Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0E15026g5.707ON29029013840.0
NDAI0F002705.707ON2981711191e-06
NCAS0G002105.707ON2881071121e-05
KLTH0E00946g5.707ON2151021092e-05
ZYRO0B16434g5.707ON2371541031e-04
KAFR0D022005.707ON182147959e-04
TPHA0E001805.707ON16596800.065
Suva_9.365.707ON224103800.098
Kwal_55.196755.707ON232107750.40
AER371C2.240ON43047702.4
YIL152W5.707ON235104666.5
NCAS0E003403.553ON29267666.7
ADR317C3.162ON81940677.0
KAFR0A051206.29ON147995668.4
NOTE: 8 genes in the same pillar as SAKL0E15026g were not hit in these BLAST results
LIST: Kpol_1043.74 Skud_9.16 Smik_9.17 TBLA0I01690 TDEL0B02130 KLLA0A00506g KNAG0L02160 Cgla_YGOB_Anc_5.707

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0E15026g
         (290 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0E15026g Chr5 complement(1250249..1251121) [873 bp, 290 aa] ...   537   0.0  
NDAI0F00270 Chr6 (55368..56264) [897 bp, 298 aa] {ON} Anc_5.707 ...    50   1e-06
NCAS0G00210 Chr7 (30686..31552) [867 bp, 288 aa] {ON} Anc_5.707 ...    48   1e-05
KLTH0E00946g Chr5 (91205..91852) [648 bp, 215 aa] {ON} conserved...    47   2e-05
ZYRO0B16434g Chr2 complement(1333310..1334023) [714 bp, 237 aa] ...    44   1e-04
KAFR0D02200 Chr4 (441330..441878) [549 bp, 182 aa] {ON} Anc_5.70...    41   9e-04
TPHA0E00180 Chr5 (19852..20349) [498 bp, 165 aa] {ON} Anc_5.707 ...    35   0.065
Suva_9.36 Chr9 (51248..51922) [675 bp, 224 aa] {ON} YIL152W (REAL)     35   0.098
Kwal_55.19675 s55 (74607..75305) [699 bp, 232 aa] {ON} [contig 1...    33   0.40 
AER371C Chr5 complement(1323406..1324698) [1293 bp, 430 aa] {ON}...    32   2.4  
YIL152W Chr9 (56545..57252) [708 bp, 235 aa] {ON} Putative prote...    30   6.5  
NCAS0E00340 Chr5 (56429..57307) [879 bp, 292 aa] {ON} Anc_3.553 ...    30   6.7  
ADR317C Chr4 complement(1263080..1265539) [2460 bp, 819 aa] {ON}...    30   7.0  
KAFR0A05120 Chr1 (1015307..1019746) [4440 bp, 1479 aa] {ON} Anc_...    30   8.4  

>SAKL0E15026g Chr5 complement(1250249..1251121) [873 bp, 290 aa]
           {ON} conserved hypothetical protein
          Length = 290

 Score =  537 bits (1384), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 262/290 (90%), Positives = 262/290 (90%)

Query: 1   MGISEQRVSKRHTTALSQPFSVLLNNSRAVSPRSSRKPLASKSTNRNXXXXXXXXXXXXX 60
           MGISEQRVSKRHTTALSQPFSVLLNNSRAVSPRSSRKPLASKSTNRN             
Sbjct: 1   MGISEQRVSKRHTTALSQPFSVLLNNSRAVSPRSSRKPLASKSTNRNLSLSQLLPRSSSP 60

Query: 61  XKAPSHQKCKKTKTPGPPAASSAHDVFSKLSTYSAGCLRHVPENQGNNRMXXXXXXXXXX 120
            KAPSHQKCKKTKTPGPPAASSAHDVFSKLSTYSAGCLRHVPENQGNNRM          
Sbjct: 61  RKAPSHQKCKKTKTPGPPAASSAHDVFSKLSTYSAGCLRHVPENQGNNRMSLSQLVSVAS 120

Query: 121 XXXXEDPLPQQMKPSSPATFDAILQSSIAGGNSTSTDGRTGGTKFTGSSNVQRYLHPEFS 180
               EDPLPQQMKPSSPATFDAILQSSIAGGNSTSTDGRTGGTKFTGSSNVQRYLHPEFS
Sbjct: 121 AAKAEDPLPQQMKPSSPATFDAILQSSIAGGNSTSTDGRTGGTKFTGSSNVQRYLHPEFS 180

Query: 181 ASLSKDSMLFRLQKSLCDFNTVYKLSSHVSKPNYDIVLTVDCTQQLSPDELLVISSECAH 240
           ASLSKDSMLFRLQKSLCDFNTVYKLSSHVSKPNYDIVLTVDCTQQLSPDELLVISSECAH
Sbjct: 181 ASLSKDSMLFRLQKSLCDFNTVYKLSSHVSKPNYDIVLTVDCTQQLSPDELLVISSECAH 240

Query: 241 AIVLHRFKNKAFPRTEKHRVLKLHLDSRSEIELYPGLYWYSNWYFADANR 290
           AIVLHRFKNKAFPRTEKHRVLKLHLDSRSEIELYPGLYWYSNWYFADANR
Sbjct: 241 AIVLHRFKNKAFPRTEKHRVLKLHLDSRSEIELYPGLYWYSNWYFADANR 290

>NDAI0F00270 Chr6 (55368..56264) [897 bp, 298 aa] {ON} Anc_5.707
           YIL152W
          Length = 298

 Score = 50.4 bits (119), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 54/171 (31%), Positives = 78/171 (45%), Gaps = 17/171 (9%)

Query: 128 LPQQMKPSSPATFD---AILQSSIAGGNSTSTDGRTGGTKFTGSSNVQRY-LHPEFSASL 183
           + +Q++   P T     AIL S   G  S     +   + F   S  ++Y L P      
Sbjct: 131 MAKQLERKEPTTIRDGIAILDSK-NGIGSKIIKAKFRKSHFKLGSVTRKYELFPLQDLEQ 189

Query: 184 SKDSMLFR-LQKSLCDFNTVYKLSSHVSKPNYDIVLTVDCTQQLSPDELLVISSECAHA- 241
           +K S L + LQKSLCD +T  K  S+ S   YD +LTV   + LS  E+ + S +   A 
Sbjct: 190 NKPSALLQSLQKSLCDLDTSLKTLSYHS---YDTLLTVTSFEMLSDHEIKINSVKNYTAG 246

Query: 242 ------IVLHRFKNKAFPR-TEKHRVLKLHLDSRSEIELYPGLYWYSNWYF 285
                 ++LH   +   P     H+  KL LDS+  +EL P + WY  W F
Sbjct: 247 FTTDVTMLLHSKISLNVPLPNNLHKDYKLALDSKVYLELAPNVKWYLVWKF 297

>NCAS0G00210 Chr7 (30686..31552) [867 bp, 288 aa] {ON} Anc_5.707
           YIL152W
          Length = 288

 Score = 47.8 bits (112), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 34/107 (31%), Positives = 51/107 (47%), Gaps = 16/107 (14%)

Query: 192 LQKSLCDFNTVYKLSSHVSKPNYDIVLTVDCTQQLSPDELLVISSECAHAIVLH------ 245
           LQK LCD +T+ K S   S   YD V T++   +LS  EL V +      I+LH      
Sbjct: 181 LQKYLCDLDTMMKTSKKFS---YDSVWTINSITKLSDFELQVTTQMSPQLIILHNKTSIN 237

Query: 246 -----RFKNKAFPRTEKHRV--LKLHLDSRSEIELYPGLYWYSNWYF 285
                +F +     T+      LKL ++S+S I++   + WY +W F
Sbjct: 238 NIPILKFIHDVSINTKIQVTESLKLAINSKSFIKVSDDINWYIDWKF 284

>KLTH0E00946g Chr5 (91205..91852) [648 bp, 215 aa] {ON} conserved
           hypothetical protein
          Length = 215

 Score = 46.6 bits (109), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 50/102 (49%), Gaps = 9/102 (8%)

Query: 187 SMLFRLQKSLCDFNTVYKLSSH-VSKPNYDIVLTVDCTQQLSPDELLVISSE--CAHAIV 243
           +++ RL K +  F T  +L  H +S   YD  L V  T+ LSP ELL +++       ++
Sbjct: 115 ALVNRLLKCVSAFETNRRLQRHGLSTHEYDRKLHVQYTKLLSPTELLAVAAGPLGREVLI 174

Query: 244 LHRF--KNKAFPRTEKHRVLKLHLDSRSEIELYPGLYWYSNW 283
           LH       A P++      +L L S +   LYPGL WY  W
Sbjct: 175 LHMLPSTKDAEPKSGS----QLLLSSNASALLYPGLRWYFEW 212

>ZYRO0B16434g Chr2 complement(1333310..1334023) [714 bp, 237 aa]
           {ON} weakly similar to uniprot|P40455 Saccharomyces
           cerevisiae YIL152W Hypothetical ORF
          Length = 237

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 44/154 (28%), Positives = 72/154 (46%), Gaps = 13/154 (8%)

Query: 140 FDAILQSSIAGGNS--TSTDGRTGGTKFTGSSNVQRYLHPE-----FSASLSKDSMLFRL 192
            D+ILQ+S     S   +T     G     S  ++R +  +      SA   K +++ +L
Sbjct: 88  LDSILQNSKVSKLSQPITTTNIARGEDIRDSYTLRRRIRDDNEKCASSADKKKTNLVTQL 147

Query: 193 QKSLCDFNTVYKLSSHVSKPNYDIVLTVDCTQQLSPDELLVISSE-CAHAIVLHRFKNKA 251
             +L DFN + K S      NYDI++ +     LSP E++VIS +      +LH   +KA
Sbjct: 148 ICALNDFNLMVKTSQQ--NQNYDILVDIRHAIWLSPFEIMVISDDPRVKRAILH--SHKA 203

Query: 252 FPRTEKHRVLKLHLDSRSEIELYPGLYWYSNWYF 285
            P+   +   +L + S+  + LY  + WY  W F
Sbjct: 204 IPKFV-NSPSRLAICSKCCLTLYNDMNWYLKWKF 236

>KAFR0D02200 Chr4 (441330..441878) [549 bp, 182 aa] {ON} Anc_5.707
           YIL152W
          Length = 182

 Score = 41.2 bits (95), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 43/147 (29%), Positives = 66/147 (44%), Gaps = 21/147 (14%)

Query: 152 NSTSTDGRTGGTKFTGSSNVQRYL---------HPEFSASLSK-DSMLFRLQKSLCDFNT 201
           NS  T GRT       +S V++           H       +K  S+   LQKSL D N 
Sbjct: 38  NSKETQGRTQVITILNNSEVKKMTFARHWNERPHLNLLDECNKPVSLAISLQKSLWDLNA 97

Query: 202 VYKLSSHVSKPNYDIVLTVDCTQQLSPDELLVI-SSECAHAIVLHR---FKNKAFPR-TE 256
           +  +S +  K  YD+++ V   ++LS  E+L+I S++ A   +LH+   F+  +    T 
Sbjct: 98  LVTVSKNNKK--YDLLIKVASARRLSSTEMLIIPSTDEAMRYILHKPLTFRTNSVDNFTG 155

Query: 257 KHRVLKLHLDSRSEIELYPGLYWYSNW 283
            H    L L+S+    L   L W  NW
Sbjct: 156 AH----LALNSKISFRLDDTLIWCLNW 178

>TPHA0E00180 Chr5 (19852..20349) [498 bp, 165 aa] {ON} Anc_5.707
           YIL152W
          Length = 165

 Score = 35.4 bits (80), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 25/96 (26%), Positives = 47/96 (48%), Gaps = 4/96 (4%)

Query: 192 LQKSLCDFNTVYKLSSHVSKPNYDIVLTVDCTQQLSPDELLVISSECAHAIVLHRFKNKA 251
           L+ S+  FN + K SS+     YD +  ++  ++LS +E +V + +    I+    KN  
Sbjct: 62  LRLSINKFNMLLKASSN----KYDEIHDINSIEKLSQNEFIVTTIDSKTLILHSNEKNVV 117

Query: 252 FPRTEKHRVLKLHLDSRSEIELYPGLYWYSNWYFAD 287
                  +  ++ ++S+  + LY  L WY +W F D
Sbjct: 118 NSNNYTLKYQQVAINSKYYLSLYNDLNWYLDWKFYD 153

>Suva_9.36 Chr9 (51248..51922) [675 bp, 224 aa] {ON} YIL152W (REAL)
          Length = 224

 Score = 35.4 bits (80), Expect = 0.098,   Method: Compositional matrix adjust.
 Identities = 31/103 (30%), Positives = 49/103 (47%), Gaps = 10/103 (9%)

Query: 188 MLFRLQKSLCDFNTVYKLSSHVSKPNYD-IVLTVDCTQQLSPDELLVISSECAHAIVLHR 246
           ++ +L  S+ D +T+ +      KP +D I+  +  T  LSP+ELL I       I+LH 
Sbjct: 126 LVSQLHSSVKDLDTIVQ----THKPRFDTIIHDLSHTTILSPNELL-IKLHTEDTIILHS 180

Query: 247 ---FKNKAFPRTEKHRV-LKLHLDSRSEIELYPGLYWYSNWYF 285
                N  + R +       L +DSRS + L   + WY +W F
Sbjct: 181 RTPIINAEWLRNKVSNAGASLVIDSRSFLILCSNIKWYLHWKF 223

>Kwal_55.19675 s55 (74607..75305) [699 bp, 232 aa] {ON} [contig 159]
           FULL
          Length = 232

 Score = 33.5 bits (75), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 35/107 (32%), Positives = 51/107 (47%), Gaps = 9/107 (8%)

Query: 187 SMLFRLQKSLCDFNTVYKLSSH-VSKPNYDIVLTVDCTQQLSPDELLVI--SSECAHAIV 243
           +++  L K +    T ++L  H V+   YD  L V   + LSP E L +  SS     ++
Sbjct: 114 ALIRHLFKCVNSLETSWRLQRHGVATHQYDRRLRVQYFKSLSPTEDLAVASSSTGQEILI 173

Query: 244 LHR--FKNKAFPRTEKHRVLKLHLDSRSEIELYPGLYWYSNWYFADA 288
           LHR   ++    R       +L LDS S + LYPGL WY  W   +A
Sbjct: 174 LHRTSLRDSISLRAGS----ELMLDSSSSLLLYPGLRWYFQWQAVNA 216

>AER371C Chr5 complement(1323406..1324698) [1293 bp, 430 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL122W
           (POG1)
          Length = 430

 Score = 31.6 bits (70), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 23/47 (48%), Gaps = 3/47 (6%)

Query: 138 ATFDAILQSSIAGGNSTSTDGRTGG---TKFTGSSNVQRYLHPEFSA 181
            TFD +LQSS A G   S  G  GG   T+  G    ++ L P F A
Sbjct: 124 GTFDKLLQSSTAVGGGGSILGSDGGCTDTEALGHDRKRKKLEPRFPA 170

>YIL152W Chr9 (56545..57252) [708 bp, 235 aa] {ON} Putative protein
           of unknown function
          Length = 235

 Score = 30.0 bits (66), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 29/104 (27%), Positives = 49/104 (47%), Gaps = 12/104 (11%)

Query: 188 MLFRLQKSLCDFNTVYKLSSHVSKPNYDIVLTVDCTQQ--LSPDELLVISSECAHAIVLH 245
           ++ +L  S+ D + + +      KP +D ++  D +Q   LS +ELL I       I+LH
Sbjct: 137 LVSQLHSSVKDLDAIIQ----THKPKFDTIIR-DFSQATILSSNELL-IKLPKDQTIILH 190

Query: 246 RFKNKAFPRTEKHRV----LKLHLDSRSEIELYPGLYWYSNWYF 285
               K      +++V      L +DSRS + L   + WY +W F
Sbjct: 191 SRAPKINAEWLQNKVNDPSASLVIDSRSFLTLCNNIKWYLHWKF 234

>NCAS0E00340 Chr5 (56429..57307) [879 bp, 292 aa] {ON} Anc_3.553
           YGL232W
          Length = 292

 Score = 30.0 bits (66), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 30/67 (44%), Gaps = 16/67 (23%)

Query: 172 QRYLHPEFSASLSKDSMLFRLQKSLCDFNTV----------------YKLSSHVSKPNYD 215
           QR L P F    S+D + F ++ +  +FNT+                 KL+  V   NYD
Sbjct: 180 QRILAPHFHGEHSEDGLKFAVEVTRRNFNTIPKMDIINQVVKEVTEKGKLNHKVDLKNYD 239

Query: 216 IVLTVDC 222
            ++ V+C
Sbjct: 240 KLVLVEC 246

>ADR317C Chr4 complement(1263080..1265539) [2460 bp, 819 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL028C
           (MPS1)
          Length = 819

 Score = 30.4 bits (67), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 25/40 (62%), Gaps = 1/40 (2%)

Query: 146 SSIAGGNSTSTDGRTGGTKFTGSSNVQRYLHPEFSASLSK 185
           +S+ GGN+T+T G T  + FTG+ N +   H    +S+SK
Sbjct: 73  TSLQGGNATATSGHTKPSTFTGTMNTEDS-HSTLFSSMSK 111

>KAFR0A05120 Chr1 (1015307..1019746) [4440 bp, 1479 aa] {ON} Anc_6.29
            YOL004W
          Length = 1479

 Score = 30.0 bits (66), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 25/95 (26%), Positives = 45/95 (47%), Gaps = 15/95 (15%)

Query: 139  TFDAILQSSIAGGNSTSTDGRTGGTKFTGSSNVQRYLHPE--FSASLSKDSMLFRLQKSL 196
            T D ++Q+ +  G++  TD +T        + V +    +   SA+ +KD +L+RLQ   
Sbjct: 1222 TVDKVVQALVKHGHTLMTDYKT--------TEVMKLFEKDRLSSATSAKDQILYRLQARS 1273

Query: 197  CDFNTVYKLSSHVSKPNYDIVLTVDCTQQLSPDEL 231
               NT Y      +K + +I     C Q ++ D+L
Sbjct: 1274 HMSNTEYMFRIEYNKDDRNI-----CIQYIALDDL 1303

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.127    0.372 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 28,219,708
Number of extensions: 1080286
Number of successful extensions: 3214
Number of sequences better than 10.0: 23
Number of HSP's gapped: 3284
Number of HSP's successfully gapped: 23
Length of query: 290
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 182
Effective length of database: 41,097,471
Effective search space: 7479739722
Effective search space used: 7479739722
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 65 (29.6 bits)