFGSKERLDYGTGHELSFLAVVSAIDMLDLWGSNPSGEDILFLFNG 180
           YHVCIVEIRYYLGNAFGSKERLDYGTGHELSFLAVVSAIDMLDLWGSNPSGEDILFLFNG
Sbjct: 121 YHVCIVEIRYYLGNAFGSKERLDYGTGHELSFLAVVSAIDMLDLWGSNPSGEDILFLFNG 180

Query: 181 YYTLVKKLIATYTLEPAGSHGVWGLDDHFHLAYILGSSQLAPISHNPLRPSDILDRHTVE 240
           YYTLVKKLIATYTLEPAGSHGVWGLDDHFHLAYILGSSQLAPISHNPLRPSDILDRHTVE
Sbjct: 181 YYTLVKKLIATYTLEPAGSHGVWGLDDHFHLAYILGSSQLAPISHNPLRPSDILDRHTVE 240

Query: 241 DYAKTNLYFQAIAFIDKVKSGSFSEHSPMLYDIAKTVSTWSKVQRGLLKMYSAEVLNKFP 300
           DYAKTNLYFQAIAFIDKVKSGSFSEHSPMLYDIAKTVSTWSKVQRGLLKMYSAEVLNKFP
Sbjct: 241 DYAKTNLYFQAIAFIDKVKSGSFSEHSPMLYDIAKTVSTWSKVQRGLLKMYSAEVLNKFP 300

Query: 301 VVQHFWFGTGFFPWVNVKSGAILPTYEANQEENPHFSSVTSISNMPTATKSVLXXXXXXX 360
           VVQHFWFGTGFFPWVNVKSGAILPTYEANQEENPHFSSVTSISNMPTATKSVL       
Sbjct: 301 VVQHFWFGTGFFPWVNVKSGAILPTYEANQEENPHFSSVTSISNMPTATKSVLPATSSTT 360

Query: 361 XXXXXXXXXRNSPMGKFANRDRFKR 385
                    RNSPMGKFANRDRFKR
Sbjct: 361 MPPPTILPSRNSPMGKFANRDRFKR 385

>KLTH0E00880g Chr5 (87353..88468) [1116 bp, 371 aa] {ON} similar to
           uniprot|P40454 Saccharomyces cerevisiae YIL153W RRD1
           Resistant to Rapamycin Deletion
          Length = 371

 Score =  442 bits (1138), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 203/327 (62%), Positives = 250/327 (76%)

Query: 5   ITTPKIDVSHTKFTEPVKKIFDTQGTQDFQSSVTMYRLQSYLHKYITLVGTKNIPSTSNN 64
           ++  +ID S   FTEP K+IFD++G+  FQSSV M RL+SYLHKY++ +    IP TS N
Sbjct: 1   MSLERIDASSATFTEPTKRIFDSRGSHVFQSSVAMGRLKSYLHKYVSSMSGVKIPETSTN 60

Query: 65  DAVNRFTQIIDALSRTIDETPPLPGPRRFGNFACRTWHVKMRGSLDALLQAFIPEKYHVC 124
             V  F +++  LS  +D TP LPGPRR+GN ACRTWH K+  SL+ALL  F+PE  H  
Sbjct: 61  HEVRSFAELLKTLSELVDSTPALPGPRRYGNLACRTWHDKVDESLEALLHKFLPEPCHKS 120

Query: 125 IVEIRYYLGNAFGSKERLDYGTGHELSFLAVVSAIDMLDLWGSNPSGEDILFLFNGYYTL 184
           IVE++YYLGNAFGS+ERLDYGTGHELSF A + A+DML +WG++    D+LFLF+ YY L
Sbjct: 121 IVELQYYLGNAFGSRERLDYGTGHELSFFAEICALDMLGVWGADFQASDVLFLFDKYYAL 180

Query: 185 VKKLIATYTLEPAGSHGVWGLDDHFHLAYILGSSQLAPISHNPLRPSDILDRHTVEDYAK 244
           V+KL+ TYTLEPAGSHGVWGLDDHFHL YI G+SQ       P+ P ++ D+  V++Y K
Sbjct: 181 VRKLVLTYTLEPAGSHGVWGLDDHFHLIYIFGASQWVDGKCAPIAPREVQDKLIVDEYTK 240

Query: 245 TNLYFQAIAFIDKVKSGSFSEHSPMLYDIAKTVSTWSKVQRGLLKMYSAEVLNKFPVVQH 304
           TN Y QAI+FI +VKSG FSEHSPML+DI+++V TWSKVQRGLLKMY AEVLNKFPVVQH
Sbjct: 241 TNFYCQAISFIFQVKSGPFSEHSPMLFDISRSVPTWSKVQRGLLKMYFAEVLNKFPVVQH 300

Query: 305 FWFGTGFFPWVNVKSGAILPTYEANQE 331
           FWFGTG FPW ++  G  LPTYEA+QE
Sbjct: 301 FWFGTGLFPWTSLGDGYALPTYEASQE 327

>Kwal_55.19661 s55 (69740..70855) [1116 bp, 371 aa] {ON} YIL153W
           (RRD1) - Resistant to Rapamycin Deletion [contig 159]
           FULL
          Length = 371

 Score =  434 bits (1115), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 203/342 (59%), Positives = 251/342 (73%)

Query: 9   KIDVSHTKFTEPVKKIFDTQGTQDFQSSVTMYRLQSYLHKYITLVGTKNIPSTSNNDAVN 68
           +IDV  T FTEPVK+IFD++GT  FQSSV M RL+ +LHKY+ ++  + IPS ++N  V 
Sbjct: 5   QIDVGTTTFTEPVKRIFDSRGTHVFQSSVAMIRLKKHLHKYLGMLSGQRIPSETSNPNVI 64

Query: 69  RFTQIIDALSRTIDETPPLPGPRRFGNFACRTWHVKMRGSLDALLQAFIPEKYHVCIVEI 128
              +I+   S+ +DETP LPGPRR+GN ACR WH KM   +   LQ F+PEKY+  IVE+
Sbjct: 65  SLRKILHFFSKLVDETPALPGPRRYGNLACRDWHDKMEEQIREQLQEFLPEKYYPSIVEL 124

Query: 129 RYYLGNAFGSKERLDYGTGHELSFLAVVSAIDMLDLWGSNPSGEDILFLFNGYYTLVKKL 188
            YYLGNAFGS+ERLDYGTGHELSF +V+ A+DML +WGS    +D+L+LFN YY+LV+KL
Sbjct: 125 AYYLGNAFGSRERLDYGTGHELSFFSVICALDMLGIWGSGFQAKDLLYLFNEYYSLVRKL 184

Query: 189 IATYTLEPAGSHGVWGLDDHFHLAYILGSSQLAPISHNPLRPSDILDRHTVEDYAKTNLY 248
           I  Y+LEPAGSHGVWGLDDHFHL YI G+SQ A        P +I  +  V++YA +N Y
Sbjct: 185 ITKYSLEPAGSHGVWGLDDHFHLIYIFGASQWADSKDAEASPREIQSKMIVDEYAGSNFY 244

Query: 249 FQAIAFIDKVKSGSFSEHSPMLYDIAKTVSTWSKVQRGLLKMYSAEVLNKFPVVQHFWFG 308
            QAI+FI KVKSG FSEHSPMLYDI+++V TWSKVQRGLLKMY AEVLNKFPVVQHFWFG
Sbjct: 245 CQAISFIFKVKSGPFSEHSPMLYDISRSVPTWSKVQRGLLKMYFAEVLNKFPVVQHFWFG 304

Query: 309 TGFFPWVNVKSGAILPTYEANQEENPHFSSVTSISNMPTATK 350
           T  FPW +   G +LPTYE +QE +          + P+ TK
Sbjct: 305 TALFPWTSTDGGDVLPTYEVSQETDTQAQLPRMTQHQPSMTK 346

>TDEL0B02110 Chr2 (376429..377598) [1170 bp, 389 aa] {ON} Anc_5.709
           YIL153W
          Length = 389

 Score =  420 bits (1080), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 201/340 (59%), Positives = 245/340 (72%), Gaps = 1/340 (0%)

Query: 5   ITTPKIDVSHTKFTEPVKKIFDTQGTQDFQSSVTMYRLQSYLHKYITLV-GTKNIPSTSN 63
           I+ P+ID+S TKF  PVK IFD+QG  DFQ SV + RL+ +L KY  ++ G   +   S 
Sbjct: 2   ISEPRIDISQTKFESPVKCIFDSQGASDFQQSVAIDRLKYHLEKYARMIHGQPIVHEPSG 61

Query: 64  NDAVNRFTQIIDALSRTIDETPPLPGPRRFGNFACRTWHVKMRGSLDALLQAFIPEKYHV 123
            + VNR   ++  LS  +DETPP  GPRR+GN ACR WH K+  +L  LLQ  +P+ YH 
Sbjct: 62  IEVVNRVVSLLSRLSELVDETPPFSGPRRYGNLACRDWHDKLDANLTELLQQVLPQDYHK 121

Query: 124 CIVEIRYYLGNAFGSKERLDYGTGHELSFLAVVSAIDMLDLWGSNPSGEDILFLFNGYYT 183
           CI E+ YYLGN+FGS  RLDYGTGHELSFLAV+ A+DML LW S  SG+D+L LF+ YY 
Sbjct: 122 CIPELSYYLGNSFGSSTRLDYGTGHELSFLAVLGALDMLGLWTSEFSGKDVLLLFDTYYK 181

Query: 184 LVKKLIATYTLEPAGSHGVWGLDDHFHLAYILGSSQLAPISHNPLRPSDILDRHTVEDYA 243
           LV+KLI TYTLEPAGSHGVWGLDDHFH+ YILGSSQ +     P+ P D+ ++  V+DYA
Sbjct: 182 LVRKLILTYTLEPAGSHGVWGLDDHFHIIYILGSSQWSSDPAVPMTPRDVKNKVLVQDYA 241

Query: 244 KTNLYFQAIAFIDKVKSGSFSEHSPMLYDIAKTVSTWSKVQRGLLKMYSAEVLNKFPVVQ 303
            TNLY QAI FI  VKSG FSEHS MLYDIA TV TWSKVQ GLLKMY  EVL KFPVVQ
Sbjct: 242 DTNLYCQAIDFIFHVKSGPFSEHSSMLYDIASTVQTWSKVQSGLLKMYYVEVLKKFPVVQ 301

Query: 304 HFWFGTGFFPWVNVKSGAILPTYEANQEENPHFSSVTSIS 343
           HFWFG GF+PW++ ++G  LP YE  + E     S+T+++
Sbjct: 302 HFWFGPGFYPWISDRNGQKLPIYENAESEKKQPPSMTTMA 341

>AFR293C Chr6 complement(967308..968405) [1098 bp, 365 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL153W
           (RRD1)
          Length = 365

 Score =  418 bits (1074), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 198/325 (60%), Positives = 245/325 (75%), Gaps = 2/325 (0%)

Query: 9   KIDVSHTKFTEPVKKIFDTQGTQDFQSSVTMYRLQSYLHKYITLVGTKNIPSTSNNDAVN 68
           +  V  T+F+ PVK+IFDT GT DFQ S+TMYRLQS+L +Y+ LV  + IP +S N AV 
Sbjct: 2   EFSVEGTQFSPPVKRIFDTAGTHDFQKSLTMYRLQSHLERYLKLVQGQKIPKSSQNRAVV 61

Query: 69  RFTQIIDALSRTIDETPPLPG-PRRFGNFACRTWHVKMRGSLDALLQAFIPEKYHVCIVE 127
           RF  I++ L   +DETPP  G  RRFG+ ACR WH +M+G LD LL+  +PE       E
Sbjct: 62  RFVCILERLDALMDETPPRTGSARRFGDLACRDWHDRMQGELDGLLETLLPEAARRSAAE 121

Query: 128 IRYYLGNAFGSKERLDYGTGHELSFLAVVSAIDMLDLWGSNP-SGEDILFLFNGYYTLVK 186
           +RYYLG+AFGS+ERLDYGTGHEL+FLAVV A+DML LW  +  +GED+L+++  YY LV 
Sbjct: 122 LRYYLGSAFGSRERLDYGTGHELAFLAVVVALDMLGLWTEDKFTGEDMLYVWARYYALVH 181

Query: 187 KLIATYTLEPAGSHGVWGLDDHFHLAYILGSSQLAPISHNPLRPSDILDRHTVEDYAKTN 246
           +LI TY LEPAGSHGVWGLDDH HLAYILG+SQ A   + P++PSDILD   V  Y++TN
Sbjct: 182 RLILTYNLEPAGSHGVWGLDDHLHLAYILGASQWAQDRNVPMQPSDILDPKAVARYSETN 241

Query: 247 LYFQAIAFIDKVKSGSFSEHSPMLYDIAKTVSTWSKVQRGLLKMYSAEVLNKFPVVQHFW 306
           LY  +IAF+ +VK+G F++HSPML+DIA+TV TWSKV  GL+KMY  EVLNKFPVVQHFW
Sbjct: 242 LYCNSIAFLLRVKTGHFAQHSPMLHDIAQTVPTWSKVTTGLIKMYRVEVLNKFPVVQHFW 301

Query: 307 FGTGFFPWVNVKSGAILPTYEANQE 331
           FGTGFFPWV++  G  LP YEA  E
Sbjct: 302 FGTGFFPWVDMAHGMSLPNYEAPSE 326

>Ecym_4012 Chr4 (29674..30861) [1188 bp, 395 aa] {ON} similar to
           Ashbya gossypii AFR293C
          Length = 395

 Score =  414 bits (1063), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 206/360 (57%), Positives = 256/360 (71%), Gaps = 18/360 (5%)

Query: 10  IDVSHTKFTEPVKKIFDTQGTQDFQSSVTMYRLQSYLHKYITLVGTKNIPSTSNNDAVNR 69
           +++  TKF+ PVK+IFD+ GT DFQ S+TMYRLQS+L +Y+ LV  + +P  S N +V+ 
Sbjct: 3   VELRKTKFSAPVKRIFDSHGTHDFQRSLTMYRLQSHLERYLGLVHNQEVPKVSTNGSVSS 62

Query: 70  FTQI-IDALSRTIDETPPLPG-PRRFGNFACRTWHVKMRGSLDALLQAFIP----EKYHV 123
           F  I +D     IDETPP    PRRFGN ACR WH K++  +D+L + F+P      Y  
Sbjct: 63  FVSIFLDRFLELIDETPPTTNTPRRFGNMACRDWHAKVQEEMDSLWRRFLPIERDAAYEN 122

Query: 124 CIVEIRYYLGNAFGSKERLDYGTGHELSFLAVVSAIDMLDLWGSNPSGE-----DILFLF 178
           CI+E+RYYLGNAFGS ERLDYGTGHELSFLAVV A+DML LW ++ SG      D+L+L+
Sbjct: 123 CIIELRYYLGNAFGSPERLDYGTGHELSFLAVVVAVDMLGLWETSESGHGLTGTDLLYLW 182

Query: 179 NGYYTLVKKLIATYTLEPAGSHGVWGLDDHFHLAYILGSSQLAPISHN-PLRPSDILDRH 237
           N YY++V KLI TYTLEPAGSHGVWGLDDH HLAYI+G+SQ +    N P++ SDILD  
Sbjct: 183 NKYYSIVHKLILTYTLEPAGSHGVWGLDDHIHLAYIIGASQWSDKDQNAPIQLSDILDMK 242

Query: 238 TVEDYAKTNLYFQAIAFIDKVKSGSFSEHSPMLYDIAKTVSTWSKVQRGLLKMYSAEVLN 297
           ++  Y  TNLY  +IAF+ KVKSG FS+HSPMLYDI++TV TWSK   GL+KMY  EVLN
Sbjct: 243 SLYQYEDTNLYCNSIAFVMKVKSGPFSQHSPMLYDISRTVPTWSKATSGLIKMYQVEVLN 302

Query: 298 KFPVVQHFWFGTGFFPWVNVKSGAILPTYE------ANQEENPHFSSVTSISNMPTATKS 351
           KFPVVQHFWFGTGFFPWV++K G  LP YE        +      +S  S + +PTAT S
Sbjct: 303 KFPVVQHFWFGTGFFPWVDMKKGMSLPNYELYSKGACKERAVDGDASEDSTTAVPTATGS 362

>NCAS0G00200 Chr7 (29159..30475) [1317 bp, 438 aa] {ON} Anc_5.709
          Length = 438

 Score =  409 bits (1050), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 199/337 (59%), Positives = 243/337 (72%), Gaps = 15/337 (4%)

Query: 10  IDVSHTKFTEPVKKIFDTQGTQDFQSSVTMYRLQSYLHKYITLVGTKNIP---STSNNDA 66
           +D+  T+F+ P K+IFD+Q TQDFQSS+ + RL+ +L KYI++V     P   + S+   
Sbjct: 33  LDLKTTQFSLPAKRIFDSQTTQDFQSSIALNRLRFFLQKYISMVTNVQTPPEGTLSSVTL 92

Query: 67  VNRFTQIIDALSRTIDETPPLPGPRRFGNFACRTWHVKMRGSLDALLQA----FIPE--- 119
           VN   Q+++ LS  IDETPPL GPRR+GN ACR WH KM   L ALL      ++P+   
Sbjct: 93  VNSIVQLLNHLSTLIDETPPLVGPRRYGNLACRDWHTKMEAQLPALLNEILDPYLPKVSG 152

Query: 120 ---KYHVCIVEIRYYLGNAFGSKERLDYGTGHELSFLAVVSAIDMLDLWGSNPSGEDILF 176
                H CI E+ YY+ NAFGS  RLD+GTGHELSF+A ++AIDML LW     G DIL 
Sbjct: 153 ESSSMHPCIQELNYYISNAFGSSTRLDFGTGHELSFMAFIAAIDMLGLWTDGMQGTDILL 212

Query: 177 LFNGYYTLVKKLIATYTLEPAGSHGVWGLDDHFHLAYILGSSQLAPISHNPLRPSDILDR 236
           LFN YY LV+KLI TYTLEPAGSHGVWGLDDHFHLAYILGSSQ   I + P+RP D+ D 
Sbjct: 213 LFNTYYALVRKLILTYTLEPAGSHGVWGLDDHFHLAYILGSSQW--IRNAPMRPRDVKDI 270

Query: 237 HTVEDYAKTNLYFQAIAFIDKVKSGSFSEHSPMLYDIAKTVSTWSKVQRGLLKMYSAEVL 296
             V+ YAK+NLY Q IAFI +VKSG FSEHSP+LYDIA +V+TWSKVQRGL+KMY  EVL
Sbjct: 271 SLVKQYAKSNLYCQCIAFIFQVKSGPFSEHSPILYDIATSVTTWSKVQRGLIKMYMDEVL 330

Query: 297 NKFPVVQHFWFGTGFFPWVNVKSGAILPTYEANQEEN 333
            KFPVVQHFWFG GF+PW+N  +G  LP YE + E++
Sbjct: 331 KKFPVVQHFWFGDGFYPWINQHTGKPLPIYEHSPEDD 367

>Suva_9.35 Chr9 (49860..51041) [1182 bp, 393 aa] {ON} YIL153W (REAL)
          Length = 393

 Score =  400 bits (1029), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 190/346 (54%), Positives = 249/346 (71%), Gaps = 6/346 (1%)

Query: 10  IDVSHTKFTEPVKKIFDTQGTQDFQSSVTMYRLQSYLHKYITLVGTKNIP----STSNND 65
           +D  H  F+ PVK+IFDTQ TQDFQSS+ ++R++ +LHKY TL+     P    + S+  
Sbjct: 6   VDWPHAAFSTPVKRIFDTQTTQDFQSSLAIHRIKYHLHKYTTLMSHCADPDPHATASSIP 65

Query: 66  AVNRFTQIIDALSRTIDETPPLPGPRRFGNFACRTWHVKMRGSLDALLQAFIPEKYHVCI 125
            VN    ++D  ++ ID+TPPLPGPRR+GN ACR WH K+   L   L+  +P +YH  +
Sbjct: 66  MVNGLMAVLDRFAQLIDDTPPLPGPRRYGNLACREWHYKLDAHLAQWLREVLPAQYHAVV 125

Query: 126 VEIRYYLGNAFGSKERLDYGTGHELSFLAVVSAIDMLDLWGSNPSGEDILFLFNGYYTLV 185
            E++YYLGN+FGS  RLDYGTGHELSF+A V+A+D+L L+  +  G D+  LF+ YY ++
Sbjct: 126 PELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDLLGLF-PHLRGTDVFLLFSKYYAIM 184

Query: 186 KKLIATYTLEPAGSHGVWGLDDHFHLAYILGSSQLAPI-SHNPLRPSDILDRHTVEDYAK 244
           ++LI TYTLEPAGSHGVWGLDDHFHL YILGSSQ   + +  PL+P D+LD+  V +Y  
Sbjct: 185 RRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPRDVLDKSLVREYQD 244

Query: 245 TNLYFQAIAFIDKVKSGSFSEHSPMLYDIAKTVSTWSKVQRGLLKMYSAEVLNKFPVVQH 304
           TN Y Q I FI++VK G F EHSP+LYDIA TV  WSKV +GLLKMYS EVL KFPVVQH
Sbjct: 245 TNFYCQGINFINQVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLQKFPVVQH 304

Query: 305 FWFGTGFFPWVNVKSGAILPTYEANQEENPHFSSVTSISNMPTATK 350
           FWFGTGFFPW+NV++G  LP +E  +EE+   ++ TS +   T+T+
Sbjct: 305 FWFGTGFFPWINVQNGTDLPVFEEKEEESIDQANATSATPDRTSTR 350

>Skud_9.15 Chr9 (32255..33463) [1209 bp, 402 aa] {ON} YIL153W (REAL)
          Length = 402

 Score =  400 bits (1029), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 192/346 (55%), Positives = 249/346 (71%), Gaps = 6/346 (1%)

Query: 10  IDVSHTKFTEPVKKIFDTQGTQDFQSSVTMYRLQSYLHKYITLVGTKNIP----STSNND 65
           +D  H  F+ PVK+IFDTQ T DFQSS+ ++R++ +LHKY TL+     P    ++S+  
Sbjct: 15  VDWLHATFSTPVKRIFDTQTTLDFQSSLAIHRIKYHLHKYTTLMSHCPDPDAHAASSSIA 74

Query: 66  AVNRFTQIIDALSRTIDETPPLPGPRRFGNFACRTWHVKMRGSLDALLQAFIPEKYHVCI 125
            VN    ++D L++ IDETPPLPGPRR+GN ACR WH K+   L   LQ  +P +YHV +
Sbjct: 75  MVNGLMGVLDKLAQLIDETPPLPGPRRYGNLACREWHYKLDEHLSQWLQEMLPAEYHVVV 134

Query: 126 VEIRYYLGNAFGSKERLDYGTGHELSFLAVVSAIDMLDLWGSNPSGEDILFLFNGYYTLV 185
            E++YYLGN+FGS  RLDYGTGHELSF+A V+A+D+L ++  +  G D+  LFN YYT++
Sbjct: 135 PELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDLLGVF-PHLRGNDVFLLFNKYYTIM 193

Query: 186 KKLIATYTLEPAGSHGVWGLDDHFHLAYILGSSQLAPI-SHNPLRPSDILDRHTVEDYAK 244
           ++LI TYTLEPAGSHGVWGLDDHFHL YILGSSQ   + +  PL+P ++LD+  V DY  
Sbjct: 194 RRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDARAPLQPREVLDKSLVHDYKD 253

Query: 245 TNLYFQAIAFIDKVKSGSFSEHSPMLYDIAKTVSTWSKVQRGLLKMYSAEVLNKFPVVQH 304
           TN Y Q I FI++VK G F EHSP+LYDIA TV  WSKV +GLLKMYS EVL KFPVVQH
Sbjct: 254 TNFYCQGINFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKFPVVQH 313

Query: 305 FWFGTGFFPWVNVKSGAILPTYEANQEENPHFSSVTSISNMPTATK 350
           FWFGTGFFPWVN+++G  LP +E  ++E    ++  S     T+T+
Sbjct: 314 FWFGTGFFPWVNIQNGTDLPVFEEKEDETIEQANAASPGPNHTSTR 359

>ZYRO0B16478g Chr2 complement(1336755..1337930) [1176 bp, 391 aa]
           {ON} similar to uniprot|P40454 Saccharomyces cerevisiae
           YIL153W RRD1 Resistant to Rapamycin Deletion
          Length = 391

 Score =  395 bits (1014), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 183/327 (55%), Positives = 236/327 (72%), Gaps = 1/327 (0%)

Query: 13  SHTKFTEPVKKIFDTQGTQDFQSSVTMYRLQSYLHKYITLVGTKNIPS-TSNNDAVNRFT 71
            +T+F  PVK+IFD+Q T +FQ+SV + RL+ ++ KY  ++   NIP   S    VN F 
Sbjct: 7   ENTQFNTPVKRIFDSQCTLEFQASVAIVRLKYFIQKYAKIINRVNIPQGPSRISVVNEFV 66

Query: 72  QIIDALSRTIDETPPLPGPRRFGNFACRTWHVKMRGSLDALLQAFIPEKYHVCIVEIRYY 131
            +++ +S  +D+TPPL GPRR+GN ACR WH K+   + +L +  +P+++H CIVE+ +Y
Sbjct: 67  GVLNHMSLLVDQTPPLEGPRRYGNLACRDWHAKIDEQMPSLWRKVLPDRFHHCIVELVHY 126

Query: 132 LGNAFGSKERLDYGTGHELSFLAVVSAIDMLDLWGSNPSGEDILFLFNGYYTLVKKLIAT 191
           LGN+FGS  RLDYGTGHELSFLAVV AIDML L+     GED L + N YY +V+KLI T
Sbjct: 127 LGNSFGSATRLDYGTGHELSFLAVVGAIDMLGLFTDEFQGEDFLLIMNAYYAVVRKLILT 186

Query: 192 YTLEPAGSHGVWGLDDHFHLAYILGSSQLAPISHNPLRPSDILDRHTVEDYAKTNLYFQA 251
           YTLEPAGSHGVWGLDDHFHLAY+ GS+Q A     PLRP DIL+ H V++YA  NLY Q 
Sbjct: 187 YTLEPAGSHGVWGLDDHFHLAYVFGSAQWANYKEAPLRPRDILNHHLVQEYAHLNLYCQT 246

Query: 252 IAFIDKVKSGSFSEHSPMLYDIAKTVSTWSKVQRGLLKMYSAEVLNKFPVVQHFWFGTGF 311
           I FI +VK G F EHS MLYD+A TV TW+K++ GL+KMY+ EVLNKFPVVQHFWFGTGF
Sbjct: 247 IGFIYQVKRGPFREHSSMLYDLATTVHTWAKLESGLMKMYAVEVLNKFPVVQHFWFGTGF 306

Query: 312 FPWVNVKSGAILPTYEANQEENPHFSS 338
           +PWV+ ++G  L  Y+    +  + SS
Sbjct: 307 YPWVDNQTGKQLLIYDPADADRRNTSS 333

>YIL153W Chr9 (55198..56379) [1182 bp, 393 aa] {ON}
           RRD1Peptidyl-prolyl cis/trans-isomerase; activator of
           the phosphotyrosyl phosphatase activity of PP2A;
           involved in G1 phase progression, microtubule dynamics,
           bud morphogenesis and DNA repair; required for rapid
           reduction of Sgs1p levels in response to rapamycin;
           subunit of the Tap42p-Sit4p-Rrd1p complex
          Length = 393

 Score =  395 bits (1014), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 187/323 (57%), Positives = 237/323 (73%), Gaps = 6/323 (1%)

Query: 9   KIDVSHTKFTEPVKKIFDTQGTQDFQSSVTMYRLQSYLHKYITLVGTKNIP----STSNN 64
           ++D  H  F+ PVK+IFDTQ T DFQSS+ ++R++ +LHKY TL+   + P    + S+ 
Sbjct: 5   RVDWPHATFSTPVKRIFDTQTTLDFQSSLAIHRIKYHLHKYTTLISHCSDPDPHATASSI 64

Query: 65  DAVNRFTQIIDALSRTIDETPPLPGPRRFGNFACRTWHVKMRGSLDALLQAFIPEKYHVC 124
             VN    ++D L+  IDETPPLPGPRR+GN ACR WH K+   L   LQ  +P +YH  
Sbjct: 65  AMVNGLMGVLDKLAHLIDETPPLPGPRRYGNLACREWHHKLDERLPQWLQEMLPSEYHEV 124

Query: 125 IVEIRYYLGNAFGSKERLDYGTGHELSFLAVVSAIDMLDLWGSNPSGEDILFLFNGYYTL 184
           + E++YYLGN+FGS  RLDYGTGHELSF+A V+A+DML ++  +  G D+  LFN YYT+
Sbjct: 125 VPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDMLGMF-PHMRGADVFLLFNKYYTI 183

Query: 185 VKKLIATYTLEPAGSHGVWGLDDHFHLAYILGSSQLAPI-SHNPLRPSDILDRHTVEDYA 243
           +++LI TYTLEPAGSHGVWGLDDHFHL YILGSSQ   + +  PL+P +ILD+  V +Y 
Sbjct: 184 MRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPREILDKSLVREYK 243

Query: 244 KTNLYFQAIAFIDKVKSGSFSEHSPMLYDIAKTVSTWSKVQRGLLKMYSAEVLNKFPVVQ 303
            TN Y Q I FI++VK G F EHSP+LYDIA TV  WSKV +GLLKMYS EVL KFPVVQ
Sbjct: 244 DTNFYCQGINFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKFPVVQ 303

Query: 304 HFWFGTGFFPWVNVKSGAILPTY 326
           HFWFGTGFFPWVN+++G  LP +
Sbjct: 304 HFWFGTGFFPWVNIQNGTDLPVF 326

>Kpol_2001.77 s2001 complement(211870..213111) [1242 bp, 413 aa]
           {ON} complement(211870..213111) [1242 nt, 414 aa]
          Length = 413

 Score =  394 bits (1013), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 189/338 (55%), Positives = 239/338 (70%), Gaps = 10/338 (2%)

Query: 5   ITTPKIDVSHTKFTEPVKKIFDTQGTQDFQSSVTMYRLQSYLHKYITLVGTKNIPS---T 61
           +  P ++    +F  PVK+I+D+QGT  FQSSV ++RL+ ++ KYI LV   +IP     
Sbjct: 3   MKQPLLNKEPIEFCLPVKRIYDSQGTSLFQSSVAIFRLKYFISKYIKLVPNVDIPDESYV 62

Query: 62  SNNDAVNRFTQIIDALSRTIDETPPLPGPRRFGNFACRTWHVKMRGSLDALLQAF----- 116
           S    VN+  ++I  LS  +DETPP PGPRRFGN +CR WH K+  +L +LL        
Sbjct: 63  SEIPTVNKLVKLISELSLLVDETPPAPGPRRFGNLSCREWHKKVDLNLKSLLMKMLTDDK 122

Query: 117 --IPEKYHVCIVEIRYYLGNAFGSKERLDYGTGHELSFLAVVSAIDMLDLWGSNPSGEDI 174
             I  K    +VE+ YYLGN+FGS  RLDYGTGHELSF+AV++ IDML LW  N  G D+
Sbjct: 123 QNISSKCKDSVVELSYYLGNSFGSSTRLDYGTGHELSFIAVIAGIDMLGLWTENIKGGDL 182

Query: 175 LFLFNGYYTLVKKLIATYTLEPAGSHGVWGLDDHFHLAYILGSSQLAPISHNPLRPSDIL 234
           L +FN YY L+KKLI TYTLEPAGSHGVWGLDDHFH AYILGS+Q +  ++ PL+P DI+
Sbjct: 183 LIIFNEYYKLMKKLILTYTLEPAGSHGVWGLDDHFHFAYILGSAQWSETNNPPLKPMDIV 242

Query: 235 DRHTVEDYAKTNLYFQAIAFIDKVKSGSFSEHSPMLYDIAKTVSTWSKVQRGLLKMYSAE 294
           ++  V +YA TN+Y  AI FID VKSG FSEHSPMLYDI+++V  WSKV+ GLLKMY  E
Sbjct: 243 NKDLVCEYANTNMYCSAIKFIDCVKSGPFSEHSPMLYDISQSVHNWSKVESGLLKMYMVE 302

Query: 295 VLNKFPVVQHFWFGTGFFPWVNVKSGAILPTYEANQEE 332
           VLNKFPVVQHFWFGTG FPW++  +   LP YE + ++
Sbjct: 303 VLNKFPVVQHFWFGTGLFPWIDNNTKKSLPLYENDAKK 340

>Smik_9.16 Chr9 (32798..33979) [1182 bp, 393 aa] {ON} YIL153W (REAL)
          Length = 393

 Score =  391 bits (1004), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 186/322 (57%), Positives = 235/322 (72%), Gaps = 6/322 (1%)

Query: 10  IDVSHTKFTEPVKKIFDTQGTQDFQSSVTMYRLQSYLHKYITLVGTKNIPS----TSNND 65
           +D  H  F+ PVK+IFDTQ T DFQSS+ ++R++ +LHKY TL+     P      S+  
Sbjct: 6   VDWPHATFSTPVKRIFDTQTTLDFQSSLAIHRIKYHLHKYTTLMSHCADPDPQAVASSIP 65

Query: 66  AVNRFTQIIDALSRTIDETPPLPGPRRFGNFACRTWHVKMRGSLDALLQAFIPEKYHVCI 125
             N   Q++D L+  IDETPPLPGPRR+GN ACR WH K+   L   L+  +P +YHV +
Sbjct: 66  MDNGLMQVLDKLAHLIDETPPLPGPRRYGNLACREWHHKLDERLPQWLREMLPPEYHVVV 125

Query: 126 VEIRYYLGNAFGSKERLDYGTGHELSFLAVVSAIDMLDLWGSNPSGEDILFLFNGYYTLV 185
            E++YYLGN+FGS  RLDYGTGHELSF+A V+A+D+L ++  +  G D+  LFN YYT++
Sbjct: 126 PELQYYLGNSFGSSTRLDYGTGHELSFMATVTALDLLGMF-PHLRGTDVFLLFNKYYTIM 184

Query: 186 KKLIATYTLEPAGSHGVWGLDDHFHLAYILGSSQLAPI-SHNPLRPSDILDRHTVEDYAK 244
           ++LI TYTLEPAGSHGVWGLDDHFHL YILGSSQ   + +  PL+P +ILD+  V +Y  
Sbjct: 185 RRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPREILDKSLVREYKN 244

Query: 245 TNLYFQAIAFIDKVKSGSFSEHSPMLYDIAKTVSTWSKVQRGLLKMYSAEVLNKFPVVQH 304
           TN Y Q I FI++VK G F EHSP+LYDIA TV  WSKV +GLLKMYS EVL KFPVVQH
Sbjct: 245 TNFYCQGINFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKFPVVQH 304

Query: 305 FWFGTGFFPWVNVKSGAILPTY 326
           FWFGTGFFPWVN+++G  LP +
Sbjct: 305 FWFGTGFFPWVNIQNGTNLPVF 326

>NDAI0F00240 Chr6 (46047..47441) [1395 bp, 464 aa] {ON} Anc_5.709
          Length = 464

 Score =  379 bits (974), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 182/328 (55%), Positives = 235/328 (71%), Gaps = 9/328 (2%)

Query: 10  IDVSHTKFTEPVKKIFDTQGTQDFQSSVTMYRLQSYLHKYITLVGTKNIPS-----TSNN 64
           +D+  T F+ PVK+IFD+Q TQDFQSS+ + RL+ +L +YI LV    IP       S  
Sbjct: 14  LDLKATNFSLPVKRIFDSQTTQDFQSSIALQRLRFFLQRYIELVANVEIPPHPDSYVSEI 73

Query: 65  DAVNRFTQIIDALSRTIDETPPLPGPRRFGNFACRTWHVKMRGSLDALLQAFIPE-KYHV 123
             VN    +++ LS  + +TPPL GPRR+GN ACR WH K+   L  LL+  IP      
Sbjct: 74  LMVNSIIHLLNELSTIVQDTPPLKGPRRYGNLACRDWHSKIEVELPKLLEKAIPSPDLQP 133

Query: 124 CIVEIRYYLGNAFGSKERLDYGTGHELSFLAVVSAIDMLDLWGSNPSGEDILFLFNGYYT 183
            I+E+ YY+ N+FGS  RLDYGTGHELSF+A ++A+DML L+  + +G+D+L +FN YY+
Sbjct: 134 SIIELNYYIANSFGSSTRLDYGTGHELSFMAFIAALDMLGLF-PDLTGKDLLIMFNAYYS 192

Query: 184 LVKKLIATYTLEPAGSHGVWGLDDHFHLAYILGSSQLAPISHNPLRPSDILDRHTVEDYA 243
           LV++LI TYTLEPAGSHGVWGLDDHFHLAYILGSSQ   +++ PL P +I +   V+DY+
Sbjct: 193 LVRELILTYTLEPAGSHGVWGLDDHFHLAYILGSSQW--LNNAPLTPKEITNSRLVKDYS 250

Query: 244 KTNLYFQAIAFIDKVKSGSFSEHSPMLYDIAKTVSTWSKVQRGLLKMYSAEVLNKFPVVQ 303
             NLY Q I F+  VKSG F+EHSP+LYDI+ +VS W KVQRGL+KMY  EVLNKFPVVQ
Sbjct: 251 TKNLYCQCIEFVLTVKSGPFAEHSPILYDISTSVSAWRKVQRGLIKMYMDEVLNKFPVVQ 310

Query: 304 HFWFGTGFFPWVNVKSGAILPTYEANQE 331
           HFWFGTGF+PW+N ++   LP YE + E
Sbjct: 311 HFWFGTGFYPWINFQTLRELPVYEHSPE 338

>TPHA0D04650 Chr4 complement(1015658..1016923) [1266 bp, 421 aa]
           {ON} Anc_5.709 YIL153W
          Length = 421

 Score =  377 bits (969), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 188/348 (54%), Positives = 233/348 (66%), Gaps = 16/348 (4%)

Query: 10  IDVSHTKFTEPVKKIFDTQGTQDFQSSVTMYRLQSYLHKYITLVGTKNIPS---TSNNDA 66
           I++    F+ P+K+I+D+Q T  FQSS+ +YRL+ YLHKYI +V    IP     S    
Sbjct: 7   INIKEQSFSLPLKRIYDSQSTFTFQSSIAIYRLKYYLHKYINMVHNVEIPDLTYVSEITI 66

Query: 67  VNRFTQIIDALSRTIDETPPLPGPRRFGNFACRTWHVKMRGSLDALLQAFIP-------- 118
           VN  + ++  LS  ID  PP  GPRR+GN ACR WH  +   +  LL+  +         
Sbjct: 67  VNEMSSLLTELSNDIDTIPPFEGPRRYGNLACRNWHSLIDSKVPLLLEKVLGCSNHATEK 126

Query: 119 ---EKYHVCIVEIRYYLGNAFGSKERLDYGTGHELSFLAVVSAIDMLDLWGSNPSGEDIL 175
              EK   CI+E+ YYL N+ GS  RLDYGTGHELSFLAV++A+DML LW  N  G D+L
Sbjct: 127 GEFEKLKGCIIELNYYLCNSLGSATRLDYGTGHELSFLAVIAAMDMLGLWTENFKGVDLL 186

Query: 176 FLFNGYYTLVKKLIATYTLEPAGSHGVWGLDDHFHLAYILGSSQLAPISHNPLRPSDILD 235
            +F+ YY LVKKLI TYTLEPAGSHGVWGLDDHFHL+YILGSSQL+   + P  PSDI++
Sbjct: 187 HMFHCYYELVKKLIVTYTLEPAGSHGVWGLDDHFHLSYILGSSQLSENPNPPFSPSDIIN 246

Query: 236 RHTVEDYAKTNLYFQAIAFIDKVKSGSFSEHSPMLYDIAKTVSTWSKVQRGLLKMYSAEV 295
           +  V +Y   N Y   I FI KVKSG FSEHSP+LYDI+ TV++W KV  GL+KMY  EV
Sbjct: 247 KKIVTEYMHKNFYCYTIDFIYKVKSGPFSEHSPILYDISTTVNSWLKVNSGLVKMYMVEV 306

Query: 296 LNKFPVVQHFWFGTGFFPWVNVKSGAILPTY--EANQEENPHFSSVTS 341
           LNKFPVVQHFWFG GF+PW NVK+  +L  Y  + NQE N   SS +S
Sbjct: 307 LNKFPVVQHFWFGEGFYPWKNVKTHKLLDVYMNDTNQENNVFNSSDSS 354

>CAGL0H06655g Chr8 complement(661713..662987) [1275 bp, 424 aa] {ON}
           similar to uniprot|P40454 Saccharomyces cerevisiae
           YIL153w RRD1
          Length = 424

 Score =  360 bits (923), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 167/314 (53%), Positives = 228/314 (72%), Gaps = 6/314 (1%)

Query: 17  FTEPVKKIFDTQGTQDFQSSVTMYRLQSYLHKYITLVGTKNIPSTSNNDAVNRFTQIIDA 76
           F+EPVK+I+D+QG   FQSS  + RL+  + KY  LV ++++     +  V    +++D 
Sbjct: 2   FSEPVKRIYDSQGAYYFQSSEAIRRLEGAIVKYTDLVESRDVADLELSGVVGGVVKVLDR 61

Query: 77  LSRTIDETPPLPGPRRFGNFACRTWHVKMRGSLDALLQAFIPEKYHV---CIVEIRYYLG 133
           L + + ETPP+PGPRR+GN ACR WH K+   +  LL+  I   +     C+VE+RYYL 
Sbjct: 62  LDQLVSETPPIPGPRRYGNMACRDWHEKIEREIPGLLEDLISSHFPSELQCVVELRYYLA 121

Query: 134 NAFGSKERLDYGTGHELSFLAVVSAIDMLDLWGSNPSGEDILFLFNGYYTLVKKLIATYT 193
           N+FGS  RLD+GTGHELSFLA V+A+DML   G++  G+ +L++F+ YY+LV +LI +YT
Sbjct: 122 NSFGSATRLDFGTGHELSFLATVAALDML---GASFDGDQVLYIFDRYYSLVHRLILSYT 178

Query: 194 LEPAGSHGVWGLDDHFHLAYILGSSQLAPISHNPLRPSDILDRHTVEDYAKTNLYFQAIA 253
           LEPAGSHGVWGLDDHFHLAYILGSSQ        + P+D+ D   VE Y++TN++ + + 
Sbjct: 179 LEPAGSHGVWGLDDHFHLAYILGSSQWCNRKKLAMEPNDLSDPVLVEQYSRTNIFCKTLN 238

Query: 254 FIDKVKSGSFSEHSPMLYDIAKTVSTWSKVQRGLLKMYSAEVLNKFPVVQHFWFGTGFFP 313
           F+  VKSG+F EHSPML+DI+++V TW+KV++GL KMY  EVLNKFPV+QHFWFGTGF+P
Sbjct: 239 FVFTVKSGAFREHSPMLFDISRSVRTWAKVRKGLWKMYKDEVLNKFPVIQHFWFGTGFYP 298

Query: 314 WVNVKSGAILPTYE 327
           WV+ K+G  LP YE
Sbjct: 299 WVDYKNGKPLPNYE 312

>KAFR0D02190 Chr4 (439664..440944) [1281 bp, 426 aa] {ON} Anc_5.709
           YIL153W
          Length = 426

 Score =  360 bits (923), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 187/352 (53%), Positives = 242/352 (68%), Gaps = 13/352 (3%)

Query: 8   PKIDVSHTKFTEPVKKIFDTQGTQDFQSSVTMYRLQSYLHKYITLVGTKNIPSTSN-NDA 66
           P +D   +KF+ P K+IFD+Q TQ FQ SV  YRL+ + +KYI LV    +P + N    
Sbjct: 8   PVVDPFASKFSIPAKRIFDSQTTQYFQHSVANYRLKYFTNKYINLVRGVPLPVSRNITMT 67

Query: 67  VNRFT-QIIDALSRTIDETPPLPGPRRFGNFACRTWHVKMR----GSLDALLQAFIPEKY 121
           + R+   ++D  S+ IDETPPL  PRRFGN +CRTWH K+     G L  ++  F   + 
Sbjct: 68  ITRYILDLLDKCSQFIDETPPLIEPRRFGNLSCRTWHDKINSYLPGELKTIIDNFSTIEN 127

Query: 122 HVCIVEIRYYLGNAFGSKERLDYGTGHELSFLAVVSAIDMLDLWGSNPSGEDILFLFNGY 181
                E+ YYL N+FGSK RLDYGTGHELSFLA +S IDM+ +   + + +D L ++  Y
Sbjct: 128 ENMFNELNYYLLNSFGSKTRLDYGTGHELSFLAFISCIDMIRML-QDMTADDFLLIWQSY 186

Query: 182 YTLVKKLIATYTLEPAGSHGVWGLDDHFHLAYILGSSQL-APISHNPLRPSDILDRHTVE 240
           Y L +KLI TYTLEPAGSHGVWGLDDHFHLAYI GSSQL + ISH  L P DIL +  V 
Sbjct: 187 YNLTRKLILTYTLEPAGSHGVWGLDDHFHLAYIFGSSQLISDISH--LAPKDILKKDVVA 244

Query: 241 DYAKTNLYFQAIAFIDKVKSGSFSEHSPMLYDIAKTVSTWSKVQRGLLKMYSAEVLNKFP 300
           ++ + NLY QAI FI  VK G F+EHSP+LYDI+K V +WSKV +GLLKMY+ EVLNKFP
Sbjct: 245 EHKENNLYCQAINFIFTVKKGPFNEHSPILYDISKNVKSWSKVLKGLLKMYNDEVLNKFP 304

Query: 301 VVQHFWFGTGFFPWVNVKSGAILPTYEANQEENPHFSSVTSISNMPTATKSV 352
           VVQHFWFG GFFPW +  SG  LP +E ++ E+P+ + +T    MP++T+++
Sbjct: 305 VVQHFWFGDGFFPWKDNNSGKDLPVFEHSEGESPNPAIMTM---MPSSTETM 353

>TBLA0E01690 Chr5 (406884..408350) [1467 bp, 488 aa] {ON} Anc_5.709
           YIL153W
          Length = 488

 Score =  361 bits (927), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 176/353 (49%), Positives = 242/353 (68%), Gaps = 23/353 (6%)

Query: 2   ISTITTPKIDVSHTKFTEPVKKIFDTQGTQDFQSSVTMYRLQSYLHKYITLVGTKNIPST 61
           + +I   K+D S+  F+ P K+IFD+QGTQ F  S+  +R+Q ++ KY  L+  +NIP T
Sbjct: 1   MESIPIYKLD-SNCVFSAPTKQIFDSQGTQYFNRSIAFHRIQYFISKYTQLIQEENIPPT 59

Query: 62  ---SNNDAVNRFTQIIDALSRTIDETPPLPGPRRFGNFACRTWHVKMRGSLDALLQAFIP 118
              S+ND ++  ++II+ L + ++ETPPLPGPRR+GN +CR WH ++  +++ L + ++ 
Sbjct: 60  DYTSSNDTISGVSKIINDLIKLVEETPPLPGPRRYGNLSCRQWHKRVDDNINELFEKYLT 119

Query: 119 ---EKYH--VCIVEIRYYLGNAFGSKERLDYGTGHELSFLAVVSAIDMLDLWGSNPSGED 173
               K++     +E+ YY   + GS  RLDYGTGHELSFLA + A+DML+L  ++ SG D
Sbjct: 120 ISNTKFNKDQLFLELIYYFNASLGSPTRLDYGTGHELSFLAFIGALDMLNLL-TDISGTD 178

Query: 174 ILFLFNGYYTLVKKLIATYTLEPAGSHGVWGLDDHFHLAYILGSSQLAPISHN------- 226
           ILF+FN YY L++KLI  YTLEPAGSHGVWGLDDHFHL YI GSSQ  P + +       
Sbjct: 179 ILFIFNEYYRLIRKLILNYTLEPAGSHGVWGLDDHFHLIYIFGSSQWCPENADMTEPSIS 238

Query: 227 ------PLRPSDILDRHTVEDYAKTNLYFQAIAFIDKVKSGSFSEHSPMLYDIAKTVSTW 280
                 P++P DIL+++ +E +  +N Y Q+I FI  VK+G F EHSP+L+DIAK V  W
Sbjct: 239 EPKFKAPIKPVDILNKNLIEKFKSSNFYCQSILFILTVKTGPFPEHSPILFDIAKNVHNW 298

Query: 281 SKVQRGLLKMYSAEVLNKFPVVQHFWFGTGFFPWVNVKSGAILPTYEANQEEN 333
            KV+ GLLKMY  EVLNKFPVVQHFWFGTGF+PW+N  +   LPTYE   ++N
Sbjct: 299 KKVRSGLLKMYMVEVLNKFPVVQHFWFGTGFYPWINSSTLMKLPTYELAPDDN 351

>KLLA0A00462g Chr1 (38766..39827) [1062 bp, 353 aa] {ON} similar to
           uniprot|P40454 Saccharomyces cerevisiae YIL153W RRD1
           Resistant to Rapamycin Deletion
          Length = 353

 Score =  347 bits (890), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 169/339 (49%), Positives = 228/339 (67%), Gaps = 6/339 (1%)

Query: 11  DVSHTKFTEPVKKIFDTQGTQDFQSSVTMYRLQSYLHKYITLVGTKNIPSTSNNDA-VNR 69
           D  + KF+ P K+IFD+QGT DFQ+SV M R+Q +L KYITL   + IP T       N 
Sbjct: 4   DYENAKFSMPEKRIFDSQGTLDFQNSVAMVRIQYHLQKYITLCKGQQIPDTIKESFFTNI 63

Query: 70  FTQIIDALSRTIDETPPLPGPRRFGNFACRTWHVKMRGSLDALLQAFIPEKYHVCIVEIR 129
             +++  LS  IDETPP     R+GN + R W  K +  L+  L   +PEKY+  I+E+ 
Sbjct: 64  VVELLKRLSALIDETPPERMHSRYGNLSYRDWQTKFQNQLENWLHELLPEKYNNSIIELS 123

Query: 130 YYLGNAFGSKERLDYGTGHELSFLAVVSAIDMLDLWGSNPSGEDILFLFNGYYTLVKKLI 189
           YY+ NAFGSKER+DYGTGHELSFLAV+  +DML +      G  +L+ FN YY +++KLI
Sbjct: 124 YYISNAFGSKERIDYGTGHELSFLAVIICLDMLKI--ETIKGPALLYCFNSYYDVIQKLI 181

Query: 190 ATYTLEPAGSHGVWGLDDHFHLAYILGSSQLAPISHNPLRPSDILDRHTVEDYAKTNLYF 249
            TY LEPAGSHGVWGLDDHFH +YILG++QL  ++   L P DI +   +E  + +NL+ 
Sbjct: 182 LTYKLEPAGSHGVWGLDDHFHFSYILGATQLLDVN-TSLIPKDISNTRLMEQNSSSNLFC 240

Query: 250 QAIAFIDKVKSGSFSEHSPMLYDIAKTVSTWSKVQRGLLKMYSAEVLNKFPVVQHFWFGT 309
           ++I FI+ VKSG FS HSP+LY+I+++V TW K+Q+GL+KMY  EVLNKFPVVQHFWFGT
Sbjct: 241 KSIRFINVVKSGPFSNHSPLLYNISRSVHTWHKMQQGLIKMYKVEVLNKFPVVQHFWFGT 300

Query: 310 GFFPWVNVKSGAILPTYE--ANQEENPHFSSVTSISNMP 346
            FFPW +  +   LP Y+   N ++    ++  + + MP
Sbjct: 301 AFFPWTSYGNNHSLPIYQPAENNDDADFLTANNATTKMP 339

>KNAG0L02170 Chr12 complement(388956..390146) [1191 bp, 396 aa] {ON}
           Anc_5.709 YIL153W
          Length = 396

 Score =  323 bits (829), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 167/328 (50%), Positives = 214/328 (65%), Gaps = 15/328 (4%)

Query: 10  IDVSHTKFTEPVKKIFDTQGTQDFQSSVTMYRLQSYLHKYITLVGTKNIPSTSNNDAVNR 69
           +DV H  F +P K+IFD+Q T  FQ SV + R++ ++ KY+ ++  +   S   + +V R
Sbjct: 16  LDVEHAVFRQPQKRIFDSQTTATFQESVALARIRFHIEKYMRMM--RGDTSGGISASVAR 73

Query: 70  FTQIIDALSRTIDETPPLPGPRRFGNFACRTWHVKMRGSLDALLQAFIPEKYHVCIVEIR 129
             QI+D L   +DETPPL GPRR+GN ACR WH K+  SL  L             +E  
Sbjct: 74  MLQILDRLDALVDETPPLVGPRRYGNLACRDWHDKVDSSLPGLTSQVDCLAGGGACIEAE 133

Query: 130 YYLGNAFGSKERLDYGTGHELSFLAVVSAIDMLDLWGSNPSG---EDILFLFNGYYTLVK 186
           YYL N+FGSK RLDYGTGHELSFLA V+A+DM+    S P G    ++  L++ YY LV+
Sbjct: 134 YYLRNSFGSKIRLDYGTGHELSFLAFVAALDMM----SQPRGITPVELSRLWDRYYRLVR 189

Query: 187 KLIATYTLEPAGSHGVWGLDDHFHLAYILGSSQLAPISHNPL--RPSDILDRHTV-EDYA 243
           +LI  Y LEPAGSHGVWGLDDHFHLAY+ G+SQ A   +NP+  +P D+L       D A
Sbjct: 190 RLIVDYNLEPAGSHGVWGLDDHFHLAYLWGASQFA---NNPVGVQPRDVLSGVIPGRDDA 246

Query: 244 KTNLYFQAIAFIDKVKSGSFSEHSPMLYDIAKTVSTWSKVQRGLLKMYSAEVLNKFPVVQ 303
             N   +AI F+  VK G F E+SPML DI   VS+W K+QRGL +MY+AEVLNKFPVVQ
Sbjct: 247 PANFLVEAIGFVKSVKHGPFWENSPMLNDILSGVSSWRKIQRGLFRMYNAEVLNKFPVVQ 306

Query: 304 HFWFGTGFFPWVNVKSGAILPTYEANQE 331
           HFWFGT FFPW +V+ G  LP YE + +
Sbjct: 307 HFWFGTAFFPWTSVRDGTPLPVYEQSAD 334

>NDAI0E02410 Chr5 complement(500623..501702) [1080 bp, 359 aa] {ON}
           Anc_8.674
          Length = 359

 Score =  176 bits (446), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 106/294 (36%), Positives = 167/294 (56%), Gaps = 9/294 (3%)

Query: 20  PVKKIFDTQGTQDFQSSVTMYRLQSYLHKYITLV-GTKNIP-STSNNDAVNRFTQIIDAL 77
           P K++      + +++S T   L  ++      V G +N   S   + A+N   QI+ ++
Sbjct: 3   PEKRLLTEDDMKLWEASSTKKELLDFISTLAEAVKGCENSQISEPISPAINTLEQILVSI 62

Query: 78  SRTIDETPPLPGPR--RFGNFACRTWHVKMRGSLDALLQAFIPEKYHVCIVEIRYYLGNA 135
            + ID+ P L      RFG    R ++ ++    + L+    P   H  + ++  YL  +
Sbjct: 63  DKIIDKHPVLEDKEISRFGKKEFRGFYDEINEVSEKLIHENFPSLTHEQLEQLTIYLDES 122

Query: 136 FGSKERLDYGTGHELSFLAVVSAIDMLDLWGSNPSGED-ILFLFNGYYTLVKKLIATYTL 194
           +G+K+R+DYG+GHEL+F+  +  +   D+   +    + +L +F  Y  +++ L   Y L
Sbjct: 123 WGNKQRIDYGSGHELNFMCFLFGLYKYDVLKLDIDARNMVLIIFIKYLDIMRSLETKYWL 182

Query: 195 EPAGSHGVWGLDDHFHLAYILGSSQLAPISHNPLRPSDILDRHTVEDYAKTNLYFQAIAF 254
           EPAGSHGVWGLDD+  L ++ G+ QLA  +H  L+P  I +   VE +AK  LYF  IAF
Sbjct: 183 EPAGSHGVWGLDDYHFLPFLFGAYQLA--THKHLKPLSIHNEELVEMFAKKYLYFGCIAF 240

Query: 255 IDKVKS-GSFSEHSPMLYDIAKTVSTWSKVQRGLLKMYSAEVLNKFPVVQHFWF 307
           I+ VK+  S   HSPML DI+  V  WSKV  G++KMY+AEVL+K P++QHF+F
Sbjct: 241 INSVKTTASLRWHSPMLDDIS-GVKRWSKVAEGMVKMYNAEVLSKLPIMQHFYF 293

>Ecym_2399 Chr2 (778448..779503) [1056 bp, 351 aa] {ON} similar to
           Ashbya gossypii ACR139C
          Length = 351

 Score =  169 bits (428), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 92/250 (36%), Positives = 145/250 (58%), Gaps = 7/250 (2%)

Query: 67  VNRFTQIIDALSRTIDETPPL--PGPRRFGNFACRTWHVKMRGSLDALLQAFIPEKYHVC 124
           +     ++D +++ +D+ P +   G  RFG    R ++ ++R +   L+ +   E     
Sbjct: 52  IENLCALLDTVAKIVDKHPVVQDKGTSRFGKVEFRDFYDEVRETTKELISSLSSELTDEQ 111

Query: 125 IVEIRYYLGNAFGSKERLDYGTGHELSFLAVVSAIDMLDLWGSNPSGEDILFLFNGYYTL 184
           + E+  Y   ++G ++R+DYG+GHEL+F+  +  +    +         +L +F  Y  +
Sbjct: 112 VEELAVYFTESWGDRKRIDYGSGHELNFICFLYGLTHYSVLSDADKVNLVLKVFIKYLDV 171

Query: 185 VKKLIATYTLEPAGSHGVWGLDDHFHLAYILGSSQLAPISHNPLRPSDILDRHTVEDYAK 244
           ++ L   Y LEPAGSHGVWGLDD+  L ++ G+ QL   +H  L+P  I +   VE + K
Sbjct: 172 MRLLETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQLT--THKHLKPKSIHNPEIVEVFEK 229

Query: 245 TNLYFQAIAFIDKVK-SGSFSEHSPMLYDIAKTVSTWSKVQRGLLKMYSAEVLNKFPVVQ 303
             +YF+ +AFI+KVK + S   HSPML DI+  V TWSKV  G++KMY AEVL K P++Q
Sbjct: 230 RYMYFECVAFINKVKTTASLRWHSPMLDDIS-GVRTWSKVAEGMVKMYKAEVLGKLPIMQ 288

Query: 304 HFWFGTGFFP 313
           HF+F T F P
Sbjct: 289 HFFFST-FLP 297

>CAGL0M02255g Chr13 (270614..271690) [1077 bp, 358 aa] {ON} highly
           similar to uniprot|Q12461 Saccharomyces cerevisiae
           YPL152w RRD2
          Length = 358

 Score =  168 bits (426), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 105/294 (35%), Positives = 159/294 (54%), Gaps = 9/294 (3%)

Query: 20  PVKKIFDTQGTQDFQSSVTMYRLQSYLHKYITLV-GTKNIP-STSNNDAVNRFTQIIDAL 77
           P K+I   +  + ++ S T   + S++      V G +N   S   +D+V     ++  +
Sbjct: 3   PSKRILTDKDVKIWEESETREDILSFIESLAKAVEGFENDQVSEPVSDSVQSTIAVLTEI 62

Query: 78  SRTIDETPPLPGPR--RFGNFACRTWHVKMRGSLDALLQAFIPEKYHVCIVEIRYYLGNA 135
            + I   P +      RFG    R ++  +    D LL +  P      I ++  YL  +
Sbjct: 63  DKLIKLHPVIQDKNTSRFGKVEFRDFYDDVCEKADDLLSSHFPALTSEQIEQLSIYLQES 122

Query: 136 FGSKERLDYGTGHELSFLAVVSAIDMLDLWGSNPSGED-ILFLFNGYYTLVKKLIATYTL 194
           +G+K R+DYG+GHEL+F+  +  +    ++       + +L LF  Y  +++++   Y L
Sbjct: 123 WGNKRRIDYGSGHELNFICFLYGLTHYKIFDLQRDARNLVLVLFIEYLKIMREIETLYWL 182

Query: 195 EPAGSHGVWGLDDHFHLAYILGSSQLAPISHNPLRPSDILDRHTVEDYAKTNLYFQAIAF 254
           EPAGSHGVWGLDD+  L ++ G+ QLAP  H  L+P  I +   VE +A   LYF  IAF
Sbjct: 183 EPAGSHGVWGLDDYHFLPFLFGAFQLAP--HKHLKPKSIHNEELVEMFADKYLYFGCIAF 240

Query: 255 IDKVK-SGSFSEHSPMLYDIAKTVSTWSKVQRGLLKMYSAEVLNKFPVVQHFWF 307
           I+ VK S S   HSPML DI+  V  WSKV  G++KMY AEVL K P++QHF+F
Sbjct: 241 INSVKTSTSLRWHSPMLDDIS-GVKKWSKVAEGMIKMYKAEVLGKLPIMQHFYF 293

>ZYRO0F07326g Chr6 complement(592906..593964) [1059 bp, 352 aa] {ON}
           highly similar to uniprot|Q12461 Saccharomyces
           cerevisiae YPL152W
          Length = 352

 Score =  164 bits (416), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 93/242 (38%), Positives = 141/242 (58%), Gaps = 7/242 (2%)

Query: 72  QIIDALSRTIDETPPLPGPR--RFGNFACRTWHVKMRGSLDALLQAFIPEKYHVCIVEIR 129
           Q++  ++  ID+ P +      RFG    R ++  ++   + L+    P      + E+ 
Sbjct: 57  QLLKKVNDLIDKYPVIQDANTSRFGKVEFRDFYDDLQTHAEELVATTYPSLNKDQVEELA 116

Query: 130 YYLGNAFGSKERLDYGTGHELSFLAVVSAIDMLDLWGSNPSGED-ILFLFNGYYTLVKKL 188
            YL  ++G+K R+DYG+GHEL+F+  +  + +  ++       D +L +F  Y  +++ L
Sbjct: 117 VYLYESWGNKRRIDYGSGHELNFVCFIYGLYVYKVFDLERDAADLVLKVFVEYLRIMRIL 176

Query: 189 IATYTLEPAGSHGVWGLDDHFHLAYILGSSQLAPISHNPLRPSDILDRHTVEDYAKTNLY 248
              Y LEPAGSHGVWGLDD+  L ++ G+ QLA  +H  LRP  I +   VE +    +Y
Sbjct: 177 ETKYWLEPAGSHGVWGLDDYHFLPFLFGAHQLA--THPHLRPKSIHNEEVVEMFMDKYIY 234

Query: 249 FQAIAFIDKVKS-GSFSEHSPMLYDIAKTVSTWSKVQRGLLKMYSAEVLNKFPVVQHFWF 307
           F  IAFI+ VKS  S   HSPML DI+  V TW+KV  G++KMY AEVL+K P++QHF+F
Sbjct: 235 FGCIAFINSVKSTASLRWHSPMLDDIS-GVKTWAKVAEGMIKMYKAEVLSKLPIMQHFYF 293

Query: 308 GT 309
           G 
Sbjct: 294 GN 295

>Smik_6.349 Chr6 complement(558150..559226) [1077 bp, 358 aa] {ON}
           YPL152W (REAL)
          Length = 358

 Score =  164 bits (415), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 98/254 (38%), Positives = 148/254 (58%), Gaps = 8/254 (3%)

Query: 64  NDAVNRFTQIIDALSRTIDETPPLPGPR--RFGNFACRTWHVKMRGSLDALLQAFIPEKY 121
           ++ ++R   ++  +   I + P +      RFG    R ++ ++  S    L++  P   
Sbjct: 49  SEPISRMMNLLSYIRDIIQKHPVVKDANSSRFGKIEFRDFYDEVSQSSRKFLRSEFPSLT 108

Query: 122 HVCIVEIRYYLGNAFGSKERLDYGTGHELSFLAVVSAIDMLDLWG-SNPSGEDILFLFNG 180
              + ++  YL  ++G+K R+DYG+GHEL+F+ ++  +    ++  SN S   IL +F  
Sbjct: 109 DEQLEQLSIYLDESWGNKRRIDYGSGHELNFMCLLYGLYKYGVFNLSNDSTNLILKVFIE 168

Query: 181 YYTLVKKLIATYTLEPAGSHGVWGLDDHFHLAYILGSSQLAPISHNPLRPSDILDRHTVE 240
           Y  +++ L   Y LEPAGSHGVWGLDD+  L ++ G+ QL   SH  L+P  I +   VE
Sbjct: 169 YLKIMRILETRYWLEPAGSHGVWGLDDYHFLPFLFGAFQLT--SHKHLKPISIHNNELVE 226

Query: 241 DYAKTNLYFQAIAFIDKVKS-GSFSEHSPMLYDIAKTVSTWSKVQRGLLKMYSAEVLNKF 299
            +A   LYF  I FI+KVKS  S   HSPML DI+  V TWSKV  G++KMY AEVL+K 
Sbjct: 227 MFANRYLYFGCIDFINKVKSSASLRWHSPMLDDIS-GVKTWSKVAEGMIKMYEAEVLSKL 285

Query: 300 PVVQHFWFGTGFFP 313
           P++QHF+F + F P
Sbjct: 286 PIMQHFYF-SDFLP 298

>YPL152W Chr16 (265028..266104) [1077 bp, 358 aa] {ON}
           RRD2Activator of the phosphotyrosyl phosphatase activity
           of PP2A,peptidyl-prolyl cis/trans-isomerase; regulates
           G1 phase progression, the osmoresponse, microtubule
           dynamics; subunit of the Tap42p-Pph21p-Rrd2p complex
          Length = 358

 Score =  164 bits (415), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 102/259 (39%), Positives = 151/259 (58%), Gaps = 14/259 (5%)

Query: 60  STSNNDAVNRFTQIIDALSRTIDETPPL---PGPRRFGNFACRTWHVKMRGSLDALLQAF 116
           S S N  +N  +QI D     I +  P+       RFG    R ++ ++  +   +L++ 
Sbjct: 49  SESINSMMNLLSQIKD-----ITQKHPVIKDADSSRFGKVEFRDFYDEVSRNSRKILRSE 103

Query: 117 IPEKYHVCIVEIRYYLGNAFGSKERLDYGTGHELSFLAVVSAIDMLDLWG-SNPSGEDIL 175
            P      + ++  YL  ++G+K R+DYG+GHEL+F+ ++  +    ++  SN S   +L
Sbjct: 104 FPSLTDEQLEQLSIYLDESWGNKRRIDYGSGHELNFMCLLYGLYSYGIFNLSNDSTNLVL 163

Query: 176 FLFNGYYTLVKKLIATYTLEPAGSHGVWGLDDHFHLAYILGSSQLAPISHNPLRPSDILD 235
            +F  Y  +++ L   Y LEPAGSHGVWGLDD+  L ++ G+ QL   +H  L+P  I +
Sbjct: 164 KVFIEYLKIMRILETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQLT--THKHLKPISIHN 221

Query: 236 RHTVEDYAKTNLYFQAIAFIDKVKS-GSFSEHSPMLYDIAKTVSTWSKVQRGLLKMYSAE 294
              VE +A   LYF  IAFI+KVKS  S   HSPML DI+  V TWSKV  G++KMY AE
Sbjct: 222 NELVEMFAHRYLYFGCIAFINKVKSSASLRWHSPMLDDIS-GVKTWSKVAEGMIKMYKAE 280

Query: 295 VLNKFPVVQHFWFGTGFFP 313
           VL+K P++QHF+F + F P
Sbjct: 281 VLSKLPIMQHFYF-SEFLP 298

>ACR139C Chr3 complement(592864..593943) [1080 bp, 359 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL152W
           (RRD2)
          Length = 359

 Score =  164 bits (414), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 96/269 (35%), Positives = 148/269 (55%), Gaps = 14/269 (5%)

Query: 55  TKNIPSTSNNDAVNRFTQIIDALSRTIDETPPLPG---------PRRFGNFACRTWHVKM 105
            +++    N++     +  I+AL   ++E   +             RFG    R +H ++
Sbjct: 41  AQSVRGRENSEHAEPVSPAIEALEALLEEMQGIAAHHPVLQDAATSRFGKVEFRDFHKEV 100

Query: 106 RGSLDALLQAFIPEKYHVCIVEIRYYLGNAFGSKERLDYGTGHELSFLAVVSAIDMLDLW 165
           +   +AL+    P        E+  YLGNA+G  +R+DYG+GHEL+F+  +  +    + 
Sbjct: 101 QARAEALVLQVDPSLTDEQAQELAVYLGNAWGDCKRIDYGSGHELNFVCFLYGLWKYGVL 160

Query: 166 GSNPSGEDILFLFNGYYTLVKKLIATYTLEPAGSHGVWGLDDHFHLAYILGSSQLAPISH 225
             +     +L +F  Y  +++ L   Y LEPAGSHGVWGLDD+  L ++ G+ QLA  +H
Sbjct: 161 SEHDFTNAVLRVFVKYMDVMRVLETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQLA--TH 218

Query: 226 NPLRPSDILDRHTVEDYAKTNLYFQAIAFIDKVK-SGSFSEHSPMLYDIAKTVSTWSKVQ 284
             L+P  I +   VE +    LYF  IAFI++VK + S   HSPML DI+  V +W+KV 
Sbjct: 219 KHLKPKSIHNPEVVELFENRYLYFGCIAFINRVKTTASLRWHSPMLDDIS-GVRSWTKVS 277

Query: 285 RGLLKMYSAEVLNKFPVVQHFWFGTGFFP 313
            G++KMY AEVL K P++QHF+F + F P
Sbjct: 278 EGMVKMYKAEVLGKLPIMQHFFF-SRFLP 305

>Kpol_1013.4 s1013 complement(5948..7024) [1077 bp, 358 aa] {ON}
           complement(5948..7024) [1077 nt, 359 aa]
          Length = 358

 Score =  162 bits (411), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 99/300 (33%), Positives = 162/300 (54%), Gaps = 19/300 (6%)

Query: 20  PVKKIFDTQGTQDFQSSVTMYRLQSYLHKYITLVGTKNIPSTSNND-------AVNRFTQ 72
           P K++   +  + +  S T + L  ++ K       K++    N          +  F  
Sbjct: 3   PEKRLLTPEDLELWDKSQTKHDLLEFIEKL-----AKSVEGHENKQYQEPITPQIESFMG 57

Query: 73  IIDALSRTIDETPPLPGPR--RFGNFACRTWHVKMRGSLDALLQAFIPEKYHVCIVEIRY 130
           ++ +++  ID+ P +   +  RFG    R ++ ++      L+    P      + ++  
Sbjct: 58  LLKSVNNIIDKHPVVQDAKSSRFGKIEFRDFYDELTSQSKTLISNAYPSLTEDQLDQLYV 117

Query: 131 YLGNAFGSKERLDYGTGHELSFLAVVSAIDMLDLWGSNPSGED-ILFLFNGYYTLVKKLI 189
           YL  ++G+K+R+DYG+GHEL+FL ++  +    ++  +    + +L +F  Y  +++ L 
Sbjct: 118 YLDESWGNKQRIDYGSGHELNFLCLLYGLHKYKIFDESKDFTNMVLKIFIEYLRVMRILE 177

Query: 190 ATYTLEPAGSHGVWGLDDHFHLAYILGSSQLAPISHNPLRPSDILDRHTVEDYAKTNLYF 249
             Y LEPAGSHGVWGLDD+  L ++ G+ QLA  +H  L+P  I +   VE +    LYF
Sbjct: 178 TKYWLEPAGSHGVWGLDDYHFLPFLFGAFQLA--THKHLKPLSIHNEELVEMFQDKYLYF 235

Query: 250 QAIAFIDKVK-SGSFSEHSPMLYDIAKTVSTWSKVQRGLLKMYSAEVLNKFPVVQHFWFG 308
             +AFI+ VK S S   HSPML DI+  V  WSKV  G++KMY AEVL+K P++QHF+FG
Sbjct: 236 SCVAFINSVKTSTSLRFHSPMLDDIS-GVKKWSKVAEGMIKMYRAEVLSKLPIMQHFYFG 294

>Kwal_26.8783 s26 complement(941317..942384) [1068 bp, 355 aa] {ON}
           YPL152W (RRD2) - similar to hosphotyrosyl phosphatase
           activator (PTPA) from several organisms [contig 67] FULL
          Length = 355

 Score =  162 bits (411), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 106/330 (32%), Positives = 165/330 (50%), Gaps = 23/330 (6%)

Query: 19  EPVKKIFDTQGTQDFQSSVTMYRLQSYLHKYITLVGTKNIPSTSNNDAVNRFTQIIDALS 78
           +P K++  +Q  + +    T  +L  ++ +       +++    NN         ID   
Sbjct: 2   KPQKRLLTSQDIETWVDCATFDQLIEFISEL-----AESVKGLENNQYQEPIGASIDKCC 56

Query: 79  RTIDETPPLPGPR---------RFGNFACRTWHVKMRGSLDALLQAFIPEKYHVCIVEIR 129
             +DE   +             RFG    R ++  +R     L+     +       E+ 
Sbjct: 57  SLLDEVFSIAKQHPVKEDAETSRFGKIEFRHFYDDLRIKAQDLISKEFDQLSQDQAEELV 116

Query: 130 YYLGNAFGSKERLDYGTGHELSFLAVVSAIDMLDLWGSNPSGED-ILFLFNGYYTLVKKL 188
            Y   ++G +ER+DYG+GHEL+F+  +  +    L+  +    + +L +F  Y  L++ L
Sbjct: 117 AYFVESWGDRERIDYGSGHELNFICFLYGLKDCGLFERSRDYRNLVLKVFIHYLELMRVL 176

Query: 189 IATYTLEPAGSHGVWGLDDHFHLAYILGSSQLAPISHNPLRPSDILDRHTVEDYAKTNLY 248
             TY LEPAGSHGVWGLDD+  L ++ G+SQLAP  H  L+P  I +   V+ +A   LY
Sbjct: 177 ETTYWLEPAGSHGVWGLDDYHFLPFLFGASQLAP--HKHLKPKSIHNNELVDMFASRYLY 234

Query: 249 FQAIAFIDKVKS-GSFSEHSPMLYDIAKTVSTWSKVQRGLLKMYSAEVLNKFPVVQHFWF 307
           F  I FI++VK+  S   HSPML DI+   S WSKV  G++KMY  EVL K P++QHF F
Sbjct: 235 FGCIDFINRVKTTASLRWHSPMLDDISGAKS-WSKVAEGMIKMYRKEVLAKLPIMQHFLF 293

Query: 308 GTGFFPWVNVKSGAILPTYEANQEENPHFS 337
           G+    ++    G   P   A+ +E+ H S
Sbjct: 294 GS----FLKCPEGVSPPGAHADDKEHQHCS 319

>TDEL0A06200 Chr1 complement(1085066..1086133) [1068 bp, 355 aa]
           {ON} Anc_8.674 YPL152W
          Length = 355

 Score =  162 bits (410), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 104/303 (34%), Positives = 162/303 (53%), Gaps = 17/303 (5%)

Query: 20  PVKKIFDTQGTQDFQSSVTMYRLQSYLHKYITLVGTKNIPSTSNNDAVNRFTQIIDALSR 79
           P K++      Q +Q+  T   L  +L +    V  K + ++  +  +    Q ++AL  
Sbjct: 4   PEKRLLTKDDMQLWQNCQTKSDLLKFLCELADAV--KGLENSQYSQPIGGSIQSVEALIE 61

Query: 80  TID---ETPPLP--GPRRFGNFACRTWHVKMRGSLDALLQAFIPEKYHVCIVEIRYYLGN 134
            +D   E  P+   GP RFG    R  +  + G    L++          + ++  Y   
Sbjct: 62  CVDQCIENHPVESTGPSRFGKGEFRDLYDDISGRSSVLIKEKFGSLTDEQVAQLSVYFNE 121

Query: 135 AFGSKERLDYGTGHELSFLAVVSAI---DMLDLWGSNPSGEDILFLFNGYYTLVKKLIAT 191
           ++G K R+DYG+GHEL+FL  +  +    + DL   N +   +L +F  Y   ++ +   
Sbjct: 122 SWGDKSRIDYGSGHELNFLCFLYGLYRCGVFDLAKDNRNL--VLIVFMKYLKTMRVIETV 179

Query: 192 YTLEPAGSHGVWGLDDHFHLAYILGSSQLAPISHNPLRPSDILDRHTVEDYAKTNLYFQA 251
           Y LEPAGSHGVWGLDD+  L ++ G+SQL+  +H  L+P  I +   VE +++  LYF  
Sbjct: 180 YWLEPAGSHGVWGLDDYHFLPFLFGASQLS--THRHLKPKSIHNPEVVEMFSEKYLYFGC 237

Query: 252 IAFIDKVKS-GSFSEHSPMLYDIAKTVSTWSKVQRGLLKMYSAEVLNKFPVVQHFWFGTG 310
           I FI+ VK+  S   HSPML DI+  V  W+KV +G++KMY AEVL K P++QHF+F + 
Sbjct: 238 IDFINSVKTTASLRWHSPMLDDIS-GVKEWAKVYQGMVKMYDAEVLCKLPIMQHFYF-SE 295

Query: 311 FFP 313
           F P
Sbjct: 296 FLP 298

>Suva_16.158 Chr16 (274228..275304) [1077 bp, 358 aa] {ON} YPL152W
           (REAL)
          Length = 358

 Score =  161 bits (408), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 105/276 (38%), Positives = 156/276 (56%), Gaps = 14/276 (5%)

Query: 68  NRFTQIIDALSRTIDETPPLP-----GPRRFGNFACRTWHVKMRGSLDALLQAFIPEKYH 122
            + T+++  LSR  D     P        RFG    R ++ ++  +   LL++       
Sbjct: 50  EQITRMLSLLSRVRDIIEKHPVVHDVDSSRFGKVEFRDFYDEVSQNSRKLLKSEFSLLTD 109

Query: 123 VCIVEIRYYLGNAFGSKERLDYGTGHELSFLAVVSAIDMLDLWG-SNPSGEDILFLFNGY 181
             + ++  YL  ++G+K R+DYG+GHEL+F+ ++  +    ++  SN S   IL +F  Y
Sbjct: 110 EQLEQLSIYLDESWGNKRRIDYGSGHELNFMCLLYGLYNYGVFNLSNDSTNLILKVFIEY 169

Query: 182 YTLVKKLIATYTLEPAGSHGVWGLDDHFHLAYILGSSQLAPISHNPLRPSDILDRHTVED 241
             +++ L   Y LEPAGSHGVWGLDD+  L ++ G+ QL   +H  L+P  I +   VE 
Sbjct: 170 LDIMRVLETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQLT--THKHLKPISIHNSELVEM 227

Query: 242 YAKTNLYFQAIAFIDKVKS-GSFSEHSPMLYDIAKTVSTWSKVQRGLLKMYSAEVLNKFP 300
           ++   LYF  IAFI+KVKS  S   HSPML DI+  V TWSKV  G++KMY AEVL+K P
Sbjct: 228 FSDRYLYFGCIAFINKVKSSASLRWHSPMLDDIS-GVKTWSKVAEGMIKMYEAEVLSKLP 286

Query: 301 VVQHFWFGTGFFPW---VNVKSGAILPTYEANQEEN 333
           ++QHF+F + F P    V+   G I    +A+ E N
Sbjct: 287 IMQHFYF-SEFLPCPEGVSQPRGHIHDGTDADDECN 321

>KLTH0D11176g Chr4 complement(913077..914138) [1062 bp, 353 aa] {ON}
           similar to uniprot|Q12461 Saccharomyces cerevisiae
           YPL152W RRD2 Resistant to Rapamycin
          Length = 353

 Score =  161 bits (407), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 99/302 (32%), Positives = 157/302 (51%), Gaps = 19/302 (6%)

Query: 19  EPVKKIFDTQGTQDFQSSVTMYRLQSYLHKYITLVGTKNIPSTSNND-------AVNRFT 71
           +P K++        +  S T   L S+L         +++    NN+       ++    
Sbjct: 2   KPQKRLLTQDDMDIWSHSETFNNLISFLSGL-----AESVKGLENNEYQKPTGSSIESCC 56

Query: 72  QIIDALSRTIDETPPLPGPR--RFGNFACRTWHVKMRGSLDALLQAFIPEKYHVCIVEIR 129
           Q+++ ++   ++ P        RFG    R ++  ++     L+Q            E+ 
Sbjct: 57  QLLEEVASLAEQYPVKQDAETSRFGKVEFRYFYDDLKSKSQGLIQRAFDALDGTQCEELS 116

Query: 130 YYLGNAFGSKERLDYGTGHELSFLAVVSAIDMLDLWGSNPSGED-ILFLFNGYYTLVKKL 188
            Y   ++G + R+DYG+GHEL+FL  +  +    ++       + +L LF  Y  +++ L
Sbjct: 117 VYFAESWGDRSRIDYGSGHELNFLCFLYGLKEFGVFKEPADYRNMVLKLFIKYLGVMRTL 176

Query: 189 IATYTLEPAGSHGVWGLDDHFHLAYILGSSQLAPISHNPLRPSDILDRHTVEDYAKTNLY 248
              Y LEPAGSHGVWGLDD+  L ++ G+ QL+  +H  L+P  I +   VE + K  LY
Sbjct: 177 ETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQLS--THKHLKPKSIHNSEVVEMFGKRYLY 234

Query: 249 FQAIAFIDKVKS-GSFSEHSPMLYDIAKTVSTWSKVQRGLLKMYSAEVLNKFPVVQHFWF 307
           F  I FI+KVK+  S   HSPML DI+  V TW+KV  G++KMY AEVLNK P++QHF+F
Sbjct: 235 FGCIDFINKVKTTASLRWHSPMLDDIS-GVKTWAKVAEGMIKMYKAEVLNKLPIMQHFFF 293

Query: 308 GT 309
           G+
Sbjct: 294 GS 295

>KNAG0J01690 Chr10 complement(308576..309667) [1092 bp, 363 aa] {ON}
           Anc_8.674 YPL152W
          Length = 363

 Score =  160 bits (406), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 103/301 (34%), Positives = 167/301 (55%), Gaps = 21/301 (6%)

Query: 20  PVKKIFDTQGTQDFQSSVTMYRLQSYLHKYITLV-GTKN----IPSTSNNDAVNRFTQII 74
           P K++   +    ++SS T   L  ++ +    V G +N    +P +++ +A+    Q +
Sbjct: 6   PCKRLLMKRDLDLWESSETRAHLVHFIEQLADAVRGRENEQYDLPISASVEALMGLLQQV 65

Query: 75  DALSRTIDETPPLPG----PRRFGNFACRTWHVKMRGSLDALLQAFIPEKYHVCIVEIRY 130
               R + E  P+        RFG    R ++ ++R    +L+    P+     + +++ 
Sbjct: 66  ----RGVIERHPVAKKDAPASRFGKVEFRDFYDELRAESASLITGAFPQLTQNQVRQLQT 121

Query: 131 YLGNAFGSKERLDYGTGHELSFLAVV---SAIDMLDLWGSNPSGEDILFLFNGYYTLVKK 187
           YL  ++G K R+DYG+GHEL+F+  +   +A  + DL G++ +   +L  F  Y  +++ 
Sbjct: 122 YLEESWGDKRRIDYGSGHELNFMCFLYGLTAYKVFDLGGTDRANL-VLKPFIEYLKIMRV 180

Query: 188 LIATYTLEPAGSHGVWGLDDHFHLAYILGSSQLAPISHNPLRPSDILDRHTVEDYAKTNL 247
           L   Y LEPAGSHGVWGLDD+  L ++ G+ QL+  +H  L+P  I +   VE +A   L
Sbjct: 181 LETEYWLEPAGSHGVWGLDDYHFLPFLFGAFQLS--THKHLKPLSIHNEEVVELFADKYL 238

Query: 248 YFQAIAFIDKVKS-GSFSEHSPMLYDIAKTVSTWSKVQRGLLKMYSAEVLNKFPVVQHFW 306
           YF  I FI+ VK+  +   HSPML DI+  V  WSKV  G++KMY AEVL+K P++QHF+
Sbjct: 239 YFGCIHFINSVKTTATLRWHSPMLDDIS-GVKKWSKVAEGMVKMYQAEVLSKLPIMQHFY 297

Query: 307 F 307
           F
Sbjct: 298 F 298

>Skud_16.130 Chr16 (236660..237736) [1077 bp, 358 aa] {ON} YPL152W
           (REAL)
          Length = 358

 Score =  160 bits (405), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 93/224 (41%), Positives = 136/224 (60%), Gaps = 6/224 (2%)

Query: 92  RFGNFACRTWHVKMRGSLDALLQAFIPEKYHVCIVEIRYYLGNAFGSKERLDYGTGHELS 151
           RFG    R ++ ++  +   LL++  P      + ++  YL  ++G+K R+DYG+GHEL+
Sbjct: 79  RFGKVEFRDFYDEVSQNSRKLLRSEFPHLTDEQLEQLSIYLDESWGNKRRIDYGSGHELN 138

Query: 152 FLAVVSAIDMLDLWG-SNPSGEDILFLFNGYYTLVKKLIATYTLEPAGSHGVWGLDDHFH 210
           F+ ++  +    ++  S+ S   IL +F  Y  +++ L   Y LEPAGSHGVWGLDD+  
Sbjct: 139 FMCLLYGLYNYGIFNLSDDSTNLILKVFIEYLQIMRILETKYWLEPAGSHGVWGLDDYHF 198

Query: 211 LAYILGSSQLAPISHNPLRPSDILDRHTVEDYAKTNLYFQAIAFIDKVKS-GSFSEHSPM 269
           L ++ G+ QL   +H  L+P  I +   VE +A   LYF  IAFI+KVKS  S   HSPM
Sbjct: 199 LPFLFGAFQLT--THKHLKPISIHNNELVEMFAHRYLYFGCIAFINKVKSSASLRWHSPM 256

Query: 270 LYDIAKTVSTWSKVQRGLLKMYSAEVLNKFPVVQHFWFGTGFFP 313
           L DI+  V TWSKV  G++KMY  EVL+K P++QHF+F   F P
Sbjct: 257 LDDIS-GVKTWSKVAEGMIKMYKVEVLSKLPIMQHFYF-CEFLP 298

>KAFR0H02440 Chr8 (467656..468717) [1062 bp, 353 aa] {ON} Anc_8.674
           YPL152W
          Length = 353

 Score =  159 bits (401), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 91/238 (38%), Positives = 140/238 (58%), Gaps = 6/238 (2%)

Query: 73  IIDALSRTIDETPPLPGP-RRFGNFACRTWHVKMRGSLDALLQAFIPEKYHVCIVEIRYY 131
           ++D++   +DE P L     RFG    R+++  ++ +   LL           I ++  Y
Sbjct: 60  LLDSVLSVVDEHPVLNDTTSRFGKTEFRSFYQDVKSNCHNLLSKAFDTLTTNQIEQLSIY 119

Query: 132 LGNAFGSKERLDYGTGHELSFLAVVSAIDMLDLWGSNPSGEDILFL-FNGYYTLVKKLIA 190
              ++G++ER+DYG+GHEL+F+  +  +   D++       +I+ L F  Y  ++++L  
Sbjct: 120 FYESWGNEERIDYGSGHELNFICFLYGLYKYDVFRLERDSTNIVILVFVKYLKIMRRLET 179

Query: 191 TYTLEPAGSHGVWGLDDHFHLAYILGSSQLAPISHNPLRPSDILDRHTVEDYAKTNLYFQ 250
            Y LEPAGSHGVWGLDD+  L ++ G+ QL+  +H  L+P  I +   V+ +    LYF 
Sbjct: 180 LYWLEPAGSHGVWGLDDYHFLPFLFGAFQLS--NHKHLKPKSIHNDEIVDMFKDKYLYFG 237

Query: 251 AIAFIDKVKS-GSFSEHSPMLYDIAKTVSTWSKVQRGLLKMYSAEVLNKFPVVQHFWF 307
            IAFI+ VK+  S   HSPML DI+  V  WSKV  G++KMY AEVL+K PV+QHF+F
Sbjct: 238 CIAFINSVKTTASLRWHSPMLDDIS-GVKKWSKVSEGMIKMYVAEVLSKLPVMQHFYF 294

>NCAS0C01690 Chr3 complement(311102..312181) [1080 bp, 359 aa] {ON}
           Anc_8.674
          Length = 359

 Score =  157 bits (396), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 87/246 (35%), Positives = 142/246 (57%), Gaps = 7/246 (2%)

Query: 66  AVNRFTQIIDALSRTIDETPPLPGPR--RFGNFACRTWHVKMRGSLDALLQAFIPEKYHV 123
           ++   + ++D +++ +D+ P +   +  RFG    R ++ ++     +L++         
Sbjct: 51  SIASLSSLLDEVNKLVDKHPVIKEAKVSRFGKVEFRDFYDELNEKSSSLIKTRFSTLSDE 110

Query: 124 CIVEIRYYLGNAFGSKERLDYGTGHELSFLAVVSAIDMLDLWGSNPSGED-ILFLFNGYY 182
            + ++  YL  ++G+K R+DYG+GHEL+F+  +  +    L+       + +L +F  Y 
Sbjct: 111 QLEQLSIYLDESWGNKRRIDYGSGHELNFICFLFGLYSYGLFDLEKDAINLVLVVFLKYL 170

Query: 183 TLVKKLIATYTLEPAGSHGVWGLDDHFHLAYILGSSQLAPISHNPLRPSDILDRHTVEDY 242
            +++ L   Y LEPAGSHGVWGLDD+  L ++ G+ QL P  H  L+P  I +   VE +
Sbjct: 171 NIMRVLETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQLVP--HKHLKPMSIHNEELVELF 228

Query: 243 AKTNLYFQAIAFIDKVKSG-SFSEHSPMLYDIAKTVSTWSKVQRGLLKMYSAEVLNKFPV 301
               LYF  I+FI+ VK+  S   HSPML DI+  V  WSKV  G++KMY+AEVL K P+
Sbjct: 229 KDKFLYFGCISFINSVKTTTSLRWHSPMLDDIS-GVKKWSKVAEGMIKMYTAEVLGKLPI 287

Query: 302 VQHFWF 307
           +QHF+F
Sbjct: 288 MQHFYF 293

>TPHA0D01240 Chr4 complement(259089..260168) [1080 bp, 359 aa] {ON}
           Anc_8.674 YPL152W
          Length = 359

 Score =  156 bits (395), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 95/304 (31%), Positives = 156/304 (51%), Gaps = 19/304 (6%)

Query: 20  PVKKIFDTQGTQDFQSSVTMYRLQSYLHKYITLVGTKNIPSTSNNDAVNRFTQIIDALSR 79
           P K++      + +  S T   L ++L +       K++    N D     +Q ++++ +
Sbjct: 3   PQKRLLTNADMEIWDRSQTQADLLNFLKQL-----AKSVEGKENTDYTLPISQPVESMMK 57

Query: 80  TIDETPPL---------PGPRRFGNFACRTWHVKMRGSLDALLQAFIPEKYHVCIVEIRY 130
            + +   +             RFG    R ++  +      LL+   P      I ++  
Sbjct: 58  LLHKVQSILFKHPVVKDAHSSRFGKVEFRDFYDDLTSQSKTLLKECFPSLTDSQIEQLYV 117

Query: 131 YLGNAFGSKERLDYGTGHELSFLAVVSAIDMLDLWGSNPSGED-ILFLFNGYYTLVKKLI 189
           Y+  ++G+K+R+DYG+GHEL+F+  +  +    ++       + +L +F  Y  L++ L 
Sbjct: 118 YVDESWGNKQRIDYGSGHELNFMCFIYGLTSFKIFDLERDATNLVLKVFIQYLKLMRVLE 177

Query: 190 ATYTLEPAGSHGVWGLDDHFHLAYILGSSQLAPISHNPLRPSDILDRHTVEDYAKTNLYF 249
             Y LEPAGSHGVWGLDD+  L ++ G+ QL+  +H  L+PS I +   +E +A   LYF
Sbjct: 178 LQYWLEPAGSHGVWGLDDYHFLPFLFGAYQLS--THKHLKPSSIHNDDLIEMFADKYLYF 235

Query: 250 QAIAFIDKVKSGS-FSEHSPMLYDIAKTVSTWSKVQRGLLKMYSAEVLNKFPVVQHFWFG 308
             I FI+ VK+ +    HSPML DI+  V  WSKV  G+ KMY AEV+ K P++QHF+F 
Sbjct: 236 GCIEFINSVKTTTTLRWHSPMLDDIS-GVKKWSKVAEGMFKMYEAEVIKKLPIMQHFYFN 294

Query: 309 TGFF 312
             F 
Sbjct: 295 DMFL 298

>SAKL0H06622g Chr8 (583484..584551) [1068 bp, 355 aa] {ON} similar
           to uniprot|Q12461 Saccharomyces cerevisiae YPL152W
          Length = 355

 Score =  156 bits (394), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 94/295 (31%), Positives = 158/295 (53%), Gaps = 9/295 (3%)

Query: 20  PVKKIFDTQGTQDFQSSVTMYRLQSYLHKYITLV-GTKNIPSTSN-NDAVNRFTQIIDAL 77
           P K++      + +  S T   L  ++ K    V G +N       + +++    ++D +
Sbjct: 3   PQKRLLSQHDMEIWTESNTFNELTGFITKLGESVKGRENTQYVEPISSSIDELCSLLDKV 62

Query: 78  SRTIDETPPLPGPR--RFGNFACRTWHVKMRGSLDALLQAFIPEKYHVCIVEIRYYLGNA 135
           ++ +   P +      RFG    R ++  +      ++ +   +     + E+  Y   +
Sbjct: 63  NKVVSSHPVIQDANTSRFGKVEFRDFYDDLSSRSSEMISSLSDKLSTPQVDELAAYFRKS 122

Query: 136 FGSKERLDYGTGHELSFLAVVSAIDMLDLWGSNPSGEDILF-LFNGYYTLVKKLIATYTL 194
           +G++ R+DYG+GHEL+F+  +  ++  + +       +++  +F  Y  +++ L   Y L
Sbjct: 123 WGNRTRIDYGSGHELNFICFLYGLNKCNFFDLEKDATNVVLRVFIKYLDVMRTLETKYWL 182

Query: 195 EPAGSHGVWGLDDHFHLAYILGSSQLAPISHNPLRPSDILDRHTVEDYAKTNLYFQAIAF 254
           EPAGSHGVWGLDD+  L ++ G+ QLA  +H  L+P  I ++  VE + K  LYF  I F
Sbjct: 183 EPAGSHGVWGLDDYHFLPFLFGAFQLA--THKHLKPKSIHNKEFVEMFEKRYLYFGCIGF 240

Query: 255 IDKVKSG-SFSEHSPMLYDIAKTVSTWSKVQRGLLKMYSAEVLNKFPVVQHFWFG 308
           I+ VK+  S   HSPML DI+  V TWSKV  G++KMY AEVL K P++QHF+FG
Sbjct: 241 INSVKTSISLRWHSPMLDDIS-GVKTWSKVAEGMVKMYKAEVLGKLPIMQHFYFG 294

>KLLA0F11187g Chr6 (1031839..1032921) [1083 bp, 360 aa] {ON} similar
           to uniprot|Q12461 Saccharomyces cerevisiae YPL152W RRD2
           Resistant to Rapamycin Deletion 2; similar to
           hosphotyrosyl phosphatase activator (PTPA) from several
           organisms
          Length = 360

 Score =  155 bits (393), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 85/186 (45%), Positives = 117/186 (62%), Gaps = 9/186 (4%)

Query: 127 EIRYYLGNAFGSKERLDYGTGHELSFLAVVSAI---DMLDLWGSNPSGEDILFLFNGYYT 183
           +I  Y  N++G + R+DYG+GHEL+F+  +  +    + DL   N S   +L LF  Y  
Sbjct: 116 DICTYFINSWGDRSRIDYGSGHELNFICFLYCLTESKVFDL--ENDSSNIVLMLFIKYLG 173

Query: 184 LVKKLIATYTLEPAGSHGVWGLDDHFHLAYILGSSQLAPISHNPLRPSDILDRHTVEDYA 243
           +++ L   Y LEPAGSHGVWGLDD+  L ++ G+ QL+  +H  L+P  I +   VE + 
Sbjct: 174 IMRSLELKYWLEPAGSHGVWGLDDYHFLPFLFGAFQLS--THKHLKPKSIHNPEVVEMFQ 231

Query: 244 KTNLYFQAIAFIDKVKS-GSFSEHSPMLYDIAKTVSTWSKVQRGLLKMYSAEVLNKFPVV 302
              LYF  IAFI+KVK+  S   HSPML DI+  V  WSKV  G++KMY AEVL K P++
Sbjct: 232 DRYLYFGCIAFINKVKTTASLRWHSPMLDDIS-GVKRWSKVAEGMVKMYKAEVLQKLPIM 290

Query: 303 QHFWFG 308
           QHF+FG
Sbjct: 291 QHFYFG 296

>TBLA0C01860 Chr3 complement(437987..439057) [1071 bp, 356 aa] {ON}
           Anc_8.674 YPL152W
          Length = 356

 Score =  153 bits (386), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 93/267 (34%), Positives = 148/267 (55%), Gaps = 9/267 (3%)

Query: 60  STSNNDAVNRFTQIIDALSRTIDETPPLPGPRRFGNFACRTWHVKMRGSLDALLQAFIPE 119
           S S N+A +    I D + R   E+       RFG    ++++  +  + + L+++    
Sbjct: 48  SDSINNAFSLLQDIRDIIERYPVESDIESTKSRFGKVEFKSFYDDINQNSEKLIKSHFNG 107

Query: 120 KYHVCIVEIRYYLGNAFGSKERLDYGTGHELSFLAVVSAIDMLDLWGS-NPSGEDILFLF 178
                I E+  YL  ++G+++R+DYG+GHEL+F+  +  +   +++     S   +L +F
Sbjct: 108 LDPNQIQELSIYLVESWGNRQRIDYGSGHELNFICFLYGLTKYNIFNLLEDSTNLVLKIF 167

Query: 179 NGYYTLVKKLIATYTLEPAGSHGVWGLDDHFHLAYILGSSQLAPISHNPLRPSDILDRHT 238
             Y  +++ +   Y LEPAGSHGVWGLDD+  L ++ G+ QL+   H  L+P  I +   
Sbjct: 168 MEYINIMRIIETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQLS--KHKHLKPISIHNEEM 225

Query: 239 VEDYAKTNLYFQAIAFIDKVKS-GSFSEHSPMLYDIAKTVSTWSKVQRGLLKMYSAEVLN 297
           VE +    +YF  I FI+ +K+  +   HSPML DI+  V  WSKV  G++KMYSAEVL 
Sbjct: 226 VEMFKDKYMYFGCIDFINSIKTTATLRWHSPMLDDIS-GVKKWSKVSEGMIKMYSAEVLG 284

Query: 298 KFPVVQHFWFGTGFFPWVNVKSGAILP 324
           K P++QHF+F + F P      G  LP
Sbjct: 285 KLPIMQHFYF-SDFLP---CPQGVSLP 307

>NCAS0J00290 Chr10 (40028..43270) [3243 bp, 1080 aa] {ON} Anc_8.15
           YLR071C
          Length = 1080

 Score = 32.7 bits (73), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 24/38 (63%), Gaps = 3/38 (7%)

Query: 112 LLQAFIPEKYHVCIVEIRYYLGNAFGSKERLDYGTGHE 149
           L+ ++ P+K   CI+ IRY+L +  G+K ++  G G E
Sbjct: 368 LVHSYDPKK---CIISIRYWLNSKMGNKGKIMIGIGRE 402

>Kwal_56.23583 s56 (607721..609823) [2103 bp, 700 aa] {ON} YDR108W
           (GSG1) - involved in meiosis [contig 176] FULL
          Length = 700

 Score = 30.4 bits (67), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 24/46 (52%), Gaps = 2/46 (4%)

Query: 16  KFTEPVKKIFDTQGTQDFQSSVTMYRLQSYLHKYITLVGTKNIPST 61
           +FT P+  I  T+ T+D       + L+ +L KY+ LV  K  P T
Sbjct: 109 RFTRPLSDIIGTRETRDLL--FDYHSLEVFLQKYLELVDVKTSPDT 152

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.135    0.412 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 41,164,543
Number of extensions: 1796920
Number of successful extensions: 4144
Number of sequences better than 10.0: 46
Number of HSP's gapped: 4140
Number of HSP's successfully gapped: 46
Length of query: 385
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 274
Effective length of database: 40,753,473
Effective search space: 11166451602
Effective search space used: 11166451602
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 67 (30.4 bits)