Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0E15048g5.708ON54254229470.0
KLLA0A00484g5.708ON54354326560.0
TDEL0B021205.708ON54854826050.0
AFR292W5.708ON54154225540.0
Ecym_40135.708ON54254225530.0
YKR097W (PCK1)5.708ON54954825520.0
Skud_11.3375.708ON54954825420.0
NDAI0E050805.708ON55153225380.0
Smik_11.3615.708ON54954825280.0
NCAS0A031605.708ON55255225230.0
Suva_11.3345.708ON54854825220.0
KNAG0C066405.708ON54753425190.0
KLTH0E00902g5.708ON54454425160.0
CAGL0H06633g5.708ON54454325070.0
Kwal_55.196635.708ON54454424830.0
ZYRO0B16456g5.708ON54854824800.0
KAFR0H001605.708ON54954224710.0
TPHA0E001705.708ON57852023190.0
TBLA0E017005.708ON57654922770.0
Kpol_1043.755.708ON55852322590.0
Suva_7.275singletonON961101661e-13
TDEL0C063501.67ON693110840.14
KLTH0F02024g1.67ON73490770.88
TPHA0J025406.239ON866113751.5
Kwal_56.242656.259ON21759703.7
Kpol_1049.19na 1ON943228697.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0E15048g
         (542 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0E15048g Chr5 (1251927..1253555) [1629 bp, 542 aa] {ON} high...  1139   0.0  
KLLA0A00484g Chr1 complement(40330..41961) [1632 bp, 543 aa] {ON...  1027   0.0  
TDEL0B02120 Chr2 complement(377690..379336) [1647 bp, 548 aa] {O...  1008   0.0  
AFR292W Chr6 (965578..967203) [1626 bp, 541 aa] {ON} Syntenic ho...   988   0.0  
Ecym_4013 Chr4 complement(31078..32706) [1629 bp, 542 aa] {ON} s...   988   0.0  
YKR097W Chr11 (631152..632801) [1650 bp, 549 aa] {ON}  PCK1Phosp...   987   0.0  
Skud_11.337 Chr11 (612752..614401) [1650 bp, 549 aa] {ON} YKR097...   983   0.0  
NDAI0E05080 Chr5 (1165969..1167624) [1656 bp, 551 aa] {ON} Anc_5...   982   0.0  
Smik_11.361 Chr11 (621197..622846) [1650 bp, 549 aa] {ON} YKR097...   978   0.0  
NCAS0A03160 Chr1 complement(619303..620961) [1659 bp, 552 aa] {O...   976   0.0  
Suva_11.334 Chr11 (615967..617613) [1647 bp, 548 aa] {ON} YKR097...   976   0.0  
KNAG0C06640 Chr3 (1288896..1290539) [1644 bp, 547 aa] {ON} Anc_5...   974   0.0  
KLTH0E00902g Chr5 complement(88552..90186) [1635 bp, 544 aa] {ON...   973   0.0  
CAGL0H06633g Chr8 (659326..660960) [1635 bp, 544 aa] {ON} highly...   970   0.0  
Kwal_55.19663 s55 complement(70935..72569) [1635 bp, 544 aa] {ON...   961   0.0  
ZYRO0B16456g Chr2 (1334967..1336613) [1647 bp, 548 aa] {ON} high...   959   0.0  
KAFR0H00160 Chr8 complement(16235..17884) [1650 bp, 549 aa] {ON}...   956   0.0  
TPHA0E00170 Chr5 complement(16873..18609) [1737 bp, 578 aa] {ON}...   897   0.0  
TBLA0E01700 Chr5 complement(408779..410509) [1731 bp, 576 aa] {O...   881   0.0  
Kpol_1043.75 s1043 (162051..163727) [1677 bp, 558 aa] {ON} (1620...   874   0.0  
Suva_7.275 Chr7 complement(476201..476281,476285..476410,476414....    69   1e-13
TDEL0C06350 Chr3 complement(1159576..1161657) [2082 bp, 693 aa] ...    37   0.14 
KLTH0F02024g Chr6 (161423..163627) [2205 bp, 734 aa] {ON} simila...    34   0.88 
TPHA0J02540 Chr10 complement(561110..563710) [2601 bp, 866 aa] {...    33   1.5  
Kwal_56.24265 s56 complement(928206..928859) [654 bp, 217 aa] {O...    32   3.7  
Kpol_1049.19 s1049 (38439..41270) [2832 bp, 943 aa] {ON} (38439....    31   7.9  

>SAKL0E15048g Chr5 (1251927..1253555) [1629 bp, 542 aa] {ON} highly
           similar to uniprot|P10963 Saccharomyces cerevisiae
           YKR097W PCK1 Phosphoenolpyruvate carboxykinase key
           enzyme in gluconeogenesis catalyzes early reaction in
           carbohydrate biosynthesis glucose represses
           transcription and accelerates mRNA degradation regulated
           by Mcm1p and Cat8p located in the cytosol
          Length = 542

 Score = 1139 bits (2947), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 542/542 (100%), Positives = 542/542 (100%)

Query: 1   MSPSKTYASAEQRIRNELDLSDEVVTIRRNAPAALLYEDALKERKTTISSSGALIAYSGE 60
           MSPSKTYASAEQRIRNELDLSDEVVTIRRNAPAALLYEDALKERKTTISSSGALIAYSGE
Sbjct: 1   MSPSKTYASAEQRIRNELDLSDEVVTIRRNAPAALLYEDALKERKTTISSSGALIAYSGE 60

Query: 61  KTGRSPRDKRIVDESTSTDNVWWGPVNKKCSERTWQINRERAADYLRTRDHLYIVDAYAG 120
           KTGRSPRDKRIVDESTSTDNVWWGPVNKKCSERTWQINRERAADYLRTRDHLYIVDAYAG
Sbjct: 61  KTGRSPRDKRIVDESTSTDNVWWGPVNKKCSERTWQINRERAADYLRTRDHLYIVDAYAG 120

Query: 121 WDPRYRIKVRVVCARAYHALFMTNMLIRPTEQELAEFGEPDFTVWNAGQFPANTHTTGMT 180
           WDPRYRIKVRVVCARAYHALFMTNMLIRPTEQELAEFGEPDFTVWNAGQFPANTHTTGMT
Sbjct: 121 WDPRYRIKVRVVCARAYHALFMTNMLIRPTEQELAEFGEPDFTVWNAGQFPANTHTTGMT 180

Query: 181 SKTTVEINFKEMEMIILGTEYAGEMKKGIFTVMFYLMPVNHNVLTLHSSANQGIADNDVT 240
           SKTTVEINFKEMEMIILGTEYAGEMKKGIFTVMFYLMPVNHNVLTLHSSANQGIADNDVT
Sbjct: 181 SKTTVEINFKEMEMIILGTEYAGEMKKGIFTVMFYLMPVNHNVLTLHSSANQGIADNDVT 240

Query: 241 LFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCIGLSAEKEPEIYNAI 300
           LFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCIGLSAEKEPEIYNAI
Sbjct: 241 LFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCIGLSAEKEPEIYNAI 300

Query: 301 KFGSVLENVIYNPQTREVDYEDSSITENTRCAYPIDYIPSAKIPCLADNHPSNIVLLTCD 360
           KFGSVLENVIYNPQTREVDYEDSSITENTRCAYPIDYIPSAKIPCLADNHPSNIVLLTCD
Sbjct: 301 KFGSVLENVIYNPQTREVDYEDSSITENTRCAYPIDYIPSAKIPCLADNHPSNIVLLTCD 360

Query: 361 ASGVLPPVSRLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHPMKYAT 420
           ASGVLPPVSRLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHPMKYAT
Sbjct: 361 ASGVLPPVSRLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHPMKYAT 420

Query: 421 MLAEKMAKHNANAWLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLAKEKYETLPTF 480
           MLAEKMAKHNANAWLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLAKEKYETLPTF
Sbjct: 421 MLAEKMAKHNANAWLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLAKEKYETLPTF 480

Query: 481 NLEIPTRVNNVPSELLNPAKNWIEGEAKYTSAVQNLAQLFVENFKTYQDRATSQVLSAGP 540
           NLEIPTRVNNVPSELLNPAKNWIEGEAKYTSAVQNLAQLFVENFKTYQDRATSQVLSAGP
Sbjct: 481 NLEIPTRVNNVPSELLNPAKNWIEGEAKYTSAVQNLAQLFVENFKTYQDRATSQVLSAGP 540

Query: 541 QL 542
           QL
Sbjct: 541 QL 542

>KLLA0A00484g Chr1 complement(40330..41961) [1632 bp, 543 aa] {ON}
           highly similar to uniprot|P10963 Saccharomyces
           cerevisiae YKR097W PCK1 Phosphoenolpyruvate
           carboxykinase key enzyme in gluconeogenesis catalyzes
           early reaction in carbohydrate biosynthesis glucose
           represses transcription and accelerates mRNA degradation
           regulated by Mcm1p and Cat8p located in the cytosol
          Length = 543

 Score = 1027 bits (2656), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 480/543 (88%), Positives = 516/543 (95%), Gaps = 1/543 (0%)

Query: 1   MSPSKTYASAEQRIRNELDLSDEVVTIRRNAPAALLYEDALKERKTTISSSGALIAYSGE 60
           MSP+KT  SAE+ IR EL LS EVVTIRRNAPAALLYEDALKER T IS++GALIAYSG+
Sbjct: 1   MSPTKTQNSAEENIRAELGLSAEVVTIRRNAPAALLYEDALKERDTAISNAGALIAYSGD 60

Query: 61  KTGRSPRDKRIVDESTSTDNVWWGPVNKKCSERTWQINRERAADYLRTRDHLYIVDAYAG 120
           KTGRSPRDKRIV+E TS DNVWWGPVNK CSERTW+INRERAADYLRTRDH+YIVDAYAG
Sbjct: 61  KTGRSPRDKRIVEEETSKDNVWWGPVNKPCSERTWEINRERAADYLRTRDHIYIVDAYAG 120

Query: 121 WDPRYRIKVRVVCARAYHALFMTNMLIRPTEQELAEFGEPDFTVWNAGQFPANTHTTGMT 180
           WDPRYRIKVRVVCARAYHALFMTNMLIRP+++EL  FGEPDFTVWNAGQFPANTHT+GMT
Sbjct: 121 WDPRYRIKVRVVCARAYHALFMTNMLIRPSKEELENFGEPDFTVWNAGQFPANTHTSGMT 180

Query: 181 SKTTVEINFKEMEMIILGTEYAGEMKKGIFTVMFYLMPVNHNVLTLHSSANQGIADNDVT 240
           SKTTVEINFK+MEM+ILGTEYAGEMKKGIFTVMFYLMPVNHNVLTLHSSANQGI DNDVT
Sbjct: 181 SKTTVEINFKQMEMVILGTEYAGEMKKGIFTVMFYLMPVNHNVLTLHSSANQGIQDNDVT 240

Query: 241 LFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCIGLSAEKEPEIYNAI 300
           LFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKC+GLSAEKEPEI+NAI
Sbjct: 241 LFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCLGLSAEKEPEIFNAI 300

Query: 301 KFGSVLENVIYNPQTREVDYEDSSITENTRCAYPIDYIPSAKIPCLADNHPSNIVLLTCD 360
           KFGSVLEN+IY+P TREVDYEDS+ITENTRCAYPI+YIPSAKIPCLAD+HP NIVLLTCD
Sbjct: 301 KFGSVLENIIYDPNTREVDYEDSTITENTRCAYPIEYIPSAKIPCLADHHPKNIVLLTCD 360

Query: 361 ASGVLPPVSRLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHPMKYAT 420
           ASGVLPPVS+LTP+QVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFL+LHPMKYAT
Sbjct: 361 ASGVLPPVSKLTPDQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLSLHPMKYAT 420

Query: 421 MLAEKMAKHNANAWLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLAKEKYETLPTF 480
           MLAEKMA+HNANAWLINTGWTGSSYV+GGKRCPLKYTRAILD+IHDGSLAKE+YE LP F
Sbjct: 421 MLAEKMAEHNANAWLINTGWTGSSYVAGGKRCPLKYTRAILDAIHDGSLAKEEYEVLPIF 480

Query: 481 NLEIPTRV-NNVPSELLNPAKNWIEGEAKYTSAVQNLAQLFVENFKTYQDRATSQVLSAG 539
           NL+IP  V + VP+ LLNP+KNW EGEAKYTS V++LA LFVENFKTYQD+AT QVL+AG
Sbjct: 481 NLQIPKAVGDKVPASLLNPSKNWAEGEAKYTSNVKSLANLFVENFKTYQDKATEQVLAAG 540

Query: 540 PQL 542
           PQL
Sbjct: 541 PQL 543

>TDEL0B02120 Chr2 complement(377690..379336) [1647 bp, 548 aa] {ON}
           Anc_5.708 YKR097W
          Length = 548

 Score = 1008 bits (2605), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 467/548 (85%), Positives = 512/548 (93%), Gaps = 6/548 (1%)

Query: 1   MSPSKTYASA------EQRIRNELDLSDEVVTIRRNAPAALLYEDALKERKTTISSSGAL 54
           MSPSK   S       EQ+IR+EL LS+EV+TIRRNAPAA+LYEDAL E+KTTI+SSGAL
Sbjct: 1   MSPSKMNRSVTDVSEVEQKIRDELSLSNEVITIRRNAPAAILYEDALNEKKTTIASSGAL 60

Query: 55  IAYSGEKTGRSPRDKRIVDESTSTDNVWWGPVNKKCSERTWQINRERAADYLRTRDHLYI 114
           IAYSG+KTGRSP+DKRI++E TS DN+WWGPVNK   E+TW INRERAADYLRTR HLYI
Sbjct: 61  IAYSGDKTGRSPKDKRIIEEETSKDNIWWGPVNKPLPEKTWSINRERAADYLRTRTHLYI 120

Query: 115 VDAYAGWDPRYRIKVRVVCARAYHALFMTNMLIRPTEQELAEFGEPDFTVWNAGQFPANT 174
           VDA+AGWDPRYRIKVRVVCARAYHALFMTNMLIRPT++ELA FGEPDFTVWNAGQFPAN 
Sbjct: 121 VDAFAGWDPRYRIKVRVVCARAYHALFMTNMLIRPTDEELAHFGEPDFTVWNAGQFPANY 180

Query: 175 HTTGMTSKTTVEINFKEMEMIILGTEYAGEMKKGIFTVMFYLMPVNHNVLTLHSSANQGI 234
           HT GM+SKTTVEINFK MEMIILGTEYAGEMKKGIFTVMFYLMPV+HNVLTLHSSANQGI
Sbjct: 181 HTQGMSSKTTVEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI 240

Query: 235 ADNDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCIGLSAEKEP 294
             NDVTLFFGLSGTGKTTLSADPHR LIGDDEHCWSDHGVFNIEGGCYAKCIGL+AEKEP
Sbjct: 241 QKNDVTLFFGLSGTGKTTLSADPHRKLIGDDEHCWSDHGVFNIEGGCYAKCIGLTAEKEP 300

Query: 295 EIYNAIKFGSVLENVIYNPQTREVDYEDSSITENTRCAYPIDYIPSAKIPCLADNHPSNI 354
           EIYNAIKFGS+LENV+Y+P+TR+VDYEDSSITENTRCAYPI++IPSAKIPCLAD+HP N+
Sbjct: 301 EIYNAIKFGSILENVVYDPKTRDVDYEDSSITENTRCAYPIEHIPSAKIPCLADSHPQNL 360

Query: 355 VLLTCDASGVLPPVSRLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALH 414
           VLLTCDASGVLPP+S+LTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALH
Sbjct: 361 VLLTCDASGVLPPISKLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALH 420

Query: 415 PMKYATMLAEKMAKHNANAWLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLAKEKY 474
           P++YATMLA+KM++H ANAWLINTGWTGSSYV+GGKRCPLKYTRAILD+IHDGSLAKE Y
Sbjct: 421 PIRYATMLAKKMSEHRANAWLINTGWTGSSYVAGGKRCPLKYTRAILDAIHDGSLAKESY 480

Query: 475 ETLPTFNLEIPTRVNNVPSELLNPAKNWIEGEAKYTSAVQNLAQLFVENFKTYQDRATSQ 534
           ETLPTFNL IPT+VN VP ELLNP+KNW+EGEAKY +AV NLA+LFVENFK YQDRAT +
Sbjct: 481 ETLPTFNLHIPTKVNGVPKELLNPSKNWVEGEAKYNTAVNNLAKLFVENFKIYQDRATPE 540

Query: 535 VLSAGPQL 542
           VL+AGPQ+
Sbjct: 541 VLAAGPQV 548

>AFR292W Chr6 (965578..967203) [1626 bp, 541 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKR097W (PCK1)
          Length = 541

 Score =  988 bits (2554), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 458/542 (84%), Positives = 501/542 (92%), Gaps = 1/542 (0%)

Query: 1   MSPSKTYASAEQRIRNELDLSDEVVTIRRNAPAALLYEDALKERKTTISSSGALIAYSGE 60
           MSPSK Y + E++IR EL LS  V+TIRRNAPAA+LYEDAL ERKT ISS+GALIAYSGE
Sbjct: 1   MSPSKVYQTPEEKIRAELGLSSGVLTIRRNAPAAVLYEDALAERKTAISSTGALIAYSGE 60

Query: 61  KTGRSPRDKRIVDESTSTDNVWWGPVNKKCSERTWQINRERAADYLRTRDHLYIVDAYAG 120
           KTGRSP+DKRIVDE TS+DN+WWGPVN+K SE+TW INRERAAD+LRTR+HLYIVDAYAG
Sbjct: 61  KTGRSPKDKRIVDEPTSSDNIWWGPVNRKASEKTWLINRERAADFLRTREHLYIVDAYAG 120

Query: 121 WDPRYRIKVRVVCARAYHALFMTNMLIRPTEQELAEFGEPDFTVWNAGQFPANTHTTGMT 180
           WDPRYRIK+R+VC RAYHALFMTNMLIRPTE+ELAEFGEPDFTVWNAGQFPANTHT GM+
Sbjct: 121 WDPRYRIKIRIVCCRAYHALFMTNMLIRPTEEELAEFGEPDFTVWNAGQFPANTHTEGMS 180

Query: 181 SKTTVEINFKEMEMIILGTEYAGEMKKGIFTVMFYLMPVNHNVLTLHSSANQGIADNDVT 240
           SKTTVEINF+ MEM+ILGTEYAGEMKKGIFTVMFYLMP+NHNVLTLHSSANQG  +NDVT
Sbjct: 181 SKTTVEINFRAMEMVILGTEYAGEMKKGIFTVMFYLMPINHNVLTLHSSANQG-PNNDVT 239

Query: 241 LFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCIGLSAEKEPEIYNAI 300
           LFFGLSGTGKTTLSAD HR LIGDDEHCWSD+GVFNIEGGCYAKCIGLS EKEPEI+NAI
Sbjct: 240 LFFGLSGTGKTTLSADQHRKLIGDDEHCWSDYGVFNIEGGCYAKCIGLSGEKEPEIFNAI 299

Query: 301 KFGSVLENVIYNPQTREVDYEDSSITENTRCAYPIDYIPSAKIPCLADNHPSNIVLLTCD 360
           K+GSVLENV+Y+P TR VDYEDSSITENTRCAYPI+YIPSA+IPCL++NHPSNIVLLTCD
Sbjct: 300 KYGSVLENVVYDPVTRVVDYEDSSITENTRCAYPIEYIPSAQIPCLSENHPSNIVLLTCD 359

Query: 361 ASGVLPPVSRLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHPMKYAT 420
           ASGVLPPVSRLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHPMKYAT
Sbjct: 360 ASGVLPPVSRLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHPMKYAT 419

Query: 421 MLAEKMAKHNANAWLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLAKEKYETLPTF 480
           MLAEKM++HNA+AWLINTGWTGSSY +GGKRCPLKYTRAILDSIHDG+LA+ +YETLP F
Sbjct: 420 MLAEKMSQHNASAWLINTGWTGSSYTAGGKRCPLKYTRAILDSIHDGTLAQAEYETLPVF 479

Query: 481 NLEIPTRVNNVPSELLNPAKNWIEGEAKYTSAVQNLAQLFVENFKTYQDRATSQVLSAGP 540
            L IP  V  VP+ELLNPAKNW+EGE KY SAV  LA  F ENFK YQD+AT +V+ AGP
Sbjct: 480 GLSIPKAVEGVPAELLNPAKNWVEGEGKYASAVSALASKFTENFKIYQDQATEEVVRAGP 539

Query: 541 QL 542
           Q+
Sbjct: 540 QI 541

>Ecym_4013 Chr4 complement(31078..32706) [1629 bp, 542 aa] {ON}
           similar to Ashbya gossypii AFR292W
          Length = 542

 Score =  988 bits (2553), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 458/542 (84%), Positives = 499/542 (92%)

Query: 1   MSPSKTYASAEQRIRNELDLSDEVVTIRRNAPAALLYEDALKERKTTISSSGALIAYSGE 60
           MSPSK + S E++IR+EL LS  V+ IRRNAPAALLYEDAL ER T ISS+GALIAYSGE
Sbjct: 1   MSPSKVFQSPEEKIRSELGLSSGVLIIRRNAPAALLYEDALLERNTAISSTGALIAYSGE 60

Query: 61  KTGRSPRDKRIVDESTSTDNVWWGPVNKKCSERTWQINRERAADYLRTRDHLYIVDAYAG 120
           KTGRSP+DKRIVDE TS + VWWGPVN+K SERTW INRERA DYLRTR+HLYIVDA+AG
Sbjct: 61  KTGRSPKDKRIVDEPTSANKVWWGPVNRKVSERTWDINRERAVDYLRTREHLYIVDAFAG 120

Query: 121 WDPRYRIKVRVVCARAYHALFMTNMLIRPTEQELAEFGEPDFTVWNAGQFPANTHTTGMT 180
           WDPRYRIK+R+VC RAYHALFMTNMLIRPTE+ELAEFGEPDFTVWNAGQFPANTHT GM+
Sbjct: 121 WDPRYRIKIRIVCCRAYHALFMTNMLIRPTEEELAEFGEPDFTVWNAGQFPANTHTEGMS 180

Query: 181 SKTTVEINFKEMEMIILGTEYAGEMKKGIFTVMFYLMPVNHNVLTLHSSANQGIADNDVT 240
           SKTTVEINFK MEM+ILGTEYAGEMKKGIFTVMFYLMP+NHNVLTLHSSANQGIA  DVT
Sbjct: 181 SKTTVEINFKAMEMVILGTEYAGEMKKGIFTVMFYLMPINHNVLTLHSSANQGIAKGDVT 240

Query: 241 LFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCIGLSAEKEPEIYNAI 300
           LFFGLSGTGKTTLSAD HRLLIGDDEHCWSD+GVFNIEGGCYAKCIGLSAEKEPEI+NAI
Sbjct: 241 LFFGLSGTGKTTLSADQHRLLIGDDEHCWSDYGVFNIEGGCYAKCIGLSAEKEPEIFNAI 300

Query: 301 KFGSVLENVIYNPQTREVDYEDSSITENTRCAYPIDYIPSAKIPCLADNHPSNIVLLTCD 360
           ++GSVLENV+Y P +R VDY+DSSITENTRCAYPI+YIPSAKIPCL+++HPSNIVLLTCD
Sbjct: 301 RYGSVLENVVYEPVSRVVDYDDSSITENTRCAYPIEYIPSAKIPCLSNSHPSNIVLLTCD 360

Query: 361 ASGVLPPVSRLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHPMKYAT 420
           ASGVLPPVS+LTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHPMKYAT
Sbjct: 361 ASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHPMKYAT 420

Query: 421 MLAEKMAKHNANAWLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLAKEKYETLPTF 480
           MLAEKM++HNANAWLINTGWTG+SYVSGGKRCPLKYTRAILD+IH GSLA   YETLP F
Sbjct: 421 MLAEKMSQHNANAWLINTGWTGASYVSGGKRCPLKYTRAILDAIHGGSLANADYETLPVF 480

Query: 481 NLEIPTRVNNVPSELLNPAKNWIEGEAKYTSAVQNLAQLFVENFKTYQDRATSQVLSAGP 540
            L IP  V  VPSELLNP++NW+EGE KY+ AV +LA LFV+NFK YQD+AT +VL AGP
Sbjct: 481 GLSIPRAVEGVPSELLNPSRNWVEGEEKYSKAVTSLANLFVQNFKIYQDQATKEVLYAGP 540

Query: 541 QL 542
           QL
Sbjct: 541 QL 542

>YKR097W Chr11 (631152..632801) [1650 bp, 549 aa] {ON}
           PCK1Phosphoenolpyruvate carboxykinase, key enzyme in
           gluconeogenesis, catalyzes early reaction in
           carbohydrate biosynthesis, glucose represses
           transcription and accelerates mRNA degradation,
           regulated by Mcm1p and Cat8p, located in the cytosol
          Length = 549

 Score =  987 bits (2552), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 462/548 (84%), Positives = 499/548 (91%), Gaps = 6/548 (1%)

Query: 1   MSPSKTYASA------EQRIRNELDLSDEVVTIRRNAPAALLYEDALKERKTTISSSGAL 54
           MSPSK  A+       EQ+IR EL LSDEV TIRRNAPAA+LYED LKE KT ISSSGAL
Sbjct: 1   MSPSKMNATVGSTSEVEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKENKTVISSSGAL 60

Query: 55  IAYSGEKTGRSPRDKRIVDESTSTDNVWWGPVNKKCSERTWQINRERAADYLRTRDHLYI 114
           IAYSG KTGRSP+DKRIV+E TS D +WWGPVNK CSERTW INRERAADYLRTRDH+YI
Sbjct: 61  IAYSGVKTGRSPKDKRIVEEPTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYI 120

Query: 115 VDAYAGWDPRYRIKVRVVCARAYHALFMTNMLIRPTEQELAEFGEPDFTVWNAGQFPANT 174
           VDA+AGWDP+YRIKVRVVCARAYHALFMTNMLIRPTE+ELA FGEPDFTVWNAGQFPAN 
Sbjct: 121 VDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANL 180

Query: 175 HTTGMTSKTTVEINFKEMEMIILGTEYAGEMKKGIFTVMFYLMPVNHNVLTLHSSANQGI 234
           HT  M+SK+T+EINFK MEMIILGTEYAGEMKKGIFTVMFYLMPV+HNVLTLHSSANQGI
Sbjct: 181 HTQDMSSKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI 240

Query: 235 ADNDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCIGLSAEKEP 294
            + DVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCI LSAEKEP
Sbjct: 241 QNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCINLSAEKEP 300

Query: 295 EIYNAIKFGSVLENVIYNPQTREVDYEDSSITENTRCAYPIDYIPSAKIPCLADNHPSNI 354
           EI++AIKFGSVLENVIY+ ++  VDY+DSSITENTRCAYPIDYIPSAKIPCLAD+HP NI
Sbjct: 301 EIFDAIKFGSVLENVIYDEKSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNI 360

Query: 355 VLLTCDASGVLPPVSRLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALH 414
           +LLTCDASGVLPPVS+LTPEQVMYHFISGYTSKMAGTEQGVTEPE TFSSCFGQPFLALH
Sbjct: 361 ILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALH 420

Query: 415 PMKYATMLAEKMAKHNANAWLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLAKEKY 474
           P++YATMLA KM++H ANA+LINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLA E Y
Sbjct: 421 PIRYATMLATKMSQHKANAYLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLANETY 480

Query: 475 ETLPTFNLEIPTRVNNVPSELLNPAKNWIEGEAKYTSAVQNLAQLFVENFKTYQDRATSQ 534
           ETLP FNL++PT+VN VP+ELLNPAKNW +GE+KY  AV NLA LFV+NFK YQDRAT  
Sbjct: 481 ETLPIFNLQVPTKVNGVPAELLNPAKNWSQGESKYRGAVTNLANLFVQNFKIYQDRATPD 540

Query: 535 VLSAGPQL 542
           VL+AGPQ 
Sbjct: 541 VLAAGPQF 548

>Skud_11.337 Chr11 (612752..614401) [1650 bp, 549 aa] {ON} YKR097W
           (REAL)
          Length = 549

 Score =  983 bits (2542), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 458/548 (83%), Positives = 499/548 (91%), Gaps = 6/548 (1%)

Query: 1   MSPSKTYAS------AEQRIRNELDLSDEVVTIRRNAPAALLYEDALKERKTTISSSGAL 54
           MSPSK +A+       EQ+IR EL LSDEV TIRRNAPAA+LYED LKE+KT ISSSGAL
Sbjct: 1   MSPSKMHATTGSTSEVEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKEKKTVISSSGAL 60

Query: 55  IAYSGEKTGRSPRDKRIVDESTSTDNVWWGPVNKKCSERTWQINRERAADYLRTRDHLYI 114
           IAYSG KTGRSP+DKRIV+ESTS D +WWGPVNK CSERTW INRERAADYLRTRDH+YI
Sbjct: 61  IAYSGVKTGRSPKDKRIVEESTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYI 120

Query: 115 VDAYAGWDPRYRIKVRVVCARAYHALFMTNMLIRPTEQELAEFGEPDFTVWNAGQFPANT 174
           VDA+AGWDP+YRIKVRVVCARAYHALFMTNMLIRPTE+ELA FGEPDFTVWNAGQFPAN 
Sbjct: 121 VDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANL 180

Query: 175 HTTGMTSKTTVEINFKEMEMIILGTEYAGEMKKGIFTVMFYLMPVNHNVLTLHSSANQGI 234
           HT  M+SK+T+EINFK MEMIILGTEYAGEMKKGIFTVMFYLMPV+HNVLTLHSSANQGI
Sbjct: 181 HTQDMSSKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI 240

Query: 235 ADNDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCIGLSAEKEP 294
            + DVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCI LSAEKEP
Sbjct: 241 QNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCINLSAEKEP 300

Query: 295 EIYNAIKFGSVLENVIYNPQTREVDYEDSSITENTRCAYPIDYIPSAKIPCLADNHPSNI 354
           EI++AIKFG+VLENV Y+ ++  VDY+DSSITENTRCAYPIDYIPSAKIPCLAD+HP NI
Sbjct: 301 EIFDAIKFGAVLENVKYDEKSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNI 360

Query: 355 VLLTCDASGVLPPVSRLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALH 414
           +LLTCDASGVLPPVS+LTPEQVMYHFISGYTSKMAGTEQGVTEPE TFSSCFGQPFLALH
Sbjct: 361 ILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALH 420

Query: 415 PMKYATMLAEKMAKHNANAWLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLAKEKY 474
           P++YATMLA KM+ H +NA+LINTGW+GSSYVSGGKRCPLKYTRAILDSIHDGSLA E Y
Sbjct: 421 PIRYATMLATKMSHHKSNAYLINTGWSGSSYVSGGKRCPLKYTRAILDSIHDGSLANETY 480

Query: 475 ETLPTFNLEIPTRVNNVPSELLNPAKNWIEGEAKYTSAVQNLAQLFVENFKTYQDRATSQ 534
           E+LP FNL++PT+V  VP+ELLNPAKNW +GEAKY  +V NLA LFVENFK YQDRAT  
Sbjct: 481 ESLPIFNLQVPTKVKGVPAELLNPAKNWSQGEAKYKGSVTNLANLFVENFKIYQDRATPD 540

Query: 535 VLSAGPQL 542
           VL+AGPQ 
Sbjct: 541 VLAAGPQF 548

>NDAI0E05080 Chr5 (1165969..1167624) [1656 bp, 551 aa] {ON}
           Anc_5.708 YKR097W
          Length = 551

 Score =  982 bits (2538), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 450/532 (84%), Positives = 497/532 (93%)

Query: 11  EQRIRNELDLSDEVVTIRRNAPAALLYEDALKERKTTISSSGALIAYSGEKTGRSPRDKR 70
           EQ+IR ELDLS +V TIRRNAPAA+LYEDAL ER T ISS+GAL+AYSGEKTGRSPRDKR
Sbjct: 20  EQKIRQELDLSKDVTTIRRNAPAAILYEDALHERNTIISSTGALVAYSGEKTGRSPRDKR 79

Query: 71  IVDESTSTDNVWWGPVNKKCSERTWQINRERAADYLRTRDHLYIVDAYAGWDPRYRIKVR 130
           IV+E TS D++WWGPVNK CSERTW INRERAADYLRTRDHLYIVDA+AGWDP YRIKVR
Sbjct: 80  IVEEETSKDDIWWGPVNKPCSERTWSINRERAADYLRTRDHLYIVDAFAGWDPEYRIKVR 139

Query: 131 VVCARAYHALFMTNMLIRPTEQELAEFGEPDFTVWNAGQFPANTHTTGMTSKTTVEINFK 190
           VVCARAYHALFMTNMLIRPT++ELAEFGEPDFTVWNAGQFPAN HT  M+SKTT+EINFK
Sbjct: 140 VVCARAYHALFMTNMLIRPTQEELAEFGEPDFTVWNAGQFPANFHTQDMSSKTTIEINFK 199

Query: 191 EMEMIILGTEYAGEMKKGIFTVMFYLMPVNHNVLTLHSSANQGIADNDVTLFFGLSGTGK 250
            MEM+ILGTEYAGEMKKGIFTVMFYLMPV+HN+LTLHSSANQGI + DVTLFFGLSGTGK
Sbjct: 200 AMEMVILGTEYAGEMKKGIFTVMFYLMPVHHNILTLHSSANQGIRNGDVTLFFGLSGTGK 259

Query: 251 TTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCIGLSAEKEPEIYNAIKFGSVLENVI 310
           TTLSADPHRLLIGDDEHCWSD GVFNIEGGCYAKCI LS EKEPEI+ AIK+GS+LENVI
Sbjct: 260 TTLSADPHRLLIGDDEHCWSDKGVFNIEGGCYAKCINLSHEKEPEIFEAIKYGSILENVI 319

Query: 311 YNPQTREVDYEDSSITENTRCAYPIDYIPSAKIPCLADNHPSNIVLLTCDASGVLPPVSR 370
           Y+P+TR V Y+DS++TENTRCAYPI++IPSAKIPCLAD HPSNI+LLTCDASGVLPPVS+
Sbjct: 320 YDPKTRVVHYDDSTLTENTRCAYPIEFIPSAKIPCLADTHPSNIILLTCDASGVLPPVSK 379

Query: 371 LTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHPMKYATMLAEKMAKHN 430
           LTPEQVMYHFISGYTSKMAGTEQGVTEPE TFSSCFGQPFLALHP++YATMLA+K++KH+
Sbjct: 380 LTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALHPIRYATMLAKKISKHS 439

Query: 431 ANAWLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLAKEKYETLPTFNLEIPTRVNN 490
           ANAWLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLAK+++ETLP FNL++PT VNN
Sbjct: 440 ANAWLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLAKQEFETLPVFNLQVPTNVNN 499

Query: 491 VPSELLNPAKNWIEGEAKYTSAVQNLAQLFVENFKTYQDRATSQVLSAGPQL 542
           VP ELLNPAKNW +GEAKY +AV NLA LFVENFK YQD+AT +VL+A P++
Sbjct: 500 VPKELLNPAKNWAQGEAKYNAAVSNLASLFVENFKIYQDKATPEVLAAAPRI 551

>Smik_11.361 Chr11 (621197..622846) [1650 bp, 549 aa] {ON} YKR097W
           (REAL)
          Length = 549

 Score =  978 bits (2528), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 457/548 (83%), Positives = 497/548 (90%), Gaps = 6/548 (1%)

Query: 1   MSPSK------TYASAEQRIRNELDLSDEVVTIRRNAPAALLYEDALKERKTTISSSGAL 54
           MSPSK      + +  EQ+IR EL LSDEV TIRRNAPAA+LYED LKE+KT ISSSGAL
Sbjct: 1   MSPSKMNCTVGSTSEVEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKEKKTVISSSGAL 60

Query: 55  IAYSGEKTGRSPRDKRIVDESTSTDNVWWGPVNKKCSERTWQINRERAADYLRTRDHLYI 114
           IAYSG KTGRSP+DKRIV+E TS D +WWGPVNK CSERTW INRERAADYLRTRDH+YI
Sbjct: 61  IAYSGVKTGRSPKDKRIVEEPTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYI 120

Query: 115 VDAYAGWDPRYRIKVRVVCARAYHALFMTNMLIRPTEQELAEFGEPDFTVWNAGQFPANT 174
           VDA+AGWDP+YRIKVRVVCARAYHALFMTNMLIRPTE+ELA FGEPDFTVWNAGQFPAN 
Sbjct: 121 VDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANL 180

Query: 175 HTTGMTSKTTVEINFKEMEMIILGTEYAGEMKKGIFTVMFYLMPVNHNVLTLHSSANQGI 234
           HT  M+SK+T+EINFK MEMIILGTEYAGEMKKGIFTVMFYLMPV+HNVLTLHSSANQGI
Sbjct: 181 HTQDMSSKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI 240

Query: 235 ADNDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCIGLSAEKEP 294
            + DVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCI LSAEKEP
Sbjct: 241 QNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCINLSAEKEP 300

Query: 295 EIYNAIKFGSVLENVIYNPQTREVDYEDSSITENTRCAYPIDYIPSAKIPCLADNHPSNI 354
           EI++AIKFG+VLENV Y+ ++  VDY+DSSITENTRCAYPIDYIPSAKIPCLAD+HP NI
Sbjct: 301 EIFDAIKFGAVLENVKYDEKSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNI 360

Query: 355 VLLTCDASGVLPPVSRLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALH 414
           +LLTCDASGVLPPVS+LTPEQVMYHFISGYTSKMAGTEQGVTEPE TFSSCFGQPFLALH
Sbjct: 361 ILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALH 420

Query: 415 PMKYATMLAEKMAKHNANAWLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLAKEKY 474
           P++YATMLA KM++H ANA+LINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLA E Y
Sbjct: 421 PIRYATMLAAKMSQHKANAYLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLANETY 480

Query: 475 ETLPTFNLEIPTRVNNVPSELLNPAKNWIEGEAKYTSAVQNLAQLFVENFKTYQDRATSQ 534
           E+LP FNL++PT+V  VP+ELLNPAKNW +GE KY  AV +LA LFVENFK YQDRAT  
Sbjct: 481 ESLPIFNLQVPTKVKGVPAELLNPAKNWSQGETKYKGAVTSLATLFVENFKIYQDRATPD 540

Query: 535 VLSAGPQL 542
           VL+AGPQ 
Sbjct: 541 VLAAGPQF 548

>NCAS0A03160 Chr1 complement(619303..620961) [1659 bp, 552 aa] {ON}
           Anc_5.708 YKR097W
          Length = 552

 Score =  976 bits (2523), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 455/552 (82%), Positives = 499/552 (90%), Gaps = 10/552 (1%)

Query: 1   MSPSKTYAS----------AEQRIRNELDLSDEVVTIRRNAPAALLYEDALKERKTTISS 50
           MSP K  +S           EQ IR EL LS++V TIRRNAPAA+LYEDAL ERKT I+S
Sbjct: 1   MSPIKVSSSKPIDISDSQIVEQSIRKELGLSEDVTTIRRNAPAAVLYEDALHERKTVIAS 60

Query: 51  SGALIAYSGEKTGRSPRDKRIVDESTSTDNVWWGPVNKKCSERTWQINRERAADYLRTRD 110
           SGALIAYSG KTGRSPRDKRIV+E TS DNVWWGPVNK CSE+TW INRERAADYLRTRD
Sbjct: 61  SGALIAYSGSKTGRSPRDKRIVEEETSKDNVWWGPVNKPCSEKTWTINRERAADYLRTRD 120

Query: 111 HLYIVDAYAGWDPRYRIKVRVVCARAYHALFMTNMLIRPTEQELAEFGEPDFTVWNAGQF 170
           HLYIVDA+AGWDP+YRIKVRVVCARAYHA+FMTNMLIRPT++ELA FGEPDFT+WNAGQF
Sbjct: 121 HLYIVDAFAGWDPKYRIKVRVVCARAYHAIFMTNMLIRPTQEELATFGEPDFTIWNAGQF 180

Query: 171 PANTHTTGMTSKTTVEINFKEMEMIILGTEYAGEMKKGIFTVMFYLMPVNHNVLTLHSSA 230
           PAN +T  M+SKTT+EINFK MEMIILGTEYAGEMKKGIFTVMFYLMPV HN+LTLHSSA
Sbjct: 181 PANKNTQDMSSKTTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVYHNILTLHSSA 240

Query: 231 NQGIADNDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCIGLSA 290
           NQGI + DVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSD GVFNIEGGCYAKCI LSA
Sbjct: 241 NQGIQNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDTGVFNIEGGCYAKCINLSA 300

Query: 291 EKEPEIYNAIKFGSVLENVIYNPQTREVDYEDSSITENTRCAYPIDYIPSAKIPCLADNH 350
           EKEPEI+NAIK+GS+LENVIY+  TR VDY+D+SITENTRCAYPI+YIPSAKIPCLAD+H
Sbjct: 301 EKEPEIFNAIKYGSILENVIYDKNTRVVDYDDTSITENTRCAYPIEYIPSAKIPCLADSH 360

Query: 351 PSNIVLLTCDASGVLPPVSRLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPF 410
           P NI+LLTCDASGVLPPVS+LTPEQVMYHFISGYTSKMAGTE+GVTEPE+TFSSCFGQPF
Sbjct: 361 PKNIILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEEGVTEPESTFSSCFGQPF 420

Query: 411 LALHPMKYATMLAEKMAKHNANAWLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLA 470
           LALHP++YATMLAEK++ H+A+AWLINTGWTGSSYV+GGKRCPLKYTRAILDSIHDGSLA
Sbjct: 421 LALHPIRYATMLAEKISHHSADAWLINTGWTGSSYVNGGKRCPLKYTRAILDSIHDGSLA 480

Query: 471 KEKYETLPTFNLEIPTRVNNVPSELLNPAKNWIEGEAKYTSAVQNLAQLFVENFKTYQDR 530
           K+ YETLP FNL +PT VN VP E+LNPAKNW EGEAKY++AV  L  LFVENFKTYQDR
Sbjct: 481 KQSYETLPIFNLSVPTAVNGVPKEILNPAKNWSEGEAKYSTAVSKLGSLFVENFKTYQDR 540

Query: 531 ATSQVLSAGPQL 542
           AT  VL+AGPQ+
Sbjct: 541 ATPDVLAAGPQI 552

>Suva_11.334 Chr11 (615967..617613) [1647 bp, 548 aa] {ON} YKR097W
           (REAL)
          Length = 548

 Score =  976 bits (2522), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 457/548 (83%), Positives = 496/548 (90%), Gaps = 6/548 (1%)

Query: 1   MSPSKTYASA------EQRIRNELDLSDEVVTIRRNAPAALLYEDALKERKTTISSSGAL 54
           MSPSK  A A      EQ+IR EL LSDEV TIRRNAPAA+LYED LKE+KT ISSSGAL
Sbjct: 1   MSPSKMNAVAGTTSGVEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKEKKTVISSSGAL 60

Query: 55  IAYSGEKTGRSPRDKRIVDESTSTDNVWWGPVNKKCSERTWQINRERAADYLRTRDHLYI 114
           IAYSG KTGRSP+DKRIV+E TS D +WWGPVNK CSERTW INRERAADYLRTRDH+YI
Sbjct: 61  IAYSGVKTGRSPKDKRIVEEPTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYI 120

Query: 115 VDAYAGWDPRYRIKVRVVCARAYHALFMTNMLIRPTEQELAEFGEPDFTVWNAGQFPANT 174
           VDA+AGWDP+YRIKVRVVCARAYHALFMTNMLIRPTE+ELA FGEPDFTVWNAGQFPAN 
Sbjct: 121 VDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANL 180

Query: 175 HTTGMTSKTTVEINFKEMEMIILGTEYAGEMKKGIFTVMFYLMPVNHNVLTLHSSANQGI 234
           HT  M+SK+T+EINFK MEMIILGTEYAGEMKKGIFTVMFYLMPV+HN+LTLHSSANQGI
Sbjct: 181 HTQDMSSKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNILTLHSSANQGI 240

Query: 235 ADNDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCIGLSAEKEP 294
            + DVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSD+GVFNIEGGCYAKCI LSAEKEP
Sbjct: 241 KNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDNGVFNIEGGCYAKCINLSAEKEP 300

Query: 295 EIYNAIKFGSVLENVIYNPQTREVDYEDSSITENTRCAYPIDYIPSAKIPCLADNHPSNI 354
           EI++AI+FG+VLENV Y+  +  VDY+DSSITENTRCAYPIDYIPSAKIPCLAD+HP NI
Sbjct: 301 EIFDAIRFGAVLENVKYDENSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNI 360

Query: 355 VLLTCDASGVLPPVSRLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALH 414
           +LLTCDASGVLPPVS+LTPEQVMYHFISGYTSKMAGTEQGVTEPE TFSSCFGQPFLALH
Sbjct: 361 ILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALH 420

Query: 415 PMKYATMLAEKMAKHNANAWLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLAKEKY 474
           P++YATMLA KM++H ANA+LINTGWTGSSYVSGG RC LKYTRAILDSIHDGSLAK  Y
Sbjct: 421 PIRYATMLATKMSQHRANAYLINTGWTGSSYVSGGSRCALKYTRAILDSIHDGSLAKASY 480

Query: 475 ETLPTFNLEIPTRVNNVPSELLNPAKNWIEGEAKYTSAVQNLAQLFVENFKTYQDRATSQ 534
           E+LP FNL++PT+VN VP+ELLNPAKNW +GEAKY  AV NLA LFVENFK YQDRAT  
Sbjct: 481 ESLPIFNLQVPTKVNGVPAELLNPAKNWSQGEAKYKGAVTNLANLFVENFKIYQDRATPD 540

Query: 535 VLSAGPQL 542
           VL+AGPQ 
Sbjct: 541 VLAAGPQF 548

>KNAG0C06640 Chr3 (1288896..1290539) [1644 bp, 547 aa] {ON}
           Anc_5.708 YKR097W
          Length = 547

 Score =  974 bits (2519), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 449/534 (84%), Positives = 494/534 (92%)

Query: 9   SAEQRIRNELDLSDEVVTIRRNAPAALLYEDALKERKTTISSSGALIAYSGEKTGRSPRD 68
           S EQ+IR EL+LS EV+TIRRNAPAA+LYEDAL ERKT I+SSGALIAYSGEKTGRSP+D
Sbjct: 14  SVEQKIRRELNLSKEVITIRRNAPAAVLYEDALHERKTVIASSGALIAYSGEKTGRSPKD 73

Query: 69  KRIVDESTSTDNVWWGPVNKKCSERTWQINRERAADYLRTRDHLYIVDAYAGWDPRYRIK 128
           KRIV+E TS DNVWWGPVNK CSERTW+INRERAADYLRTRDHLYIVDA+AGWDP+YRIK
Sbjct: 74  KRIVEEETSKDNVWWGPVNKPCSERTWEINRERAADYLRTRDHLYIVDAFAGWDPKYRIK 133

Query: 129 VRVVCARAYHALFMTNMLIRPTEQELAEFGEPDFTVWNAGQFPANTHTTGMTSKTTVEIN 188
           VRVVCARAYHALFMTNMLIRP+++ELA FGEPDFTVWNAGQFPAN HT  M+SK+T+EIN
Sbjct: 134 VRVVCARAYHALFMTNMLIRPSKEELANFGEPDFTVWNAGQFPANMHTQDMSSKSTIEIN 193

Query: 189 FKEMEMIILGTEYAGEMKKGIFTVMFYLMPVNHNVLTLHSSANQGIADNDVTLFFGLSGT 248
           FK MEM+ILGTEYAGEMKKGIFTVMFYLMPV+HNVLTLHSSANQGI + DVTLFFGLSGT
Sbjct: 194 FKAMEMVILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGIKNGDVTLFFGLSGT 253

Query: 249 GKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCIGLSAEKEPEIYNAIKFGSVLEN 308
           GKTTLSADPHRLLIGDDEHCWSD GVFNIEGGCYAKCI LSAEKEPEI++AI+FGSVLEN
Sbjct: 254 GKTTLSADPHRLLIGDDEHCWSDQGVFNIEGGCYAKCINLSAEKEPEIFDAIRFGSVLEN 313

Query: 309 VIYNPQTREVDYEDSSITENTRCAYPIDYIPSAKIPCLADNHPSNIVLLTCDASGVLPPV 368
           V Y+ ++ EVDY+DS+ITENTRCAYPI+YIPSAKIPCLAD+HP NI+LLTCDASGVLPPV
Sbjct: 314 VAYDEKSHEVDYDDSTITENTRCAYPIEYIPSAKIPCLADSHPKNIILLTCDASGVLPPV 373

Query: 369 SRLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHPMKYATMLAEKMAK 428
           ++L+PEQVMYHFISGYTSKMAGTEQGVTEPE TFSSCFGQPFLALHP++YA MLA KM++
Sbjct: 374 AKLSPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALHPIRYAKMLAAKMSE 433

Query: 429 HNANAWLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLAKEKYETLPTFNLEIPTRV 488
           H ANA+LINTGWTGSSYVSGGKRCPLKYTRAILD+IHDGSLA+  YE+LP FNLE+PT V
Sbjct: 434 HKANAYLINTGWTGSSYVSGGKRCPLKYTRAILDAIHDGSLAQANYESLPIFNLEVPTAV 493

Query: 489 NNVPSELLNPAKNWIEGEAKYTSAVQNLAQLFVENFKTYQDRATSQVLSAGPQL 542
           N VP ELLNPAKNW +GEAKY  AV NLA LFVENFK YQD+AT  VL+AGP L
Sbjct: 494 NGVPHELLNPAKNWAQGEAKYNGAVSNLASLFVENFKIYQDKATPDVLAAGPIL 547

>KLTH0E00902g Chr5 complement(88552..90186) [1635 bp, 544 aa] {ON}
           highly similar to uniprot|P10963 Saccharomyces
           cerevisiae YKR097W PCK1 Phosphoenolpyruvate
           carboxykinase key enzyme in gluconeogenesis catalyzes
           early reaction in carbohydrate biosynthesis glucose
           represses transcription and accelerates mRNA degradation
           regulated by Mcm1p and Cat8p located in the cytosol
          Length = 544

 Score =  973 bits (2516), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 454/544 (83%), Positives = 494/544 (90%), Gaps = 2/544 (0%)

Query: 1   MSPSKT--YASAEQRIRNELDLSDEVVTIRRNAPAALLYEDALKERKTTISSSGALIAYS 58
           MSP+KT  + SA+  IR EL L +EVVTIRRNAPAALLYEDALKE KTTI+SSGALIA+S
Sbjct: 1   MSPTKTRNHVSAKDHIRQELALGEEVVTIRRNAPAALLYEDALKENKTTIASSGALIAFS 60

Query: 59  GEKTGRSPRDKRIVDESTSTDNVWWGPVNKKCSERTWQINRERAADYLRTRDHLYIVDAY 118
           G KTGRSP+DKRIVDE TST N+WWGPVNKKCSE+TW +NRERAADYLRTRDHLYIVDAY
Sbjct: 61  GSKTGRSPKDKRIVDEPTSTHNIWWGPVNKKCSEKTWLVNRERAADYLRTRDHLYIVDAY 120

Query: 119 AGWDPRYRIKVRVVCARAYHALFMTNMLIRPTEQELAEFGEPDFTVWNAGQFPANTHTTG 178
           AGWDPRYRIK+RVVCARAYHALFMTNMLIRPT++EL  FGEPDFTVWNAGQFPANTHT G
Sbjct: 121 AGWDPRYRIKIRVVCARAYHALFMTNMLIRPTKEELENFGEPDFTVWNAGQFPANTHTDG 180

Query: 179 MTSKTTVEINFKEMEMIILGTEYAGEMKKGIFTVMFYLMPVNHNVLTLHSSANQGIADND 238
           MTSKTTVEINF++MEM+ILGTEYAGEMKKGIFTVMFYLMPVNHNVLTLHSSANQGI D D
Sbjct: 181 MTSKTTVEINFQKMEMVILGTEYAGEMKKGIFTVMFYLMPVNHNVLTLHSSANQGIRDQD 240

Query: 239 VTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCIGLSAEKEPEIYN 298
           VTLFFGLSGTGKTTLSADP R LIGDDEHCWSDHGVFNIEGGCYAKCIGL+  KEPEI+N
Sbjct: 241 VTLFFGLSGTGKTTLSADPARKLIGDDEHCWSDHGVFNIEGGCYAKCIGLTEAKEPEIFN 300

Query: 299 AIKFGSVLENVIYNPQTREVDYEDSSITENTRCAYPIDYIPSAKIPCLADNHPSNIVLLT 358
           AIKFGSVLENV Y+P TR VDYED  ITENTRCAYPI+YIPSAKIPCLA++HP NIVLLT
Sbjct: 301 AIKFGSVLENVAYDPLTRVVDYEDCEITENTRCAYPIEYIPSAKIPCLANSHPKNIVLLT 360

Query: 359 CDASGVLPPVSRLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHPMKY 418
           CDASGVLPPVS+LTP QVMYHFISGYTSK+AGTE+GVTEPEATFSSCFGQPFLALHP+KY
Sbjct: 361 CDASGVLPPVSKLTPAQVMYHFISGYTSKVAGTEEGVTEPEATFSSCFGQPFLALHPLKY 420

Query: 419 ATMLAEKMAKHNANAWLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLAKEKYETLP 478
           ATMLAEKM++H ANAWLINTGWTG+S+V GG RCPLKYTRAILD++HDGSLA+E +ETLP
Sbjct: 421 ATMLAEKMSQHRANAWLINTGWTGASFVDGGNRCPLKYTRAILDAVHDGSLAQEDFETLP 480

Query: 479 TFNLEIPTRVNNVPSELLNPAKNWIEGEAKYTSAVQNLAQLFVENFKTYQDRATSQVLSA 538
           TF L +P  VNNVP  +LNPAKNW EGE KY   V  LA+LF ENFK YQDRA++ V+SA
Sbjct: 481 TFRLHVPRHVNNVPEHILNPAKNWFEGETKYKHRVGALAKLFTENFKKYQDRASADVISA 540

Query: 539 GPQL 542
           GP L
Sbjct: 541 GPVL 544

>CAGL0H06633g Chr8 (659326..660960) [1635 bp, 544 aa] {ON} highly
           similar to uniprot|P10963 Saccharomyces cerevisiae
           YKR097w PCK1
          Length = 544

 Score =  970 bits (2507), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 454/543 (83%), Positives = 495/543 (91%), Gaps = 3/543 (0%)

Query: 3   PSKTYASA---EQRIRNELDLSDEVVTIRRNAPAALLYEDALKERKTTISSSGALIAYSG 59
           PSK+  S    E+RIR+EL LS EV  IRRNAPAA+LY+DALKE+KT ISS+GALIAYSG
Sbjct: 2   PSKSSVSGNSVEERIRSELGLSKEVTLIRRNAPAAVLYQDALKEKKTVISSAGALIAYSG 61

Query: 60  EKTGRSPRDKRIVDESTSTDNVWWGPVNKKCSERTWQINRERAADYLRTRDHLYIVDAYA 119
           EKTGRSP+DKRIV+E TS DNVWWGPVNK CSERTW INRERAADYLRTR+ LY+VDA+A
Sbjct: 62  EKTGRSPKDKRIVEEETSRDNVWWGPVNKPCSERTWAINRERAADYLRTRETLYVVDAFA 121

Query: 120 GWDPRYRIKVRVVCARAYHALFMTNMLIRPTEQELAEFGEPDFTVWNAGQFPANTHTTGM 179
           GWDP+YRIKVRVVCARAYHALFMTNMLIRPTE+ELA FGEPDFTVWNAGQFPAN  T  M
Sbjct: 122 GWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELANFGEPDFTVWNAGQFPANARTQDM 181

Query: 180 TSKTTVEINFKEMEMIILGTEYAGEMKKGIFTVMFYLMPVNHNVLTLHSSANQGIADNDV 239
           TSKTT+EINFK MEM+ILGTEYAGEMKKGIFTVMFYLMPV+HNVLTLHSS NQGI + DV
Sbjct: 182 TSKTTIEINFKAMEMVILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSCNQGIKNGDV 241

Query: 240 TLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCIGLSAEKEPEIYNA 299
           TLFFGLSGTGKTTLSADPHRLLIGDDEHCWSD GVFNIEGGCYAKCI LS EKEPEI++A
Sbjct: 242 TLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDEGVFNIEGGCYAKCINLSREKEPEIFDA 301

Query: 300 IKFGSVLENVIYNPQTREVDYEDSSITENTRCAYPIDYIPSAKIPCLADNHPSNIVLLTC 359
           I+FGSVLENVIY+ ++ EVDY+DSSITENTRCAYPID+IPSAKIPCLA  HP NI+LLTC
Sbjct: 302 IRFGSVLENVIYDSESHEVDYDDSSITENTRCAYPIDFIPSAKIPCLAPAHPKNIILLTC 361

Query: 360 DASGVLPPVSRLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHPMKYA 419
           DASGVLPPVS+LTPEQVMYHFISGYTSKMAGTEQGVTEPE TFSSCFGQPFL+LHPM+YA
Sbjct: 362 DASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLSLHPMRYA 421

Query: 420 TMLAEKMAKHNANAWLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLAKEKYETLPT 479
           TMLAEKM +H+ANAWLINTGWTGSSYVSGGKRC LKYTRAILD+IHDGSLAK ++E+LP 
Sbjct: 422 TMLAEKMHEHSANAWLINTGWTGSSYVSGGKRCALKYTRAILDAIHDGSLAKAEFESLPI 481

Query: 480 FNLEIPTRVNNVPSELLNPAKNWIEGEAKYTSAVQNLAQLFVENFKTYQDRATSQVLSAG 539
           FNL++P  V  VPSELLNPA+NW EGEAKY SAV  LA LFVENFKTYQD+ATS VL+AG
Sbjct: 482 FNLQVPKAVEGVPSELLNPARNWSEGEAKYQSAVSKLAGLFVENFKTYQDKATSDVLAAG 541

Query: 540 PQL 542
           PQL
Sbjct: 542 PQL 544

>Kwal_55.19663 s55 complement(70935..72569) [1635 bp, 544 aa] {ON}
           YKR097W (PCK1) - phosphoenolpyruvate carboxylkinase
           [contig 159] FULL
          Length = 544

 Score =  961 bits (2483), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 446/544 (81%), Positives = 493/544 (90%), Gaps = 2/544 (0%)

Query: 1   MSPSK--TYASAEQRIRNELDLSDEVVTIRRNAPAALLYEDALKERKTTISSSGALIAYS 58
           MSPSK     S + RIR EL L +EVVTIRRNAPAALLYEDALKE KT IS+SGALIA+S
Sbjct: 1   MSPSKIRNLVSVKDRIRKELALGEEVVTIRRNAPAALLYEDALKENKTRISASGALIAFS 60

Query: 59  GEKTGRSPRDKRIVDESTSTDNVWWGPVNKKCSERTWQINRERAADYLRTRDHLYIVDAY 118
           G KTGRSP+DKRIVDE TS+ N+WWGPVNKKCSE+TW +NRERAAD+LRTRDHLYIVDAY
Sbjct: 61  GSKTGRSPKDKRIVDEPTSSQNIWWGPVNKKCSEKTWLVNRERAADFLRTRDHLYIVDAY 120

Query: 119 AGWDPRYRIKVRVVCARAYHALFMTNMLIRPTEQELAEFGEPDFTVWNAGQFPANTHTTG 178
           AGWDPRYRIK+RVVCARAYHALFMTNMLI+PT QEL EFGEPDFTVWNAGQFPANTHT G
Sbjct: 121 AGWDPRYRIKIRVVCARAYHALFMTNMLIQPTPQELEEFGEPDFTVWNAGQFPANTHTDG 180

Query: 179 MTSKTTVEINFKEMEMIILGTEYAGEMKKGIFTVMFYLMPVNHNVLTLHSSANQGIADND 238
           MTSKTT+EINF++MEM+ILGTEYAGEMKKGIFTVMFYLMP+NH VLTLHSSANQGI DND
Sbjct: 181 MTSKTTIEINFQKMEMVILGTEYAGEMKKGIFTVMFYLMPINHGVLTLHSSANQGIRDND 240

Query: 239 VTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCIGLSAEKEPEIYN 298
           VTLFFGLSGTGKTTLSADP R LIGDDEHCWSDHGVFNIEGGCYAKCIGL+  KEPEI+N
Sbjct: 241 VTLFFGLSGTGKTTLSADPARKLIGDDEHCWSDHGVFNIEGGCYAKCIGLTEAKEPEIFN 300

Query: 299 AIKFGSVLENVIYNPQTREVDYEDSSITENTRCAYPIDYIPSAKIPCLADNHPSNIVLLT 358
           AI+FGSVLENV Y+  TREVD+E+  ITENTRCAYPI+YIPSAKIPCLAD HP NIVLLT
Sbjct: 301 AIRFGSVLENVAYDSFTREVDFENCEITENTRCAYPIEYIPSAKIPCLADEHPKNIVLLT 360

Query: 359 CDASGVLPPVSRLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHPMKY 418
           CDASGVLPPVS+LTPEQVMYHFISGYTSK+AGTE+GVTEPEATFSSCFGQPFLALHP+KY
Sbjct: 361 CDASGVLPPVSKLTPEQVMYHFISGYTSKVAGTEEGVTEPEATFSSCFGQPFLALHPLKY 420

Query: 419 ATMLAEKMAKHNANAWLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLAKEKYETLP 478
           ATMLA+KM+ H A+AWLINTGWTG S+V GG RCPLKYTRAILD+IHDG+LAKE+YETLP
Sbjct: 421 ATMLADKMSHHKADAWLINTGWTGQSFVDGGDRCPLKYTRAILDAIHDGTLAKEEYETLP 480

Query: 479 TFNLEIPTRVNNVPSELLNPAKNWIEGEAKYTSAVQNLAQLFVENFKTYQDRATSQVLSA 538
           TFNL IP  VNNVPS +LNPA++W+ GEAKY + V+ LA LFVENFK Y+  A+++++ A
Sbjct: 481 TFNLHIPLHVNNVPSNILNPARSWVGGEAKYKTKVRTLANLFVENFKKYEANASTEIMCA 540

Query: 539 GPQL 542
           GP L
Sbjct: 541 GPLL 544

>ZYRO0B16456g Chr2 (1334967..1336613) [1647 bp, 548 aa] {ON} highly
           similar to uniprot|P10963 Saccharomyces cerevisiae
           YKR097W PCK1 Phosphoenolpyruvate carboxykinase key
           enzyme in gluconeogenesis catalyzes early reaction in
           carbohydrate biosynthesis glucose represses
           transcription and accelerates mRNA degradation regulated
           by Mcm1p and Cat8p located in the cytosol
          Length = 548

 Score =  959 bits (2480), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 450/548 (82%), Positives = 483/548 (88%), Gaps = 6/548 (1%)

Query: 1   MSPSKT------YASAEQRIRNELDLSDEVVTIRRNAPAALLYEDALKERKTTISSSGAL 54
           MSPSK        A  E++IR EL L  EVVTIR NAPAA LYED LKE+KT + SSGAL
Sbjct: 1   MSPSKVPVPITDTAEVEEQIRKELALGSEVVTIRHNAPAATLYEDGLKEKKTAVVSSGAL 60

Query: 55  IAYSGEKTGRSPRDKRIVDESTSTDNVWWGPVNKKCSERTWQINRERAADYLRTRDHLYI 114
            AYSG KTGRSP+DKRI++E TS + VWWGPVNK  SE+TW INRERAADYLRTRDHLYI
Sbjct: 61  AAYSGSKTGRSPKDKRIIEEETSKNEVWWGPVNKPASEKTWSINRERAADYLRTRDHLYI 120

Query: 115 VDAYAGWDPRYRIKVRVVCARAYHALFMTNMLIRPTEQELAEFGEPDFTVWNAGQFPANT 174
           +DAYAGWDPRYRIKVRV+CARAYHALFMTNMLIRP+ +ELA FGEPDFTVWNAGQFPAN 
Sbjct: 121 IDAYAGWDPRYRIKVRVICARAYHALFMTNMLIRPSPEELANFGEPDFTVWNAGQFPANR 180

Query: 175 HTTGMTSKTTVEINFKEMEMIILGTEYAGEMKKGIFTVMFYLMPVNHNVLTLHSSANQGI 234
           +T GMTSKTTVEINFK MEMIILGTEYAGEMKKGIFTVMFYLMPV+HNVLTLHSSANQGI
Sbjct: 181 NTEGMTSKTTVEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI 240

Query: 235 ADNDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCIGLSAEKEP 294
              DVTLFFGLSGTGKTTLSADPHR LIGDDEHCWSDHGVFNIEGGCYAKCI L+AEKEP
Sbjct: 241 ERGDVTLFFGLSGTGKTTLSADPHRALIGDDEHCWSDHGVFNIEGGCYAKCIDLTAEKEP 300

Query: 295 EIYNAIKFGSVLENVIYNPQTREVDYEDSSITENTRCAYPIDYIPSAKIPCLADNHPSNI 354
           EIYNAIKFGSVLENV+++   REVDY D+SITENTRCAYPIDYIPSAKIPCLAD HPSNI
Sbjct: 301 EIYNAIKFGSVLENVVFDASNREVDYTDNSITENTRCAYPIDYIPSAKIPCLADKHPSNI 360

Query: 355 VLLTCDASGVLPPVSRLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALH 414
           VLLTCDASGVLPPVS+LTPEQVMYHFISGYTSKMAGTEQGVTEPE TFSSCFGQPFLALH
Sbjct: 361 VLLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPETTFSSCFGQPFLALH 420

Query: 415 PMKYATMLAEKMAKHNANAWLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLAKEKY 474
           PM+YATMLA+KM +HNANAWL+NTGWTGSSY +GGKRCPLKYTRAILDSIHDGSL+K  Y
Sbjct: 421 PMRYATMLAKKMHQHNANAWLVNTGWTGSSYTAGGKRCPLKYTRAILDSIHDGSLSKADY 480

Query: 475 ETLPTFNLEIPTRVNNVPSELLNPAKNWIEGEAKYTSAVQNLAQLFVENFKTYQDRATSQ 534
           ETLP FNL  P +VN VP  LLNPAK+W+EG  KY SAV+ LA  F ENFK YQD+AT  
Sbjct: 481 ETLPIFNLHTPAKVNGVPDSLLNPAKSWVEGPTKYNSAVKTLATKFTENFKIYQDQATPD 540

Query: 535 VLSAGPQL 542
           VL+AGPQ 
Sbjct: 541 VLAAGPQF 548

>KAFR0H00160 Chr8 complement(16235..17884) [1650 bp, 549 aa] {ON}
           Anc_5.708 YKR097W
          Length = 549

 Score =  956 bits (2471), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 436/542 (80%), Positives = 496/542 (91%), Gaps = 1/542 (0%)

Query: 2   SPSKTYASAEQRIRNELDLSDEVVTIRRNAPAALLYEDALK-ERKTTISSSGALIAYSGE 60
           +P K   + EQ+IR ELDLS  V TIRRNAP ++LYEDALK E+ T ISS+GALIAYSGE
Sbjct: 8   TPLKDLNAVEQKIRQELDLSSGVTTIRRNAPVSVLYEDALKDEKNTIISSTGALIAYSGE 67

Query: 61  KTGRSPRDKRIVDESTSTDNVWWGPVNKKCSERTWQINRERAADYLRTRDHLYIVDAYAG 120
           KTGR P+DKRIV+ES S +++WWGPVNK CSERTW+INRERAADYLRTR+H+YIVDA+AG
Sbjct: 68  KTGRCPKDKRIVEESDSKEDIWWGPVNKPCSERTWEINRERAADYLRTREHIYIVDAFAG 127

Query: 121 WDPRYRIKVRVVCARAYHALFMTNMLIRPTEQELAEFGEPDFTVWNAGQFPANTHTTGMT 180
           WDP+YRIKVRVVCARAYHALFMTNMLIRPT+ EL  FG+PDFTVWNAGQFPAN HT  M+
Sbjct: 128 WDPKYRIKVRVVCARAYHALFMTNMLIRPTKDELENFGDPDFTVWNAGQFPANFHTEDMS 187

Query: 181 SKTTVEINFKEMEMIILGTEYAGEMKKGIFTVMFYLMPVNHNVLTLHSSANQGIADNDVT 240
           SKTT+EINFK MEMIILGTEYAGEMKKGIFTVMFYLMP++HNVLTLHSSAN+GI   DVT
Sbjct: 188 SKTTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPIHHNVLTLHSSANEGIEKKDVT 247

Query: 241 LFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCIGLSAEKEPEIYNAI 300
           LFFGLSGTGKTTLSADPHRLLIGDDEHCWSD GVFNIEGGCYAKCI LS EKEPEI+N+I
Sbjct: 248 LFFGLSGTGKTTLSADPHRLLIGDDEHCWSDTGVFNIEGGCYAKCINLSVEKEPEIFNSI 307

Query: 301 KFGSVLENVIYNPQTREVDYEDSSITENTRCAYPIDYIPSAKIPCLADNHPSNIVLLTCD 360
           KFGS+LENV+Y+P++REVDY+DSSITENTRCAYPI++IPSAKIPC+A++HP NI+LLTCD
Sbjct: 308 KFGSILENVVYDPKSREVDYDDSSITENTRCAYPIEFIPSAKIPCIANSHPKNIILLTCD 367

Query: 361 ASGVLPPVSRLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHPMKYAT 420
           ASGVLPPVS+LT +QVMYHFISGYTSKMAGTEQGVTEP+ TFSSCFGQPFLALHPMKYAT
Sbjct: 368 ASGVLPPVSKLTSDQVMYHFISGYTSKMAGTEQGVTEPQPTFSSCFGQPFLALHPMKYAT 427

Query: 421 MLAEKMAKHNANAWLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLAKEKYETLPTF 480
           MLAEKM KH ANAWLINTGWTGSSY++GGKRCPL YTRAILD+IHDGSL KE +ETLP F
Sbjct: 428 MLAEKMEKHKANAWLINTGWTGSSYIAGGKRCPLPYTRAILDAIHDGSLEKESFETLPIF 487

Query: 481 NLEIPTRVNNVPSELLNPAKNWIEGEAKYTSAVQNLAQLFVENFKTYQDRATSQVLSAGP 540
           NL++P  VNNVP++LLNP+KNW EGE KY+ AV+ L++LF+ENFKTY+D+AT +VL+AGP
Sbjct: 488 NLKVPKNVNNVPTKLLNPSKNWYEGELKYSGAVKKLSKLFIENFKTYEDKATKEVLAAGP 547

Query: 541 QL 542
           +L
Sbjct: 548 RL 549

>TPHA0E00170 Chr5 complement(16873..18609) [1737 bp, 578 aa] {ON}
           Anc_5.708 YKR097W
          Length = 578

 Score =  897 bits (2319), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 411/520 (79%), Positives = 461/520 (88%)

Query: 23  EVVTIRRNAPAALLYEDALKERKTTISSSGALIAYSGEKTGRSPRDKRIVDESTSTDNVW 82
           +++ I+RN P A LYED LKE KTT+SS+GALIAYSG KTGRSP+DKRIV+E  S DN+W
Sbjct: 59  QLINIKRNPPVATLYEDGLKENKTTLSSTGALIAYSGVKTGRSPKDKRIVEEELSKDNIW 118

Query: 83  WGPVNKKCSERTWQINRERAADYLRTRDHLYIVDAYAGWDPRYRIKVRVVCARAYHALFM 142
           WGPVNK+CSERTW INRERA DYL TRD LY++DA+ GWDPRYRIK+RVVCARAYHALFM
Sbjct: 119 WGPVNKQCSERTWAINRERAVDYLNTRDTLYVIDAFVGWDPRYRIKIRVVCARAYHALFM 178

Query: 143 TNMLIRPTEQELAEFGEPDFTVWNAGQFPANTHTTGMTSKTTVEINFKEMEMIILGTEYA 202
            NMLIRPT++EL  FG+PDFTVWNAGQF AN+ T  M+SKT+VEINFKEMEM ILGTEYA
Sbjct: 179 NNMLIRPTKEELENFGKPDFTVWNAGQFFANSLTNDMSSKTSVEINFKEMEMTILGTEYA 238

Query: 203 GEMKKGIFTVMFYLMPVNHNVLTLHSSANQGIADNDVTLFFGLSGTGKTTLSADPHRLLI 262
           GEMKKGIFTVMFYLMP+ HNVLTLHSSANQ   + DVTLFFGLSGTGKTTLSADPHR LI
Sbjct: 239 GEMKKGIFTVMFYLMPIYHNVLTLHSSANQENNNGDVTLFFGLSGTGKTTLSADPHRQLI 298

Query: 263 GDDEHCWSDHGVFNIEGGCYAKCIGLSAEKEPEIYNAIKFGSVLENVIYNPQTREVDYED 322
           GDDEHCWSD+GVFNIEGGCYAKCIGLS EKEP+I+NAIKFGSVLEN IY+ +T EVDY++
Sbjct: 299 GDDEHCWSDNGVFNIEGGCYAKCIGLSKEKEPDIFNAIKFGSVLENCIYDEETHEVDYDN 358

Query: 323 SSITENTRCAYPIDYIPSAKIPCLADNHPSNIVLLTCDASGVLPPVSRLTPEQVMYHFIS 382
           S+ITENTRCAYPIDYI +AKIPCLAD HP+N++LLTCDASGVLPPVS+LTPEQVMYHFIS
Sbjct: 359 STITENTRCAYPIDYISNAKIPCLADKHPTNLILLTCDASGVLPPVSKLTPEQVMYHFIS 418

Query: 383 GYTSKMAGTEQGVTEPEATFSSCFGQPFLALHPMKYATMLAEKMAKHNANAWLINTGWTG 442
           GYTSKMAGTE GVTEP+ TFSSCFGQPFLALHPMKYA+MLAEKM KH ANAWL+NTGWTG
Sbjct: 419 GYTSKMAGTEVGVTEPQPTFSSCFGQPFLALHPMKYASMLAEKMDKHKANAWLLNTGWTG 478

Query: 443 SSYVSGGKRCPLKYTRAILDSIHDGSLAKEKYETLPTFNLEIPTRVNNVPSELLNPAKNW 502
           SSYVSGG RCPLKYTRAILD+IHDGSL  E+YETLP FNL+IP   N VPSELLNPA +W
Sbjct: 479 SSYVSGGSRCPLKYTRAILDAIHDGSLQNEEYETLPIFNLQIPKNANGVPSELLNPAGSW 538

Query: 503 IEGEAKYTSAVQNLAQLFVENFKTYQDRATSQVLSAGPQL 542
            +    Y +AVQ L +LF ENFKTY+D+AT++V+ AGP L
Sbjct: 539 TDSSEDYMTAVQRLGKLFNENFKTYEDKATNEVIKAGPVL 578

>TBLA0E01700 Chr5 complement(408779..410509) [1731 bp, 576 aa] {ON}
           Anc_5.708 YKR097W
          Length = 576

 Score =  881 bits (2277), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 415/549 (75%), Positives = 466/549 (84%), Gaps = 8/549 (1%)

Query: 2   SPSKTYASAEQRIRNELDLS----DEVVTIRRNAPAALLYEDALKERKTTISSSGALIAY 57
           S  K   S E ++ ++L+        ++ I+ N  AA+LYEDALKE KT ISSSGALIAY
Sbjct: 28  SLKKQKLSMEDQLLSQLNWDGSKDSSLINIKHNPSAAILYEDALKEPKTVISSSGALIAY 87

Query: 58  SGEKTGRSPRDKRIVDESTSTDNVWWGPVNKKCSERTWQINRERAADYLRTRDHLYIVDA 117
           SG KTGRSP+DKRIV E  S DNVWWGPVNK CSE+TWQINRER  DYL TR +LY++DA
Sbjct: 88  SGAKTGRSPKDKRIVYEDGSKDNVWWGPVNKPCSEKTWQINRERTLDYLGTRSNLYVIDA 147

Query: 118 YAGWDPRYRIKVRVVCARAYHALFMTNMLIRPTEQELAEFGEPDFTVWNAGQFPANTHTT 177
           Y GWDPRYR+KVRVVCARAYHALFMTNMLIRPTE+EL  F EPDFTVWNAG F AN++T 
Sbjct: 148 YVGWDPRYRLKVRVVCARAYHALFMTNMLIRPTEEELKNFNEPDFTVWNAGGFSANSYTA 207

Query: 178 GMTSKTTVEINFKEMEMIILGTEYAGEMKKGIFTVMFYLMPVNHNVLTLHSSANQGIADN 237
            MTSKT+VEINFK MEMIILGTEYAGEMKKGIFTVMFYLMP++HN+LTLHSSAN+GI   
Sbjct: 208 DMTSKTSVEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPIHHNILTLHSSANEGIEKK 267

Query: 238 DVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCIGLSAEKEPEIY 297
           DVT+FFGLSGTGKTTLSADP+RLLIGDDEHCWSDHGVFNIEGGCYAKCIGL+ EKEPEI+
Sbjct: 268 DVTVFFGLSGTGKTTLSADPNRLLIGDDEHCWSDHGVFNIEGGCYAKCIGLTREKEPEIF 327

Query: 298 NAIKFGSVLENVIYNPQTREVDYEDSSITENTRCAYPIDYIPSAKIPCLADNHPSNIVLL 357
           +AI+FGSVLENV YN    +VDY D +ITENTRCAYPIDYI SAKIPCLA++HP N++LL
Sbjct: 328 DAIRFGSVLENVTYNELNHKVDYNDCAITENTRCAYPIDYIKSAKIPCLANSHPKNLILL 387

Query: 358 TCDASGVLPPVSRLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHPMK 417
           TCDASGVLPPVS+LTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHP+ 
Sbjct: 388 TCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHPIT 447

Query: 418 YATMLAEKMAKHNANAWLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLAKEKYETL 477
           YATMLA+KM ++ +NAWLINTGWTGSSY +GG RCPLKYTRAILD+IHDG+LA E YETL
Sbjct: 448 YATMLAKKMDQYKSNAWLINTGWTGSSYSAGGSRCPLKYTRAILDAIHDGTLANENYETL 507

Query: 478 PTFNLEIPTRVNNVPSELLNPAKNWIEGEAK----YTSAVQNLAQLFVENFKTYQDRATS 533
           P FNL+IPT VN VP+E+LNP  +W     K    Y  AV  LA LFVENFK YQD+AT 
Sbjct: 508 PVFNLQIPTHVNGVPNEILNPENSWNSPANKNNISYNKAVNKLAALFVENFKIYQDKATD 567

Query: 534 QVLSAGPQL 542
            VL+AGPQ+
Sbjct: 568 DVLAAGPQV 576

>Kpol_1043.75 s1043 (162051..163727) [1677 bp, 558 aa] {ON}
           (162051..163727) [1677 nt, 559 aa]
          Length = 558

 Score =  874 bits (2259), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/523 (77%), Positives = 452/523 (86%)

Query: 20  LSDEVVTIRRNAPAALLYEDALKERKTTISSSGALIAYSGEKTGRSPRDKRIVDESTSTD 79
           L ++ +TI+RN P A LYED LKE  TT+SS+GAL+AYSG KTGRSP+DKRIV+E +S D
Sbjct: 36  LYNKDITIKRNPPIAELYEDGLKEDSTTLSSTGALMAYSGVKTGRSPKDKRIVEEPSSKD 95

Query: 80  NVWWGPVNKKCSERTWQINRERAADYLRTRDHLYIVDAYAGWDPRYRIKVRVVCARAYHA 139
           N+WWGPVNK CSE TW INRERA DYL TR  LY++DAYAGWD  YRIK+RVVCAR YHA
Sbjct: 96  NIWWGPVNKPCSELTWSINRERAIDYLNTRKILYVIDAYAGWDANYRIKIRVVCARPYHA 155

Query: 140 LFMTNMLIRPTEQELAEFGEPDFTVWNAGQFPANTHTTGMTSKTTVEINFKEMEMIILGT 199
           LFM NMLIRPT +EL  FGEPDFT+WNAG F AN+ T  MTSKT++EINFK MEM+ILGT
Sbjct: 156 LFMNNMLIRPTTEELENFGEPDFTIWNAGSFYANSLTKDMTSKTSIEINFKSMEMVILGT 215

Query: 200 EYAGEMKKGIFTVMFYLMPVNHNVLTLHSSANQGIADNDVTLFFGLSGTGKTTLSADPHR 259
           EYAGEMKKGIFTVMFYLMPV HNVLTLHSSANQG+ + DVTLFFGLSGTGKTTLSADPHR
Sbjct: 216 EYAGEMKKGIFTVMFYLMPVYHNVLTLHSSANQGVNNGDVTLFFGLSGTGKTTLSADPHR 275

Query: 260 LLIGDDEHCWSDHGVFNIEGGCYAKCIGLSAEKEPEIYNAIKFGSVLENVIYNPQTREVD 319
            LIGDDEHCWSDHGVFNIEGGCYAKCIGL+ EKEPEI+NAIKFGSVLEN +Y+  T  VD
Sbjct: 276 ELIGDDEHCWSDHGVFNIEGGCYAKCIGLTEEKEPEIFNAIKFGSVLENCVYDENTHVVD 335

Query: 320 YEDSSITENTRCAYPIDYIPSAKIPCLADNHPSNIVLLTCDASGVLPPVSRLTPEQVMYH 379
           Y+DS ITENTRCAYPID+I SAKIPCL D HP+N++LLTCDASGVLPPVS+LTPEQVMYH
Sbjct: 336 YDDSRITENTRCAYPIDFIESAKIPCLTDKHPTNLILLTCDASGVLPPVSKLTPEQVMYH 395

Query: 380 FISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHPMKYATMLAEKMAKHNANAWLINTG 439
           FISGYTSKMAGTEQGVTEPE TFS+CFGQPFLALHPMKYA MLA+KM  H A+AWLINTG
Sbjct: 396 FISGYTSKMAGTEQGVTEPEPTFSACFGQPFLALHPMKYAQMLADKMNHHKASAWLINTG 455

Query: 440 WTGSSYVSGGKRCPLKYTRAILDSIHDGSLAKEKYETLPTFNLEIPTRVNNVPSELLNPA 499
           WTG+SY +GGKRCPLKYTRAILD+IH+GSLA E+YETLP FNL IP  V NVPSELLNP+
Sbjct: 456 WTGASYTAGGKRCPLKYTRAILDAIHNGSLANEEYETLPVFNLPIPKNVENVPSELLNPS 515

Query: 500 KNWIEGEAKYTSAVQNLAQLFVENFKTYQDRATSQVLSAGPQL 542
           K W + +  Y+ AV+ L  LFV+NF  YQD+AT  V++AGP L
Sbjct: 516 KTWSDPDVTYSQAVKKLGSLFVQNFTIYQDQATDDVIAAGPAL 558

>Suva_7.275 Chr7
           complement(476201..476281,476285..476410,476414..476494)
           [288 bp, 96 aa] {ON} YKR097W (REAL)
          Length = 96

 Score = 68.6 bits (166), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 47/110 (42%), Positives = 59/110 (53%), Gaps = 18/110 (16%)

Query: 371 LTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHPMKYATMLAEKMAKHN 430
           LT E+VMYHF SG+ S   G         +       +PFLALHP+ Y T++A KM  H 
Sbjct: 1   LTSEEVMYHFNSGHASN--GRNWAGCHLTSNVLLVLVKPFLALHPISYITVIATKMFAH- 57

Query: 431 ANAWLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLAKEKYETLPTF 480
            +A+LINTG+             LK TR   DSIHD SLAKE +   PT+
Sbjct: 58  -SAYLINTGYA------------LK-TRVNFDSIHDDSLAKELFRA-PTY 92

>TDEL0C06350 Chr3 complement(1159576..1161657) [2082 bp, 693 aa]
           {ON} Anc_1.67 YLR188W
          Length = 693

 Score = 37.0 bits (84), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 56/110 (50%), Gaps = 32/110 (29%)

Query: 231 NQGIADN-DVTL-------FFGLSGTGKTTLSA--------DPHRLLIGDDEHCWSDHGV 274
           NQ I D  D+T+         G SG+GK+T+++        +  R++IGD       H +
Sbjct: 452 NQKIFDGLDITVEPGEHVCIVGPSGSGKSTVASLLLRYYDTNEGRIMIGD-------HNI 504

Query: 275 --FNIEGGCYAKCIGLSAEKEPEIYNAIKFGSVLENVIYNPQTREVDYED 322
             FN+    Y + +G+  ++EP+++N    G++L+N++Y       D +D
Sbjct: 505 NSFNVRK--YRRLLGI-VQQEPQLFN----GTILDNILYTVPPERADNDD 547

>KLTH0F02024g Chr6 (161423..163627) [2205 bp, 734 aa] {ON} similar
           to uniprot|P33310 Saccharomyces cerevisiae YLR188W MDL1
           Half-type ATP-binding cassette (ABC) transporter of the
           inner mitochondrial membrane mediates export of peptides
           generated upon proteolysis of mitochondrial proteins
           plays a role in the regulation of cellular resistance to
           oxidative stress
          Length = 734

 Score = 34.3 bits (77), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 26/90 (28%), Positives = 47/90 (52%), Gaps = 20/90 (22%)

Query: 244 GLSGTGKTTLSA--------DPHRLLIGDDEHCWSDHGVFNIEGGCYAKCIGLSAEKEPE 295
           G SG GK+T+++        D   +LIG      +D   FN+    Y + +G+  ++EP 
Sbjct: 484 GPSGGGKSTVASLLLRFYDVDAGAILIGGQN--IAD---FNLR--KYRRLVGI-VQQEPM 535

Query: 296 IYNAIKFGSVLENVIYNPQTREVDYEDSSI 325
           ++N    G++LEN++Y    R ++ ED  +
Sbjct: 536 LFN----GTILENILYTVPQRLLNEEDGRV 561

>TPHA0J02540 Chr10 complement(561110..563710) [2601 bp, 866 aa] {ON}
           Anc_6.239 YGL137W
          Length = 866

 Score = 33.5 bits (75), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 28/113 (24%), Positives = 49/113 (43%), Gaps = 10/113 (8%)

Query: 207 KGIFTVMFYLMPVNHNVLTLHSSANQGIADNDVTLFFGLSGTGKTTLSADPHRLLIGDDE 266
           K    VM + +P+N+N+  L++ +  G+  +    FF           A   R+ I  DE
Sbjct: 420 KNFKEVMSWSIPLNYNIENLYTGSLLGVKSDGFVYFFDWES------GALIRRIDIDADE 473

Query: 267 HCWSDHGVFNIEGGCYAKCIGLSAEKEPEIYNAIKFGSVLENVIYNPQTREVD 319
             WSD+G   +     ++    S +  P+ Y+ +   SV E  + N  T + D
Sbjct: 474 VVWSDNGELVMLMSSNSE----SRDDGPKAYSLLYNRSVFEEAVANGVTGDED 522

>Kwal_56.24265 s56 complement(928206..928859) [654 bp, 217 aa] {ON}
           YPL233W (NSL1) - Protein required for cell viability
           [contig 165] FULL
          Length = 217

 Score = 31.6 bits (70), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 32/59 (54%), Gaps = 2/59 (3%)

Query: 24  VVTIRRNAPAALLYEDALKERKTTISSSGALIAYSGEKTGRSPRDKR-IVDESTSTDNV 81
           V  +RR AP  L + D + E ++ +  + ALIA   E    S RD++  V+E   +DN+
Sbjct: 112 VAQLRREAPQKLCH-DYVAEARSALEEADALIASFTESDETSSRDQQESVEELYKSDNI 169

>Kpol_1049.19 s1049 (38439..41270) [2832 bp, 943 aa] {ON}
           (38439..41270) [2832 nt, 944 aa]
          Length = 943

 Score = 31.2 bits (69), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 52/228 (22%), Positives = 85/228 (37%), Gaps = 37/228 (16%)

Query: 339 PSAKIPCLADNH--------PSNIVLLTCDA---------SGVLPPVSRLTPEQVMYHFI 381
           PS+ IPC++  +        P   +  T D          S   PPV  +TP+ +M   I
Sbjct: 96  PSSSIPCISKENIYEERIYEPETTLKQTPDVINNCTEGGFSSYCPPVPIVTPDSIMASAI 155

Query: 382 SGYTSKMAGTEQGVTE-----PEATFSSCFGQPFLA---LHPMKYATMLAEKMAKHNANA 433
           +  T+ +  +  G++       E T S  +  P      +  MK     A+         
Sbjct: 156 TPATTAVNSSINGLSNNMHSPEEVTKSKLYDIPLTVPSFMKDMKMELWEAKDTIVEYGCL 215

Query: 434 WLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLAKEKYETLPTFNLEIPTRVNNVPS 493
             +   ++  +++   K     Y RA+  SIH  SL K +         E    VNN P 
Sbjct: 216 RFVEPAFSTHTFIQLDK-----YARALCGSIHGISLIKLQERLEENIAKEDGMMVNNNPD 270

Query: 494 --ELLNPAKNWIEGEAKY----TSAVQNLAQL-FVENFKTYQDRATSQ 534
             ++L+P     +   K+    +   QN   L F  NF +  D A S+
Sbjct: 271 NMDILSPLPFIDKAIVKFLEIDSHQSQNAPPLNFFYNFYSIDDDADSK 318

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.132    0.397 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 58,847,885
Number of extensions: 2613877
Number of successful extensions: 6651
Number of sequences better than 10.0: 31
Number of HSP's gapped: 6763
Number of HSP's successfully gapped: 31
Length of query: 542
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 428
Effective length of database: 40,409,475
Effective search space: 17295255300
Effective search space used: 17295255300
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)