Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0E15004g5.706ON1196119658950.0
Kwal_55.196785.706ON1178118433070.0
KLTH0E00968g5.706ON1148119832990.0
ZYRO0B16412g5.706ON137298929860.0
AFR290W5.706ON121797229370.0
TDEL0B021405.706ON1147118928480.0
Ecym_40155.706ON125798228130.0
KLLA0A00528g5.706ON122996227160.0
KNAG0C066305.706ON1281100726920.0
KAFR0H001805.706ON124198626500.0
Kpol_1043.735.706ON126098725920.0
Smik_11.3605.706ON118097925820.0
Suva_11.3335.706ON118797825590.0
Skud_11.3365.706ON118897825390.0
CAGL0G02541g5.706ON129596525360.0
YKR096W5.706ON119597925060.0
NCAS0A031705.706ON1319104924670.0
TPHA0E001905.706ON1361102123990.0
CAGL0H06611g5.706ON1282116923690.0
Suva_9.375.706ON111797523240.0
YIL151C5.706ON111897923200.0
Skud_9.175.706ON111897823100.0
Smik_9.185.706ON111897922860.0
NDAI0E050705.706ON155637512691e-150
TBLA0E017105.706ON152630010211e-116
TPHA0D046405.706ON9624602052e-15
Smik_12.4504.202ON736127840.31
NDAI0F013006.269ON156186772.5
KNAG0K019403.130ON79291754.5
NCAS0J018704.310ON2314121746.7
SAKL0H09328g8.570ON596118737.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0E15004g
         (1196 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0E15004g Chr5 (1246544..1250134) [3591 bp, 1196 aa] {ON} sim...  2275   0.0  
Kwal_55.19678 s55 complement(75394..78930) [3537 bp, 1178 aa] {O...  1278   0.0  
KLTH0E00968g Chr5 complement(92019..95465) [3447 bp, 1148 aa] {O...  1275   0.0  
ZYRO0B16412g Chr2 (1329195..1333313) [4119 bp, 1372 aa] {ON} sim...  1154   0.0  
AFR290W Chr6 (960776..964429) [3654 bp, 1217 aa] {ON} Syntenic h...  1135   0.0  
TDEL0B02140 Chr2 complement(380503..383946) [3444 bp, 1147 aa] {...  1101   0.0  
Ecym_4015 Chr4 complement(34835..38608) [3774 bp, 1257 aa] {ON} ...  1088   0.0  
KLLA0A00528g Chr1 complement(44587..48276) [3690 bp, 1229 aa] {O...  1050   0.0  
KNAG0C06630 Chr3 (1284481..1288326) [3846 bp, 1281 aa] {ON} Anc_...  1041   0.0  
KAFR0H00180 Chr8 complement(20661..24386) [3726 bp, 1241 aa] {ON...  1025   0.0  
Kpol_1043.73 s1043 (155026..158808) [3783 bp, 1260 aa] {ON} (155...  1003   0.0  
Smik_11.360 Chr11 (616879..620421) [3543 bp, 1180 aa] {ON} YIL15...   999   0.0  
Suva_11.333 Chr11 (611602..612061,612092..615195) [3564 bp, 1187...   990   0.0  
Skud_11.336 Chr11 (608311..608769,608800..608948,608994..611952)...   982   0.0  
CAGL0G02541g Chr7 (231428..235315) [3888 bp, 1295 aa] {ON} simil...   981   0.0  
YKR096W Chr11 (626793..630380) [3588 bp, 1195 aa] {ON} Protein o...   969   0.0  
NCAS0A03170 Chr1 complement(621400..625359) [3960 bp, 1319 aa] {...   954   0.0  
TPHA0E00190 Chr5 complement(20436..24521) [4086 bp, 1361 aa] {ON...   928   0.0  
CAGL0H06611g Chr8 (653472..657320) [3849 bp, 1282 aa] {ON} simil...   917   0.0  
Suva_9.37 Chr9 complement(51993..55343) [3351 bp, 1117 aa] {ON} ...   899   0.0  
YIL151C Chr9 complement(57338..60694) [3357 bp, 1118 aa] {ON} Pu...   898   0.0  
Skud_9.17 Chr9 complement(34389..37745) [3357 bp, 1118 aa] {ON} ...   894   0.0  
Smik_9.18 Chr9 complement(34956..38312) [3357 bp, 1118 aa] {ON} ...   885   0.0  
NDAI0E05070 Chr5 (1159816..1164486) [4671 bp, 1556 aa] {ON} Anc_...   493   e-150
TBLA0E01710 Chr5 complement(411712..416292) [4581 bp, 1526 aa] {...   397   e-116
TPHA0D04640 Chr4 (1012556..1015444) [2889 bp, 962 aa] {ON} Anc_5...    84   2e-15
Smik_12.450 Chr12 (788896..791106) [2211 bp, 736 aa] {ON} YLR362...    37   0.31 
NDAI0F01300 Chr6 complement(317724..322409) [4686 bp, 1561 aa] {...    34   2.5  
KNAG0K01940 Chr11 complement(389710..392088) [2379 bp, 792 aa] {...    33   4.5  
NCAS0J01870 Chr10 (352527..359471) [6945 bp, 2314 aa] {ON} Anc_4...    33   6.7  
SAKL0H09328g Chr8 (791744..793534) [1791 bp, 596 aa] {ON} simila...    33   7.0  

>SAKL0E15004g Chr5 (1246544..1250134) [3591 bp, 1196 aa] {ON} similar
            to uniprot|P36168 Saccharomyces cerevisiae YKR096W
            Hypothetical ORF
          Length = 1196

 Score = 2275 bits (5895), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1114/1196 (93%), Positives = 1114/1196 (93%)

Query: 1    MGDTTTTDYSTVAFTSPANSRIQMASHPTLHQKRHXXXXXXXXXXGYAKRRPNTLSQNVS 60
            MGDTTTTDYSTVAFTSPANSRIQMASHPTLHQKRH          GYAKRRPNTLSQNVS
Sbjct: 1    MGDTTTTDYSTVAFTSPANSRIQMASHPTLHQKRHNSNSYDYYDSGYAKRRPNTLSQNVS 60

Query: 61   QNDELAASAACFLDSNLTPSKHQECTPSSFQRATDETPQPFYPADTPQSPFYLPTTSSSN 120
            QNDELAASAACFLDSNLTPSKHQECTPSSFQRATDETPQPFYPADTPQSPFYLPTTSSSN
Sbjct: 61   QNDELAASAACFLDSNLTPSKHQECTPSSFQRATDETPQPFYPADTPQSPFYLPTTSSSN 120

Query: 121  LEAASKVITNDNSSVQLPDICIDNXXXXXXXXXXXXXXXVNHDDKKITRNAANGEQKESI 180
            LEAASKVITNDNSSVQLPDICIDN               VNHDDKKITRNAANGEQKESI
Sbjct: 121  LEAASKVITNDNSSVQLPDICIDNKQQPERRQQQRLEKRVNHDDKKITRNAANGEQKESI 180

Query: 181  TDELQGTDNTPHEQSSNTHADTNQQSDQHNXXXXXXXXXXXXXENNRENSGIPIVNVPPK 240
            TDELQGTDNTPHEQSSNTHADTNQQSDQHN             ENNRENSGIPIVNVPPK
Sbjct: 181  TDELQGTDNTPHEQSSNTHADTNQQSDQHNSVQQGSSGGSDDGENNRENSGIPIVNVPPK 240

Query: 241  HTSQALVQKLQDIYRSIVKQEIELQERCSQLTNSQTTDMKNLWVIYKVNAELINNYISFI 300
            HTSQALVQKLQDIYRSIVKQEIELQERCSQLTNSQTTDMKNLWVIYKVNAELINNYISFI
Sbjct: 241  HTSQALVQKLQDIYRSIVKQEIELQERCSQLTNSQTTDMKNLWVIYKVNAELINNYISFI 300

Query: 301  TTALLPSQPEQDLLIGQEIVEIYRVERRLWVYGTITFLDVLKNFSNFMDPEVCCQFISHV 360
            TTALLPSQPEQDLLIGQEIVEIYRVERRLWVYGTITFLDVLKNFSNFMDPEVCCQFISHV
Sbjct: 301  TTALLPSQPEQDLLIGQEIVEIYRVERRLWVYGTITFLDVLKNFSNFMDPEVCCQFISHV 360

Query: 361  FMSISNMLGDVPPRYSIPWLERLGDLSRMAIALYPSGFIDWKLSAEHWYSQALIYTYGHG 420
            FMSISNMLGDVPPRYSIPWLERLGDLSRMAIALYPSGFIDWKLSAEHWYSQALIYTYGHG
Sbjct: 361  FMSISNMLGDVPPRYSIPWLERLGDLSRMAIALYPSGFIDWKLSAEHWYSQALIYTYGHG 420

Query: 421  KLYYHMSTVQQNTLEAFVNLGKSVFCQDTFIPSQQYMQLVIDNIYQRAFAERSGGSSRNF 480
            KLYYHMSTVQQNTLEAFVNLGKSVFCQDTFIPSQQYMQLVIDNIYQRAFAERSGGSSRNF
Sbjct: 421  KLYYHMSTVQQNTLEAFVNLGKSVFCQDTFIPSQQYMQLVIDNIYQRAFAERSGGSSRNF 480

Query: 481  PIVEYLKHSEVMLLPSFLESPELQKVVLTFFQQRFGVWPNNVDFFDHKQIFIQDGEKLRY 540
            PIVEYLKHSEVMLLPSFLESPELQKVVLTFFQQRFGVWPNNVDFFDHKQIFIQDGEKLRY
Sbjct: 481  PIVEYLKHSEVMLLPSFLESPELQKVVLTFFQQRFGVWPNNVDFFDHKQIFIQDGEKLRY 540

Query: 541  FFSHAPAFAESHILQLVGFGDPRNPFAIXXXXXXXXXXXXXXXXXXXXXXXXXXXTNLDD 600
            FFSHAPAFAESHILQLVGFGDPRNPFAI                           TNLDD
Sbjct: 541  FFSHAPAFAESHILQLVGFGDPRNPFAILFELPKFLKERKERKERRRSKSSPPLPTNLDD 600

Query: 601  GNGSSSISVDHYFENIDSHRVPYSFPQDIQIWQQSLSYLNLTSMECSMSVLKKFXXXXXX 660
            GNGSSSISVDHYFENIDSHRVPYSFPQDIQIWQQSLSYLNLTSMECSMSVLKKF      
Sbjct: 601  GNGSSSISVDHYFENIDSHRVPYSFPQDIQIWQQSLSYLNLTSMECSMSVLKKFLHAPLL 660

Query: 661  XXXXXXXXXXXFLVSVAIRISSLSSDALKKFWLVFMRRIFPWNSLVSFLNTLMAFLLDNS 720
                       FLVSVAIRISSLSSDALKKFWLVFMRRIFPWNSLVSFLNTLMAFLLDNS
Sbjct: 661  TALPHLLPWAHFLVSVAIRISSLSSDALKKFWLVFMRRIFPWNSLVSFLNTLMAFLLDNS 720

Query: 721  RNMSSVEKLCEEYNKMDLHTLVEHFTNSEELPEVWKCWGTLWFDTISNKSELKASSVQST 780
            RNMSSVEKLCEEYNKMDLHTLVEHFTNSEELPEVWKCWGTLWFDTISNKSELKASSVQST
Sbjct: 721  RNMSSVEKLCEEYNKMDLHTLVEHFTNSEELPEVWKCWGTLWFDTISNKSELKASSVQST 780

Query: 781  GIRDHLFLDAPIDGICFDQDDESGLKFWKRACRVIFMFKGMAKEFHYGIRVSDTPISTRR 840
            GIRDHLFLDAPIDGICFDQDDESGLKFWKRACRVIFMFKGMAKEFHYGIRVSDTPISTRR
Sbjct: 781  GIRDHLFLDAPIDGICFDQDDESGLKFWKRACRVIFMFKGMAKEFHYGIRVSDTPISTRR 840

Query: 841  DVTTLHALKRFSFKFEELPQEWDNEVFLQSDNFIKVFEPISPINSNFEAVPSLSMIDGES 900
            DVTTLHALKRFSFKFEELPQEWDNEVFLQSDNFIKVFEPISPINSNFEAVPSLSMIDGES
Sbjct: 841  DVTTLHALKRFSFKFEELPQEWDNEVFLQSDNFIKVFEPISPINSNFEAVPSLSMIDGES 900

Query: 901  IFEFQGYRRMYPDYYCFNKNGDLITGSLYTSGLLERVAIQGGDDFNVKRHVENGVLLAAH 960
            IFEFQGYRRMYPDYYCFNKNGDLITGSLYTSGLLERVAIQGGDDFNVKRHVENGVLLAAH
Sbjct: 901  IFEFQGYRRMYPDYYCFNKNGDLITGSLYTSGLLERVAIQGGDDFNVKRHVENGVLLAAH 960

Query: 961  NSPVDCNERTPETMVEYAERKWLNMCMDPAFMESLRDSRFPHGDLACNADSNVTYFVLDA 1020
            NSPVDCNERTPETMVEYAERKWLNMCMDPAFMESLRDSRFPHGDLACNADSNVTYFVLDA
Sbjct: 961  NSPVDCNERTPETMVEYAERKWLNMCMDPAFMESLRDSRFPHGDLACNADSNVTYFVLDA 1020

Query: 1021 TSWLRHFAHVYKLATNNVLKFAICLTTFQELRFLRKSKDESVVEAATRAVITARQLYYER 1080
            TSWLRHFAHVYKLATNNVLKFAICLTTFQELRFLRKSKDESVVEAATRAVITARQLYYER
Sbjct: 1021 TSWLRHFAHVYKLATNNVLKFAICLTTFQELRFLRKSKDESVVEAATRAVITARQLYYER 1080

Query: 1081 KLLPLRFTGNIATHLEEHLEFEEQITWRSHVDEFVIEAVYKSQRKFKGLNLQARDQGQEY 1140
            KLLPLRFTGNIATHLEEHLEFEEQITWRSHVDEFVIEAVYKSQRKFKGLNLQARDQGQEY
Sbjct: 1081 KLLPLRFTGNIATHLEEHLEFEEQITWRSHVDEFVIEAVYKSQRKFKGLNLQARDQGQEY 1140

Query: 1141 IPTDPKDDDKFNFVVLVTDDLNMRTKAEAHDIHIFSSRFMFAFCNQLGYNQKVCIN 1196
            IPTDPKDDDKFNFVVLVTDDLNMRTKAEAHDIHIFSSRFMFAFCNQLGYNQKVCIN
Sbjct: 1141 IPTDPKDDDKFNFVVLVTDDLNMRTKAEAHDIHIFSSRFMFAFCNQLGYNQKVCIN 1196

>Kwal_55.19678 s55 complement(75394..78930) [3537 bp, 1178 aa] {ON}
            YKR096W - Hypothetical ORF [contig 159] FULL
          Length = 1178

 Score = 1278 bits (3307), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 671/1184 (56%), Positives = 823/1184 (69%), Gaps = 41/1184 (3%)

Query: 29   TLHQKRHXXXXXXXXXXGYAKRRPNTLSQNVSQNDELAASAACFLDSNLTPSKHQECTPS 88
            T+ QKR           G +KRR   +   VS     AA+AA FLD   +P + +E TP+
Sbjct: 20   TVQQKRQHSRSYEYMGSGVSKRR---VGSGVS--GTTAAAAASFLDCEGSPLRRREVTPT 74

Query: 89   SFQRATDETPQPFYPADTPQSPFYLPTTSSSNLEAASKVITNDNSSVQLPDICIDNXXXX 148
              +  T   P     AD   SP YLPTTSSSNLEAA  V  N+N SV  PDICI+     
Sbjct: 75   LGRGPTIGMPHSVMSADNAYSPSYLPTTSSSNLEAA--VTENENGSVNFPDICIERQRTD 132

Query: 149  XXXXXXXXXXXVNHDDKKITRNAANGEQKESITDELQGTDN---------------TPHE 193
                        N   +  +  + +  Q  ++ + +QG  +               TP  
Sbjct: 133  PHSVRYTRTEQGN--VRPQSHESLSNHQHHTLPNSIQGGSSSAGLPTGDQDFREGSTPEN 190

Query: 194  QS-SNTHADTNQQSDQHNXXXXXXXXXXXXXENNRENSGIPIVNVPPKHTSQALVQKLQD 252
             S S+ H   + Q  +                NN  N     V+     TSQALVQKLQD
Sbjct: 191  SSRSSRHGPHDNQESKGYANSDERSNNNHENNNNNPNENSQAVSPSSSPTSQALVQKLQD 250

Query: 253  IYRSIVKQEIELQERCSQLTNSQTTDMKNLWVIYKVNAELINNYISFITTALLPSQPEQD 312
            IYR+IVKQE+ELQERC+QLT SQTTD+KNLW+IYK+N ELINNY++FITTALLPSQPEQD
Sbjct: 251  IYRNIVKQEVELQERCAQLTTSQTTDLKNLWIIYKINIELINNYVAFITTALLPSQPEQD 310

Query: 313  LLIGQEIVEIYRVERRLWVYGTITFLDVLKNFSNFMDPEVCCQFISHVFMSISNMLGDVP 372
            LLIGQEIV IYR+ERRLWV+GTITFLDVLKNFSNFMDPEVCCQFI+HVF+SIS MLGD+P
Sbjct: 311  LLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFMDPEVCCQFITHVFISISTMLGDMP 370

Query: 373  PRYSIPWLERLGDLSRMAIALYPSGFIDWKLSAEHWYSQALIYTYGHGKLYYHMSTVQQN 432
             ++S PW ERLGDLSRMAIALYPSGFIDWKLSAEHWYSQAL + +GHGKLYYHMSTVQQN
Sbjct: 371  QKFSTPWFERLGDLSRMAIALYPSGFIDWKLSAEHWYSQALSHIFGHGKLYYHMSTVQQN 430

Query: 433  TLEAFVNLGKSVFCQDTFIPSQQYMQLVIDNIYQRAFAERSGGSSRNFPIVEYLKHSEVM 492
            TLEAFVNLGKSVFC+DTFIPS QYMQLVIDNIYQRAFAER+GG+ RN  +VEYLKHSEVM
Sbjct: 431  TLEAFVNLGKSVFCRDTFIPSPQYMQLVIDNIYQRAFAERNGGNHRNSLMVEYLKHSEVM 490

Query: 493  LLPSFLESPELQKVVLTFFQQRFGVWPNNVDFFDHKQIFIQDGEKLRYFFSHAPAFAESH 552
            LL SFLESPELQKVVL+FFQ +FGV  +N DFF+ + +F+QDGE+++YFF HAPAFAESH
Sbjct: 491  LLSSFLESPELQKVVLSFFQHKFGVSTSNTDFFNPRDMFLQDGERVKYFFRHAPAFAESH 550

Query: 553  ILQLVGFGDPRNPFAIXXXXXXXXXXXXXXXXXXXXXXXXXXXTNLDDGNGSSSISVDHY 612
            ILQ VGFGDP+NPFA+                           T+++    +S +S   Y
Sbjct: 551  ILQTVGFGDPKNPFALLFELPKFLKERKERKERRKSKSSHSF-TSIET---TSHLSPSEY 606

Query: 613  FENIDSHRVPYSFPQDIQIWQQSLSYLNLTSMECSMSVLKKFXXXXXXXXXXXXXXXXXF 672
             EN+DS R  Y FP+D+ IW++SLS++N+TS  CS  V +KF                 F
Sbjct: 607  LENVDSPRYAYEFPEDLAIWRESLSHINITSARCSSIVFQKFLRGPLVVAVTHMLPWSYF 666

Query: 673  LVSVAIRISSLSSDALKKFWLVFMRRIFPWNSLVSFLNTLMAFLLDNSRNMSSVEKLCEE 732
            L+S+A++I SL S  LK FW+  +R+IFPWNS+V FLN LMAF+LDN+   S ++ LCE+
Sbjct: 667  LLSLALKIDSLPSVELKSFWITLVRQIFPWNSIVDFLNMLMAFVLDNNWKTSPIDTLCEQ 726

Query: 733  YNKMDLHTLVEHFTNSEELPEVWKCWGTLWFDTISNKSELKASSVQSTGIRDHLFLDAPI 792
             + +D  +LVEHF+  E+LPE+W+CWG LWFD I++KS  +   V ++G +DH F D P 
Sbjct: 727  LDSVDARSLVEHFSEHEDLPEIWRCWGALWFDVIADKSNGEDGDVINSGSKDHPFWDLPG 786

Query: 793  DGICFDQDDESGLKFWKRACRVIFMFKGMAKEFHYGIRVSDTPISTRRDVTTLHALKRFS 852
            DGICFD+DDE G KFWKRACR+IF+FKG+A+EF  G+ +S     +RR +T  H L+ FS
Sbjct: 787  DGICFDEDDEVGEKFWKRACRLIFIFKGIAQEFSLGLTLSAFAPQSRRPMTAGHPLQNFS 846

Query: 853  FKFEELPQEWDNEVFLQSDNFIKVFEPISPINSNFEAVPSLSMIDGESIFEFQGYRRMYP 912
            F FEE+P +   + F++  N I +FE I+  N +    P  SM++GESIF+F GYR+MY 
Sbjct: 847  FNFEEIPAQSQIQSFVR--NQIPLFEEIATGNLDPNIRPGQSMLEGESIFDFPGYRQMYA 904

Query: 913  DYYCFNKNGDLITGSLYTSGLLERVAIQGGDDFNVKRHVENGVLLAAHNSPVDCNERTPE 972
            DY CFNK+G LI+ SLYTSG LER  IQGGDDFN +R+  +       N P    E    
Sbjct: 905  DYTCFNKSGSLISCSLYTSGKLERGPIQGGDDFNTERYGRS----EDSNKP----ENAQI 956

Query: 973  TMVEYAERKWLNMCMDPAFMESLRDSRFPHGDLACNADSNVTYFVLDATSWLRHFAHVYK 1032
            T +E  ER WL+ CM+P F+E   + +FP GDL+CN DS V+YFVLDATSWLRHFAHV+K
Sbjct: 957  TELERLERDWLDNCMNPEFIEQAYEMKFPFGDLSCNCDSGVSYFVLDATSWLRHFAHVFK 1016

Query: 1033 LATNNVLKFAICLTTFQELRFLRKSKDESVVEAATRAVITARQLYYERKLLPLRFTGNIA 1092
            LATNNVL+F ICLTTFQELRFLRKSKDESVVEAATRAVIT RQLY ++KLLPLRFTGN+A
Sbjct: 1017 LATNNVLRFGICLTTFQELRFLRKSKDESVVEAATRAVITVRQLYSDKKLLPLRFTGNVA 1076

Query: 1093 THLEEHLEFEEQITWRSHVDEFVIEAVYKSQRKFKGLNLQARDQGQEYIPTDPKDDDKFN 1152
            THLEEHLEFEEQITWRSHVDEFVIEAVYK+Q+KF+ +N QA++ G ++I T   D++ F+
Sbjct: 1077 THLEEHLEFEEQITWRSHVDEFVIEAVYKAQKKFEAINAQAKEAGHDFIAT--TDEEPFH 1134

Query: 1153 FVVLVTDDLNMRTKAEAHDIHIFSSRFMFAFCNQLGYNQKVCIN 1196
            FV LV+DD NMR KA    I  FS+RFMFA CNQ+G   + C N
Sbjct: 1135 FVALVSDDTNMRVKAHTQRIQTFSTRFMFAVCNQIGLAHQACTN 1178

>KLTH0E00968g Chr5 complement(92019..95465) [3447 bp, 1148 aa] {ON}
            similar to uniprot|P36168 Saccharomyces cerevisiae
            YKR096W Hypothetical ORF
          Length = 1148

 Score = 1275 bits (3299), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 661/1198 (55%), Positives = 824/1198 (68%), Gaps = 82/1198 (6%)

Query: 20   SRIQMASHPTLHQKRHXXXXXXXXXXGYAKRRPNTLSQNVSQNDELAASAACFLDSNLTP 79
            S + + + P   QKR           G  KRR   L   +S     AA+AA FLDS  +P
Sbjct: 12   SGVNVEASPA-QQKRQHSRSCDYMGSGVNKRR---LGSGIS--GAAAAAAALFLDSGGSP 65

Query: 80   SKHQECTPSSFQRATDETPQPFYPADTPQSPFYLPTTSSSNLEAASKVITNDNSSVQLPD 139
             + ++                       QSP Y+PTTSSSNLEAA+  + N+NSSV+L D
Sbjct: 66   VRRKDA----------------------QSPSYMPTTSSSNLEAAA--VENENSSVRLSD 101

Query: 140  ICIDNXXXXXXXXXXXXXXXVNHDDKKITRNAANGEQKESITDELQGTDNTPHEQSSNTH 199
            ICID                 +H+ K    + A+  Q ++ ++ +Q     P   + N  
Sbjct: 102  ICID----------PRMDSSADHNCKMRGCDLASKNQHQTFSNCIQTASAVPGAPAGNAP 151

Query: 200  ADTNQQSDQHNXXXXXXXXXXXXXENNRENSGI---------------------PIVNVP 238
            A +     +H+                  + G+                     P     
Sbjct: 152  AYS-----EHSVPNNAAQTESGEARAPVNSGGLTGRNDRGNDHDNNNNNPNENTPAAGQT 206

Query: 239  PKHTSQALVQKLQDIYRSIVKQEIELQERCSQLTNSQTTDMKNLWVIYKVNAELINNYIS 298
               TSQALVQKLQDIYR+IVKQE+ELQERCSQLT+SQTTD+KNLW+IYKVN ELINNY++
Sbjct: 207  SSQTSQALVQKLQDIYRNIVKQEVELQERCSQLTHSQTTDLKNLWIIYKVNTELINNYVA 266

Query: 299  FITTALLPSQPEQDLLIGQEIVEIYRVERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIS 358
            FITTALLPSQPEQDLLIGQEIV IYR+ERRLWV+GTITFLDVLKNFSNFMDPEVCCQFI+
Sbjct: 267  FITTALLPSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFMDPEVCCQFIT 326

Query: 359  HVFMSISNMLGDVPPRYSIPWLERLGDLSRMAIALYPSGFIDWKLSAEHWYSQALIYTYG 418
            HVF+SISNMLGD+P +++ PWLERLGDLSRMAIALYPSGFIDWKLSAEHWY+QAL + +G
Sbjct: 327  HVFISISNMLGDMPQKFATPWLERLGDLSRMAIALYPSGFIDWKLSAEHWYTQALSHIFG 386

Query: 419  HGKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFIPSQQYMQLVIDNIYQRAFAERSGGSSR 478
            HGKLYYHMSTVQQNTLEAFVNLGKSVFC+DTFIPSQQYMQLVIDNIYQRAFAER+GG+ R
Sbjct: 387  HGKLYYHMSTVQQNTLEAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAERNGGNQR 446

Query: 479  NFPIVEYLKHSEVMLLPSFLESPELQKVVLTFFQQRFGVWPNNVDFFDHKQIFIQDGEKL 538
            N  +VEYLKHSEVMLL SFLESPELQKVVL+FFQ +FG+  NN D+F H+ IF+QDGE+ 
Sbjct: 447  NSLMVEYLKHSEVMLLSSFLESPELQKVVLSFFQNKFGISSNNTDYFSHQAIFLQDGERT 506

Query: 539  RYFFSHAPAFAESHILQLVGFGDPRNPFAIXXXXXXXXXXXXXXXXXXXXXXXXXXXTNL 598
            +YFF HAPAFAESHILQ+VGFG+P+NPFA+                           T++
Sbjct: 507  KYFFRHAPAFAESHILQMVGFGNPKNPFALLFELPKFLKERKERKERRKSKSSNSF-TSM 565

Query: 599  DDGNGSSSISVDHYFENIDSHRVPYSFPQDIQIWQQSLSYLNLTSMECSMSVLKKFXXXX 658
            +  + +S I    Y E++DS R  Y FP D+ IWQQSLS++N TS++CS  VL+KF    
Sbjct: 566  EAPSPTSPI---EYLESVDSPRFVYEFPTDLAIWQQSLSHINTTSIKCSAVVLQKFLHGP 622

Query: 659  XXXXXXXXXXXXXFLVSVAIRISSLSSDALKKFWLVFMRRIFPWNSLVSFLNTLMAFLLD 718
                         FL+S+AIRI  L S  LK FW+   R++FPWNS+V+FLN ++AF LD
Sbjct: 623  LVSAAAHLLPWAYFLLSLAIRIDELPSPELKDFWIALCRQVFPWNSIVNFLNMIIAFALD 682

Query: 719  NSRNMSSVEKLCEEYNKMDLHTLVEHFTNSEELPEVWKCWGTLWFDTISNKSELKASSVQ 778
            N+   SS++ LCE+++ +D+ TLV+HF+ +E+LPEVWKCWG LWFD IS+KS++      
Sbjct: 683  NAWKTSSIDNLCEQFDSVDVRTLVDHFSQNEDLPEVWKCWGALWFDVISDKSDVVDEGAT 742

Query: 779  STGIRDHLFLDAPIDGICFDQDDESGLKFWKRACRVIFMFKGMAKEFHYGIRVSDTPIST 838
               ++DH+F D P+DGICFD+DDE+G +FWKRACR++F+FKG+A+EF+ G+ ++  P+ +
Sbjct: 743  YNSVQDHMFGDMPVDGICFDEDDETGSRFWKRACRLVFIFKGIAQEFNMGLTLASVPLQS 802

Query: 839  RRDVTTLHALKRFSFKFEELPQEWDNEVFLQSDNFIKVFEPISPINSNFEAVPSLSMIDG 898
            RR +   H L+ F FKFE+ P   D+E +      +  FE IS  N +  A P  SM++G
Sbjct: 803  RRSLAAGHPLQNFCFKFEDPPV--DSESYALISTQMPAFENISERNLDPNAPPGQSMLEG 860

Query: 899  ESIFEFQGYRRMYPDYYCFNKNGDLITGSLYTSGLLERVAIQGGDDFNVKRHVENGVLLA 958
            +S+FE  GYR+++ D+ CFNK G LIT SLYTSG LE+  I GGDDFN +R+  +  L  
Sbjct: 861  KSLFELPGYRQLHADHTCFNKTGTLITCSLYTSGSLEKGPIHGGDDFNTERYSRSDELNK 920

Query: 959  AHNSPVDCNERTPETMVEYAERKWLNMCMDPAFMESLRDSRFPHGDLACNADSNVTYFVL 1018
            A N  +          ++  ER WL+ CM+P F+E   D +FP GDL+CN DS V+YFV 
Sbjct: 921  ADNPQIK--------ELDKMERMWLDTCMNPEFIEQTYDMKFPFGDLSCNCDSGVSYFVP 972

Query: 1019 DATSWLRHFAHVYKLATNNVLKFAICLTTFQELRFLRKSKDESVVEAATRAVITARQLYY 1078
            DATSWLRHFAHVYKLATN VL+FAICLTTFQELRFLRKSKDESVVEAATRAVIT RQLY 
Sbjct: 973  DATSWLRHFAHVYKLATNGVLRFAICLTTFQELRFLRKSKDESVVEAATRAVITVRQLYS 1032

Query: 1079 ERKLLPLRFTGNIATHLEEHLEFEEQITWRSHVDEFVIEAVYKSQRKFKGLNLQARDQGQ 1138
            E++LLPLRFTGN+ATHLEEHLEFEEQITWRSHVDEFVIEAVYK+Q KF+ LN QA++ G 
Sbjct: 1033 EKRLLPLRFTGNVATHLEEHLEFEEQITWRSHVDEFVIEAVYKAQNKFEALNAQAKEGGH 1092

Query: 1139 EYIPTDPKDDDKFNFVVLVTDDLNMRTKAEAHDIHIFSSRFMFAFCNQLGYNQKVCIN 1196
            ++IPT   +++ F+F+ LV+DD NMR KA A  I  FSSRFMFA CNQ+G     C N
Sbjct: 1093 DFIPT--TEEEPFHFIALVSDDTNMRLKAHAQRIRTFSSRFMFAVCNQIGLAHHACTN 1148

>ZYRO0B16412g Chr2 (1329195..1333313) [4119 bp, 1372 aa] {ON} similar
            to uniprot|P36168 Saccharomyces cerevisiae YKR096W
            Hypothetical ORF
          Length = 1372

 Score = 1154 bits (2986), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 567/989 (57%), Positives = 712/989 (71%), Gaps = 37/989 (3%)

Query: 229  NSGIPIVNVPPKHTSQALVQKLQDIYRSIVKQEIELQERCSQLTNSQTTDMKNLWVIYKV 288
            N  +P V VP K +SQALVQKLQDIY+ IVKQEIELQERCSQLT SQTT++KNLW IYK+
Sbjct: 400  NRAVPSVVVPSKRSSQALVQKLQDIYKVIVKQEIELQERCSQLTTSQTTELKNLWTIYKI 459

Query: 289  NAELINNYISFITTALLPSQPEQDLLIGQEIVEIYRVERRLWVYGTITFLDVLKNFSNFM 348
            N++LINNY++F+TTALLPSQ EQD+LIG+EIVEIYR+ERRLWVYGTITFLD+ KNFSNFM
Sbjct: 460  NSDLINNYVTFLTTALLPSQTEQDILIGEEIVEIYRIERRLWVYGTITFLDIFKNFSNFM 519

Query: 349  DPEVCCQFISHVFMSISNMLGDVPPRYSIPWLERLGDLSRMAIALYPSGFIDWKLSAEHW 408
            DPEVCCQFI+HVF+SISNMLGD+PP+Y IPWL+RLGDLSRMAIALYPSGFIDWKLSAEHW
Sbjct: 520  DPEVCCQFITHVFISISNMLGDIPPKYGIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHW 579

Query: 409  YSQALIYTYGHGKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFIPSQQYMQLVIDNIYQRA 468
            Y +A+ +TY HGKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFIPSQQYMQLVIDNIYQRA
Sbjct: 580  YMEAMKFTYSHGKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFIPSQQYMQLVIDNIYQRA 639

Query: 469  FAERSGGSSRNFPIVEYLKHSEVMLLPSFLESPELQKVVLTFFQQRFGVWPNNVDFFDHK 528
            F ER+ G+ RN  ++EYLKHSEVMLLPSFLES +LQ+VVL +F+ +FG   NNV+ FD +
Sbjct: 640  FVERNNGNHRNTQLIEYLKHSEVMLLPSFLESADLQQVVLIYFKAKFGCDSNNVNIFDTR 699

Query: 529  QIFIQDGEKLRYFFSHAPAFAESHILQLVGFGDPRNPFAIX-------XXXXXXXXXXXX 581
            ++F Q+ + LRYFF HAPAFAESHILQLVGFGDP+NPFA+                    
Sbjct: 700  KMFCQNPDYLRYFFRHAPAFAESHILQLVGFGDPKNPFALLFELPRFLKDRKDKKEKRRT 759

Query: 582  XXXXXXXXXXXXXXTNLDDGNGSSSISVDHYFENIDSHRVPYSFPQDIQIWQQSLSYLNL 641
                           +L+D       + + +F NI++ R PYS P +++IW +SL+Y+N+
Sbjct: 760  KSTTVTETSSTMAIDDLEDEQSDRMSTPEGFFGNIETLRFPYSVPSNLEIWNESLNYINM 819

Query: 642  TSMECSMSVLKKFXXXXXXXXXXXXXXXXXFLVSVAIRISSLSSDALKKFWLVFMRRIFP 701
            TS++CSM VL+KF                 F++S+A +I  L+ ++ +KFW+ F+ RIFP
Sbjct: 820  TSLKCSMVVLQKFLKGPLVVALPHFMPWTYFIISLAYKIKDLNHESSRKFWVEFVDRIFP 879

Query: 702  WNSLVSFLNTLMAFLLDNSRNMSSVEKLCEEYNKMDLHTLVEHFTNSEELPEVWKCWGTL 761
            WN++VSFLN L+A++LDNS   S V+ LC +Y+ M L  L+++F N+E LPEVWKCWGTL
Sbjct: 880  WNTIVSFLNVLIAYMLDNSWKSSLVDSLCGQYSSMGLEDLLDYFNNNEVLPEVWKCWGTL 939

Query: 762  WFDTISNKSELKASSVQSTGIRDHLFLDAPIDGICFDQDDESGLKFWKRACRVIFMFKGM 821
            WFDTI NK +     ++S GI++H+FLDAPIDGI FD +DESG  FWKRACR+IF+FKG+
Sbjct: 940  WFDTICNKEQSHVEDLESVGIKNHMFLDAPIDGIAFDANDESGENFWKRACRIIFLFKGL 999

Query: 822  AKEFHYGIRVSDT-PISTRR-DVTTLHALKRFSFKFE-----EL-----PQEWDNEVFLQ 869
            A+ F  GI +S   P+  RR DV+  H LK FSFK       EL     PQ     + L 
Sbjct: 1000 AENFPIGITLSPVAPVYCRRNDVSPYHILKSFSFKLRRGSDSELVPMNPPQPSTTAIDLD 1059

Query: 870  S-DNFIKVFEPISPINSNFEAVPSLSMIDGESIFEFQGYRRMYPDYYCFNKNGDLITGSL 928
               N +++FE  S  N + + +P LS+I+GESIF++ GYRR++PDY+ ++KNG+ ++ SL
Sbjct: 1060 HLKNTLEIFEEASWENIHMDTIPMLSVIEGESIFDYAGYRRLHPDYFSYDKNGEFLSASL 1119

Query: 929  YTSGLLERVAIQGGDDFNVKRHVENGVLLAAHNSPVDCNERTPETMVEYAERKWLNMCMD 988
            YTS             +    +  N  ++ AH S VD      +++    E    N  M+
Sbjct: 1120 YTS-------------WYANNNTNNTGVIPAHGSDVDSQRDAVQSV---QEMHIFNQIME 1163

Query: 989  PAFMESLRDSRFPHGDLACNADSNVTYFVLDATSWLRHFAHVYKLATNNVLKFAICLTTF 1048
            P +     D  F    L   A S+ TYFVLD T+WLRHF H+YKLA++ VLKFAICLTTF
Sbjct: 1164 PGYCGGFADDLFLRDALYQTAHSSTTYFVLDTTTWLRHFGHIYKLASSGVLKFAICLTTF 1223

Query: 1049 QELRFLRKSKDESVVEAATRAVITARQLYYERKLLPLRFTGNIATHLEEHLEFEEQITWR 1108
             ELRFLRK KDE+VVEAATRA+IT RQLY E KLLPLRFTGN+ATH+EEHLEFEE+ITWR
Sbjct: 1224 HELRFLRKPKDENVVEAATRAIITVRQLYSEGKLLPLRFTGNVATHIEEHLEFEEKITWR 1283

Query: 1109 SHVDEFVIEAVYKSQRKFKGLNLQARDQGQEYIPTDPKDD-DKFNFVVLVTDDLNMRTKA 1167
            SHVDEFVIEAVYK+Q KF+ +N    +Q ++       DD     FVVLVTDD NMR KA
Sbjct: 1284 SHVDEFVIEAVYKAQSKFQEMNQLQLEQEEQQHQLRAHDDRSGLKFVVLVTDDSNMRKKA 1343

Query: 1168 EAHDIHIFSSRFMFAFCNQLGYNQKVCIN 1196
            +  D+  FS++F+F+ CN +G   K+C N
Sbjct: 1344 QDQDVRTFSTKFVFSLCNSIGLRSKICTN 1372

>AFR290W Chr6 (960776..964429) [3654 bp, 1217 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YIL151C and YKR096W
          Length = 1217

 Score = 1135 bits (2937), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 575/972 (59%), Positives = 711/972 (73%), Gaps = 32/972 (3%)

Query: 232  IPIVNVPPKHTSQALVQKLQDIYRSIVKQEIELQERCSQLTNSQTTDMKNLWVIYKVNAE 291
            +P V V  K +SQAL++KLQ+IYR+IV+QE ELQ+RCSQLT SQTTD+KNLW+IYKVNAE
Sbjct: 271  VPTVAVTAKQSSQALMEKLQEIYRNIVRQETELQQRCSQLTTSQTTDLKNLWIIYKVNAE 330

Query: 292  LINNYISFITTALLPSQPEQDLLIGQEIVEIYRVERRLWVYGTITFLDVLKNFSNFMDPE 351
            LI+NY  FITTALLP+QPE DLLIG+EI+E+YR+ERRLWVYGTITFLDVLKNFSNFMDPE
Sbjct: 331  LIDNYFMFITTALLPTQPEADLLIGKEIIEVYRIERRLWVYGTITFLDVLKNFSNFMDPE 390

Query: 352  VCCQFISHVFMSISNMLGDVPPRYSIPWLERLGDLSRMAIALYPSGFIDWKLSAEHWYSQ 411
            VCCQFI +VF+SISNMLGD+PP++SI WLERLGDLSRMAIALYPSGFIDWKLSAEHWY +
Sbjct: 391  VCCQFIIYVFISISNMLGDIPPKFSIIWLERLGDLSRMAIALYPSGFIDWKLSAEHWYHE 450

Query: 412  ALIYTYGHGKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFIPSQQYMQLVIDNIYQRAFAE 471
            AL YT+GHGKLYYHMSTVQQNTL AFVNLGKSVFC+DTFIPSQQYMQLVIDNIYQRAFAE
Sbjct: 451  ALKYTFGHGKLYYHMSTVQQNTLAAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAE 510

Query: 472  RSGGSSRNFPIVEYLKHSEVMLLPSFLESPELQKVVLTFFQQRFGVWPNNVDFFDHKQIF 531
            R+ G  RN  +VEYLKH+EVMLLPSFLES ELQ VVL FF+Q+FGV  +NVDFFD + +F
Sbjct: 511  RNSGHHRNAHLVEYLKHTEVMLLPSFLESSELQDVVLAFFEQKFGV-TSNVDFFDPRLVF 569

Query: 532  IQDGEKLRYFFSHAPAFAESHILQLVGFGDPRNPFAIXXX--XXXXXXXXXXXXXXXXXX 589
            +QD E+L++FF HA  +AESH+LQLVGFGDPRNPFA+                       
Sbjct: 570  VQDSERLKHFFRHASLYAESHLLQLVGFGDPRNPFALLFELPKHLKERKDRREKRKSKSS 629

Query: 590  XXXXXXTNLDDGNGSSSISVDHYFENIDSHRVPYSFPQDIQIWQQSLSYLNLTSMECSMS 649
                  T++DD    ++ S   +FE IDS +  Y FP DI IW++SLSY N+T+M+CSM 
Sbjct: 630  TSTQYDTSIDDDCAFAAPS--EFFETIDSTKYIYKFPDDINIWKESLSYANVTAMKCSMI 687

Query: 650  VLKKFXXXXXXXXXXXXXXXXXFLVSVAIRISSLSSDALKKFWLVFMRRIFPWNSLVSFL 709
            VL+KF                 FL +   R+ ++  D +++FW+  +R++FP+N++++FL
Sbjct: 688  VLRKFLHGPLLTALPHLLPWGYFLAATNSRVITIPQDEIRRFWVALVRQLFPFNTIITFL 747

Query: 710  NTLMAFLLDNSRNMSSVEKLCEEYNKMDLHTLVEHFTNSEELPEVWKCWGTLWFDTISNK 769
            N L+ ++ + ++     ++  E++  M L  LV +F  +EELPEVW+CWGTLWFD ++ K
Sbjct: 748  NVLLLYMNNQTQANFPFDEYFEQFIDMSLADLVGYFCENEELPEVWECWGTLWFDALNTK 807

Query: 770  SELKASSVQSTGIRDHLFLDAPIDGICFDQDDESGLKFWKRACRVIFMFKGMAKEFHYGI 829
                 + + STG++DH+F+D+PIDGI FD +DESG KFWKR  RVI +F+ +A E   G+
Sbjct: 808  HITNLTDINSTGVKDHMFMDSPIDGISFDHNDESGEKFWKRCARVILLFRALALECPVGL 867

Query: 830  RVSDTPISTRRDVTTLHALKRFSFKFEELPQEWDNEVFLQSDNFI-KVFEPISPINSNFE 888
            R     IS  R+  +L       FKFEE P EW  +++L+    +   FE ISP+N +  
Sbjct: 868  R----EISGGRNWRSL------VFKFEEPPSEW-CDMYLEPFTLVFDTFEQISPVNLDQR 916

Query: 889  AVPSLSMIDGESIFEFQGYRRMYPDYYCFNKNGDLITGSLYTSGLLERVAIQGGDDFNVK 948
            A P   M     I   QGYR + PDYYCFN+NGD+ITGSLYT G LE   I GGDDFN K
Sbjct: 917  ATPYCGMTPDIDIRTLQGYRILLPDYYCFNRNGDMITGSLYTIGTLESSGIHGGDDFNGK 976

Query: 949  RHVENGVLLAA----HNSPVDCNERTPETMVEYAERKWLNMCMDPAFMESLRDSRFPHGD 1004
            R +ENG L++     +NS +D  E+    M E+        C +    E +     P GD
Sbjct: 977  RLLENGELVSTERRDYNSLIDREEQ--PIMDEFLRH---THCKNDVRWEQM----LPRGD 1027

Query: 1005 LACNADSNVTYFVLDATSWLRHFAHVYKLATNNVLKFAICLTTFQELRFLRKSKDESVVE 1064
            L C AD++VTYFVLDAT+WLRHF HVYKLA NN+LKFAICLTTFQELRFLRKSKDESV+E
Sbjct: 1028 LHCFADTHVTYFVLDATTWLRHFGHVYKLAANNILKFAICLTTFQELRFLRKSKDESVLE 1087

Query: 1065 AATRAVITARQLYYERKLLPLRFTGNIATHLEEHLEFEEQITWRSHVDEFVIEAVYKSQR 1124
            AATRAVIT RQLYYERKLLPLRFTGN+A HLEEHLE EEQ+TWRSHVDEFVIEA++K+Q 
Sbjct: 1088 AATRAVITVRQLYYERKLLPLRFTGNVAGHLEEHLEIEEQMTWRSHVDEFVIEAIHKAQD 1147

Query: 1125 KFKGLNLQARDQGQEYIPTDPKDDDKFNFVVLVTDDLNMRTKAEAHDIHIFSSRFMFAFC 1184
            KF  LN  A+   ++ IPT    D +FNF+ LVTDDLNMR KA A +I  FS+RFMF+ C
Sbjct: 1148 KFNALNDDAKAASRDCIPTGA--DQRFNFIALVTDDLNMRNKAGAQNIKAFSTRFMFSVC 1205

Query: 1185 NQLGYNQKVCIN 1196
            N+LG+ + VC N
Sbjct: 1206 NELGHAKNVCTN 1217

 Score = 39.7 bits (91), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 20/30 (66%), Positives = 25/30 (83%), Gaps = 2/30 (6%)

Query: 107 PQSPFYLPTTSSSNLEAASKVITNDNSSVQ 136
           P SP YLPTTSSSNL+AA++ I  DNSS++
Sbjct: 59  PGSPSYLPTTSSSNLDAAARAI--DNSSLR 86

>TDEL0B02140 Chr2 complement(380503..383946) [3444 bp, 1147 aa] {ON}
            Anc_5.706 YIL151C
          Length = 1147

 Score = 1101 bits (2848), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 598/1189 (50%), Positives = 756/1189 (63%), Gaps = 111/1189 (9%)

Query: 32   QKRHXXXXXXXXXXGYAKRRPNTLSQNVSQNDELAASAACFLDSNL---TPSKHQECT-- 86
            QKRH             KRR       ++Q          FLD+     TP K    +  
Sbjct: 46   QKRHSSNPYNSAESTGVKRRVANHDDGITQ----------FLDNGAIPNTPCKEPVSSRR 95

Query: 87   PSSFQRATDETPQPF--YPADTPQSPF-YLPTTSSSNLEAASKVITNDNSSVQLPDICID 143
            PS+ +R  + TP+    Y AD   SP+ Y P  S+  ++  S+++  ++S V +P++C D
Sbjct: 96   PSATRRTVNRTPRSTTSYVADASASPYCYSPNNSNLRIDHLSRMV--NSSGVSIPNVCRD 153

Query: 144  NXXXXXXXXXXXXXXXVNHDDKKITRNAANGEQKESITDELQGTDNTPHEQSSNTHADTN 203
                               D   I+ N+  GE  +      Q  DN+ +++      D N
Sbjct: 154  PSFLSKEAHIVSD----GQDTGTISINS--GEVND------QSQDNSANDEGR----DDN 197

Query: 204  QQSDQHNXXXXXXXXXXXXXENNRENSGIPIVNVPPKHTSQALVQKLQDIYRSIVKQEIE 263
             ++D                 N   N  +P V VP K +SQALVQKLQDIY+ IVKQEIE
Sbjct: 198  NENDSIRNKNSNNDNDNNRENNKDNNGNVPSVVVPSKKSSQALVQKLQDIYKVIVKQEIE 257

Query: 264  LQERCSQLTNSQTTDMKNLWVIYKVNAELINNYISFITTALLPSQPEQDLLIGQEIVEIY 323
            LQERCSQLTNSQTT++K LWVIYKVN++LINNY++FITTALLP Q +QDL IGQEIVEIY
Sbjct: 258  LQERCSQLTNSQTTELKQLWVIYKVNSDLINNYVTFITTALLPPQSDQDLAIGQEIVEIY 317

Query: 324  RVERRLWVYGTITFLDVLKNFSNFMDPEVCCQFISHVFMSISNMLGDVPPRYSIPWLERL 383
            R+ERRLWVYGTITFLDVLKNFSNFMDPEVC QFI+HVF+SISNML D+P RY+IPW +RL
Sbjct: 318  RIERRLWVYGTITFLDVLKNFSNFMDPEVCAQFITHVFISISNMLADIPSRYAIPWYQRL 377

Query: 384  GDLSRMAIALYPSGFIDWKLSAEHWYSQALIYTYGHGKLYYHMSTVQQNTLEAFVNLGKS 443
            GDLSRMAIALYPSGFIDWKLSAEHWY +A+ Y YGHGKLYYHMSTVQQNTLEAFVNLGKS
Sbjct: 378  GDLSRMAIALYPSGFIDWKLSAEHWYMEAMKYIYGHGKLYYHMSTVQQNTLEAFVNLGKS 437

Query: 444  VFCQDTFIPSQQYMQLVIDNIYQRAFAERSGGSSRNFPIVEYLKHSEVMLLPSFLESPEL 503
            VFCQDTF PSQQYMQLVIDNIYQRAF ER+ G+ RN  ++EYLKHSEVMLLPSFLES +L
Sbjct: 438  VFCQDTFTPSQQYMQLVIDNIYQRAFVERNNGNHRNSQLIEYLKHSEVMLLPSFLESTDL 497

Query: 504  QKVVLTFFQQRFGVWPNNVDFFDHKQIFIQDGEKLRYFFSHAPAFAESHILQLVGFGDPR 563
            Q+VVL +F+ +FG+  N  + FD +Q+F Q+ ++L+YFF HAPAFAESHILQLVGFGDP+
Sbjct: 498  QQVVLIYFRDKFGMDTNENNIFDTRQMFDQNPDQLKYFFRHAPAFAESHILQLVGFGDPK 557

Query: 564  NPFAIXXXXXXXXXXXXXXXXXXXXXXXXXXXTN----LD-----DGNGSSSISVDHYFE 614
            NPFA+                           T+    +D     D + S    V  +F+
Sbjct: 558  NPFALLFELPRCLKDRRDKKEKRKTKSSVTTETSSAMAIDEEEYIDSSFSLGAQVQQFFD 617

Query: 615  NIDSHRVPYSFPQDIQIWQQSLSYLNLTSMECSMSVLKKFXXXXXXXXXXXXXXXXXFLV 674
            NIDS   PY FP  +++W  SL YLN+TS+ CSM VLKKF                 F++
Sbjct: 618  NIDSLTSPYLFPPSLEVWNCSLKYLNITSLHCSMIVLKKFLEGPMVVALPHLLPWAYFII 677

Query: 675  SVAIRISSLSSDALKKFWLVFMRRIFPWNSLVSFLNTLMAFLLDNSRNMSSVEKLCEEYN 734
            +V  ++  ++  A ++FWL  + RIFPWN++V+FLN L+A+ LDN      ++ LCEE +
Sbjct: 678  AVVSKVQHITDGASREFWLELVNRIFPWNTIVNFLNVLIAYTLDNIHPSLPIDPLCEELS 737

Query: 735  KMDLHTLVEHFTNSEELPEVWKCWGTLWFDTISNKSELKASSVQSTGIRDHLFLDAPIDG 794
             M L  LVEHF N+E+LPEVWKCWG LWFD I +K +++  S +S GI+DH+FLD PIDG
Sbjct: 738  TMGLDQLVEHFNNNEDLPEVWKCWGLLWFDAICDKDKVQMDSYESAGIKDHMFLDLPIDG 797

Query: 795  ICFDQDDESGLKFWKRACRVIFMFKGMAKEFHYGIRVSD-TPISTRRDVTTLHALKRFSF 853
            I FD+DDESG+KFWKRACRVIF+FK +A+ F   + VS    +  RR     H LK F F
Sbjct: 798  IGFDRDDESGIKFWKRACRVIFLFKRIAENFQTRLVVSSQAQVHCRRTDPMNHVLKSFCF 857

Query: 854  KFEELPQEWDNEVFLQSDNFIKVFEPISPINSNFEAVPSLSMIDGESIFEFQGYRRMYPD 913
            K  +    +++   LQ  N I+VFE  S  N + +  P LS+++ ESIF + GY+R+  D
Sbjct: 858  KLRD--TFYNSNSVLQ--NTIEVFEEGSDANKDMQMTPQLSVLENESIFGYVGYKRLLSD 913

Query: 914  YYCFNKNGDLITGSLYTSGLLERVAIQGGDDFNVKRHVENGVLLAAHNSPVDCNERTPET 973
              C+++ G+ ++ SLYTS          G++                 + +  +E T + 
Sbjct: 914  LSCYDRGGEFVSTSLYTS---------WGNE--------------TSKNEIPQSEPTQQQ 950

Query: 974  MVEYAERKWLNMCMDPAFMESLRDS------RFPHGDLACNADSNVTYFVLDATSWLRHF 1027
                A+           F+E +  S       FP     C  +   T+FVLDATSWLRHF
Sbjct: 951  TANEAD----------LFIEGINTSLTEFNIDFPE----CKMNGKDTFFVLDATSWLRHF 996

Query: 1028 AHVYKLATNNVLKFAICLTTFQELRFLRKSKDESVVEAATRAVITARQLYYERKLLPLRF 1087
            AHVYKLA+N VL+FAICLTTFQELRFLRKSKDE+VVEAATRAVIT RQLY E ++LPLRF
Sbjct: 997  AHVYKLASNQVLQFAICLTTFQELRFLRKSKDENVVEAATRAVITVRQLYTENRILPLRF 1056

Query: 1088 TGNIATHLEEHLEFEEQITWRSHVDEFVIEAVYKSQRKFKGLNLQARDQGQEYIPTDPKD 1147
            TGN+ATH+EEHLEFEEQITWRSHVDEFV EA+ K+Q +   L+ + RD            
Sbjct: 1057 TGNVATHIEEHLEFEEQITWRSHVDEFVFEAIKKAQAR---LSQENRD------------ 1101

Query: 1148 DDKFNFVVLVTDDLNMRTKAEAHDIHIFSSRFMFAFCNQLGYNQKVCIN 1196
               F+ VVLVTDD NMR KA+ H IH  S+RF+FA CN +G   K+C N
Sbjct: 1102 ---FHHVVLVTDDANMRRKAQQHAIHTLSTRFVFATCNAVGNRLKICTN 1147

>Ecym_4015 Chr4 complement(34835..38608) [3774 bp, 1257 aa] {ON}
            similar to Ashbya gossypii AFR290W
          Length = 1257

 Score = 1088 bits (2813), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 562/982 (57%), Positives = 698/982 (71%), Gaps = 34/982 (3%)

Query: 224  ENNRENSGIPIVNVPPKHTSQALVQKLQDIYRSIVKQEIELQERCSQLTNSQTTDMKNLW 283
            +N   N  +  V VP K +SQ LV+KLQ+IY++IVKQE ELQERCSQLT SQTTD+KNLW
Sbjct: 301  DNGDNNHNVSTVAVPSKPSSQTLVEKLQEIYKNIVKQETELQERCSQLTTSQTTDLKNLW 360

Query: 284  VIYKVNAELINNYISFITTALLPSQPEQDLLIGQEIVEIYRVERRLWVYGTITFLDVLKN 343
            VIYK+NAELI+NY +FITTALLP+QP+ DLLIGQEI+E+YR+ERRLW+YGTITFLDVLKN
Sbjct: 361  VIYKLNAELIDNYFTFITTALLPTQPKADLLIGQEIIEVYRIERRLWLYGTITFLDVLKN 420

Query: 344  FSNFMDPEVCCQFISHVFMSISNMLGDVPPRYSIPWLERLGDLSRMAIALYPSGFIDWKL 403
            FSNFMDPEVCCQFI +VF+SISN+LG++PP +S+ WLERLGDLSRMAIALYPSGFIDWKL
Sbjct: 421  FSNFMDPEVCCQFIVYVFISISNILGNIPPTFSVIWLERLGDLSRMAIALYPSGFIDWKL 480

Query: 404  SAEHWYSQALIYTYGHGKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFIPSQQYMQLVIDN 463
            SAEHWY +AL Y +GHGKLYYHMSTVQQNTL AFVNLGKSVFC+DTFIPSQQYMQLVIDN
Sbjct: 481  SAEHWYQEALKYNFGHGKLYYHMSTVQQNTLAAFVNLGKSVFCRDTFIPSQQYMQLVIDN 540

Query: 464  IYQRAFAERSGGSSRNFPIVEYLKHSEVMLLPSFLESPELQKVVLTFFQQRFGVWPNNVD 523
            IYQRAFAER+ G  R   IVEYLKH+EVMLLPSFLE+ E Q VVL FF Q+FG    + +
Sbjct: 541  IYQRAFAERNSGHHRYSHIVEYLKHTEVMLLPSFLENVESQGVVLAFFDQKFGA-TGSAN 599

Query: 524  FFDHKQIFIQDGEKLRYFFSHAPAFAESHILQLVGFGDPRNPFAIXXXXXXXXXXXXXXX 583
            FFD   IF+QD E+L++FF HA  +AESHILQLVGFGDPRNPFA+               
Sbjct: 600  FFDPSLIFVQDCERLKHFFRHASLYAESHILQLVGFGDPRNPFALLFELPKCIKERKERK 659

Query: 584  XXXXXXXXXXXXTNL--DDGNGSSSISVDHYFENIDSHRVPYSFPQDIQIWQQSLSYLNL 641
                        +++  DD      +    +FE ++S +  Y F QD+ IW++SL+Y+N 
Sbjct: 660  EKRKSKSTASNQSDMSIDDTFLGDPV---QFFETLNSTKTAYRFSQDLNIWKESLNYVNK 716

Query: 642  TSMECSMSVLKKFXXXXXXXXXXXXXXXXXFLVSVAIRISSLSSDALKKFWLVFMRRIFP 701
            TSM CSM VL+KF                 FLV+V +R+ ++ ++  K+FW+VF+R+IFP
Sbjct: 717  TSMRCSMVVLRKFLNSSLLTALPHLLPWAYFLVAVGLRLDAIRNEDSKRFWIVFIRQIFP 776

Query: 702  WNSLVSFLNTLMAFLLDNSRNMSSVEKLCEEYNKMDLHTLVEHFTNSEELPEVWKCWGTL 761
            W S+ +FLN L+ ++ D       +++    Y  M L  L+E+F  +E+LPEVW CWGTL
Sbjct: 777  WESITNFLNVLLLYINDQKPTKFPIDEYMANYINMPLPELLEYFCENEDLPEVWNCWGTL 836

Query: 762  WFDTISNKSELKASSVQSTGIRDHLFLDAPIDGICFDQDDESGLKFWKRACRVIFMFKGM 821
            WFD I++K       + STG++DH+FLDAP+DGI FD  DESG KFWKR  RVI +F+G+
Sbjct: 837  WFDVINSKHVSNLVDIHSTGVKDHMFLDAPVDGISFDHSDESGEKFWKRCVRVILLFRGI 896

Query: 822  AKEFHYGIRVSDTPISTRRDVTTLHALKRFSFKFEELPQEWDNEVFLQSDNFIKVFEPIS 881
            A +F +G     T  +   D       K   FKF E P EW  +           FE IS
Sbjct: 897  AYQFPFGF----TEFNGSDD------WKSLVFKFNEPPAEWKEQYLGSFSKEYGEFESIS 946

Query: 882  PINSNFEAVPSLSMIDGESIFEFQGYRRMYPDYYCFNKNGDLITGSLYTSGLLERVAIQG 941
             +N++ ++ P   M+ G  I   QGY+++ PDY CFNKNGDLITGSLYTSG+ E  +   
Sbjct: 947  FVNTDLQSPPHKGMVLGTDIRTLQGYKQLVPDYLCFNKNGDLITGSLYTSGMSEGGSGVP 1006

Query: 942  GD--DF-NVKRHVENGVLLAA----HNSPVDCNERTPETMVEYAERKWLNMCMDPAFMES 994
             D  DF + KR +EN +L+ +    +N+ +D  E TP  + E+   KW     +  + + 
Sbjct: 1007 NDSEDFGSTKRLLENELLVTSERRDYNNLLD-KEETP-IIDEFL--KWRYSSTNSRWEQC 1062

Query: 995  LRDSRFPHGDLACNADSNVTYFVLDATSWLRHFAHVYKLATNNVLKFAICLTTFQELRFL 1054
            L     P GDL    D++VTYFVLDAT+WLRHF HVYKLAT+N+LKFAICLTTFQELRFL
Sbjct: 1063 L-----PRGDLQYFTDTHVTYFVLDATTWLRHFGHVYKLATSNLLKFAICLTTFQELRFL 1117

Query: 1055 RKSKDESVVEAATRAVITARQLYYERKLLPLRFTGNIATHLEEHLEFEEQITWRSHVDEF 1114
            RKSKDESV+EAATRAVIT RQLYYERKLLPLRFTGN+A HLEEHLE EEQ+TWRSHVDEF
Sbjct: 1118 RKSKDESVLEAATRAVITVRQLYYERKLLPLRFTGNVAGHLEEHLEIEEQMTWRSHVDEF 1177

Query: 1115 VIEAVYKSQRKFKGLNLQARDQGQEYIPTDPKDDDKFNFVVLVTDDLNMRTKAEAHDIHI 1174
            VIEA+ K+Q KF  LN  A+  G+E I T   DD KFNF+ LVTDD+NMR KA A  I  
Sbjct: 1178 VIEAIDKAQSKFNQLNKDAKASGRESITT--IDDGKFNFIALVTDDINMRNKARAQSIRA 1235

Query: 1175 FSSRFMFAFCNQLGYNQKVCIN 1196
            FS++FMFA C+++G ++KVC +
Sbjct: 1236 FSTKFMFAICHEIGLSKKVCTD 1257

 Score = 48.9 bits (115), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 42/72 (58%), Gaps = 8/72 (11%)

Query: 70  ACFLDSNLTPSKHQECTPSSFQRATDETP-----QPFYPADTPQSPFYLPTTSSSNLEAA 124
           +CFL S    +          Q+ T E P     QP Y   TP+SP+YLPTTSSSN+EAA
Sbjct: 88  SCFLGSGGEGAAALPRIKDQGQQVTLENPSKLAQQPPYEC-TPRSPYYLPTTSSSNMEAA 146

Query: 125 SKVITNDNSSVQ 136
           +K I  D+SS++
Sbjct: 147 AKAI--DSSSIK 156

>KLLA0A00528g Chr1 complement(44587..48276) [3690 bp, 1229 aa] {ON}
            similar to uniprot|P36168 Saccharomyces cerevisiae
            YKR096W
          Length = 1229

 Score = 1050 bits (2716), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 539/962 (56%), Positives = 679/962 (70%), Gaps = 27/962 (2%)

Query: 246  LVQKLQDIYRSIVKQEIELQERCSQLTNSQTTDMKNLWVIYKVNAELINNYISFITTALL 305
            LV+KLQ+IY+SIVKQE ELQERCS LT  QTTD+KNLW+ YK+NAELI+NYI FITTALL
Sbjct: 284  LVEKLQEIYKSIVKQETELQERCSNLTTQQTTDLKNLWLAYKINAELIDNYILFITTALL 343

Query: 306  PSQPEQDLLIGQEIVEIYRVERRLWVYGTITFLDVLKNFSNFMDPEVCCQFISHVFMSIS 365
            PSQ E  L IGQEIV++YR+ERRLWVYGTITFLDVLKNFSNFMDPEVCCQFI++VF+++S
Sbjct: 344  PSQSESSLAIGQEIVDVYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIAYVFIALS 403

Query: 366  NMLGDVPPRYSIPWLERLGDLSRMAIALYPSGFIDWKLSAEHWYSQALIYTYGHGKLYYH 425
            NML D+PP+YSIPWLERLGDLSRMAIALYPSGF+DWKLSAEHWY ++L +T+GHGKLYYH
Sbjct: 404  NMLEDLPPKYSIPWLERLGDLSRMAIALYPSGFVDWKLSAEHWYRESLKFTFGHGKLYYH 463

Query: 426  MSTVQQNTLEAFVNLGKSVFCQDTFIPSQQYMQLVIDNIYQRAFAERSGGSSRNFPIVEY 485
            MSTVQQNTLEAFVNLGKSVFC+D F+PS QYMQLVIDNIYQRAFAER    +R   IV+Y
Sbjct: 464  MSTVQQNTLEAFVNLGKSVFCEDIFVPSPQYMQLVIDNIYQRAFAERDSSGNRTNHIVDY 523

Query: 486  LKHSEVMLLPSFLESPELQKVVLTFFQQRFGVWPNNVDFFDHKQIFIQDGEKLRYFFSHA 545
            LKH+EVMLLPSFLES ELQ VV+ +FQ +FGV  ++ +FFD   IFIQD E+L++FF H+
Sbjct: 524  LKHTEVMLLPSFLESSELQNVVIHYFQHKFGV-SSSGNFFDPNLIFIQDAERLKHFFRHS 582

Query: 546  PAFAESHILQLVGFGDPRNPFAIXXXXXXXXXXXXXXXXXXXXXXXXXXXTNLDDGNGSS 605
              F++SHILQL GFGDP+NPFA+                           + LD    SS
Sbjct: 583  SLFSQSHILQLCGFGDPKNPFAMLFELSKHLKSRKERKERKKSTKSTSEGS-LDPVEFSS 641

Query: 606  S--ISVDHYFENIDSHRVPYSFPQDIQIWQQSLSYLNLTSMECSMSVLKKFXXXXXXXXX 663
                S + +F  IDS +VPY FP D+ +W++SL Y+N+TSM+C M VL++F         
Sbjct: 642  QQQASTEDFFSTIDSPKVPYEFPLDLGVWKRSLHYINVTSMKCGMIVLRRFLYGPIVTAL 701

Query: 664  XXXXXXXXFLVSVAIRISSLSSDALKKFWLVFMRRIFPWNSLVSFLNTLMAFLLDNSRNM 723
                    F++S+ IR+  ++   LKKFW+VF+RRIFPW+SL++F+NTL+ + +      
Sbjct: 702  PHVLPWLLFIISIQIRLDQVNDLTLKKFWIVFIRRIFPWDSLITFMNTLIHYCMVTGTKN 761

Query: 724  SSVEKLCEEYNKMDLHTLVEHFTNSEELPEVWKCWGTLWFDTISNKSELKASSVQSTGIR 783
              ++     Y  M+   L+     +E LPE W CWG+LWF+TIS KS+L  ++++STG+ 
Sbjct: 762  FDIDAHMSTYLPMNREELLTSICENENLPECWSCWGSLWFNTISKKSDLDVTTLESTGLS 821

Query: 784  DHLFLDAPIDGICFDQDDESGLKFWKRACRVIFMFKGMAK-----EFHYGIR-VSDTPIS 837
            D LFLD+P +GICFD DDE G K+W+R CR + +F  + +      + +G + ++    S
Sbjct: 822  DTLFLDSPTEGICFDDDDEFGRKYWQRICRTLLLFNIITEWEACDGYGHGCKKLNPEATS 881

Query: 838  TRRDVTTLHALKRFSFKFEELPQEWDNEVFLQSDNFIKVFEPISPIN-SNFEAVPSLSMI 896
             +  V   +         E  P+E  NE F       + FE IS +N S+     S SMI
Sbjct: 882  WKNLVFRFNDDTNDQLSVELYPEE--NESFP-----FEKFEIISNLNCSDNLQDGSKSMI 934

Query: 897  DGESIFEFQGYRRMYPDYYCFNKNGDLITGSLYTSGLLERVAIQGGDDFNVKRHVENGVL 956
             G SI   QG++ MYPDY+CFNKNGDLIT SLYT G LE   IQGGDDFN  + ++NG L
Sbjct: 935  PGVSIENLQGFKLMYPDYFCFNKNGDLITASLYTKGPLETANIQGGDDFNANKILDNGRL 994

Query: 957  LAAHNSPVDCNERTPETMVEYAERKWLNMCMDPAFMESLRDSRFPHGDLACNADSNVTYF 1016
            +         +     + ++  E+ WL   M+P F +    +R   G+L C AD+NVT+F
Sbjct: 995  VVQ-------DRLEYSSAIDKLEQPWLEAFMNPDFRQRELLNRSFLGNLNCQADTNVTFF 1047

Query: 1017 VLDATSWLRHFAHVYKLATNNVLKFAICLTTFQELRFLRKSKDESVVEAATRAVITARQL 1076
            VLDAT+WLRHFAH+YKLAT++VLKFAICLTTFQELRFLRKSKDESV+EAATRAVI  RQL
Sbjct: 1048 VLDATTWLRHFAHIYKLATSSVLKFAICLTTFQELRFLRKSKDESVLEAATRAVIAVRQL 1107

Query: 1077 YYERKLLPLRFTGNIATHLEEHLEFEEQITWRSHVDEFVIEAVYKSQRKFKGLNLQARDQ 1136
            YYERKLL LRFTGN+A HLEEHLE EEQ+TW+SHVDEFVI+A+ K+Q KF  LN  A ++
Sbjct: 1108 YYERKLLALRFTGNVAGHLEEHLEIEEQMTWKSHVDEFVIDAIAKAQDKFNVLNNDAIEK 1167

Query: 1137 GQEYIP--TDPKDDDKFNFVVLVTDDLNMRTKAEAHDIHIFSSRFMFAFCNQLGYNQKVC 1194
            G++ IP   D +   +FNFV LVTDD NMR KA+   I  FS+RF+FA C +LG    VC
Sbjct: 1168 GKDCIPLSEDGQSTQRFNFVSLVTDDFNMRNKAQQLGIRTFSTRFVFAICRELGRETGVC 1227

Query: 1195 IN 1196
             N
Sbjct: 1228 TN 1229

 Score = 68.6 bits (166), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 54/129 (41%), Positives = 71/129 (55%), Gaps = 16/129 (12%)

Query: 24  MASHPTLHQKRHXXXXXXXXXXGYAKRRP-NTLSQNVSQN-DELAASAACFLDSNL--TP 79
           MA H  LHQKRH             KRR  + + +NV  +  E+      +LD++L  +P
Sbjct: 8   MAGHSGLHQKRHNSNSVDYYDSNIIKRRTGDGVPENVDISVAEIPQEPCQYLDTSLLTSP 67

Query: 80  SK--HQECTPSSFQRAT---DETPQPFYPADT----PQSPFYLPTTSSSNLEAASKVITN 130
           SK  H E TPS  +  T   ++TPQP    DT    PQSPFYLPTTS +N EAA+ V  N
Sbjct: 68  SKIRHHEKTPSITKPHTLQMEQTPQP-RGVDTSGEFPQSPFYLPTTSQTNFEAATTV--N 124

Query: 131 DNSSVQLPD 139
           +NSS++  D
Sbjct: 125 ENSSIRRSD 133

>KNAG0C06630 Chr3 (1284481..1288326) [3846 bp, 1281 aa] {ON} Anc_5.706
            YIL151C
          Length = 1281

 Score = 1041 bits (2692), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 527/1007 (52%), Positives = 688/1007 (68%), Gaps = 60/1007 (5%)

Query: 240  KHTSQALVQKLQDIYRSIVKQEIELQERCSQLTNSQTTDMKNLWVIYKVNAELINNYISF 299
            + +SQALVQKLQDIY+ IVKQEIELQERCSQLT SQTT++KNLW IYK+N +LINNY +F
Sbjct: 285  RKSSQALVQKLQDIYKVIVKQEIELQERCSQLTTSQTTELKNLWTIYKINTDLINNYTTF 344

Query: 300  ITTALLPSQPEQDLLIGQEIVEIYRVERRLWVYGTITFLDVLKNFSNFMDPEVCCQFISH 359
            ITTALLPSQP QD+LIG+EIVEIYR+ERRLWVYGTITFLDVLKNFSNFMDPEVC QFI+H
Sbjct: 345  ITTALLPSQPAQDILIGEEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCSQFITH 404

Query: 360  VFMSISNMLGDVPPRYSIPWLERLGDLSRMAIALYPSGFIDWKLSAEHWYSQALIYTYGH 419
            VF+S+S +L D+PP+++IPWL+RLGDLSRMAIALYPSGFIDWKLSAEHWY +A+ +TY H
Sbjct: 405  VFISLSAILIDIPPKHAIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYSH 464

Query: 420  GKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFIPSQQYMQLVIDNIYQRAFAER-SGGSSR 478
            GKLYYHMSTVQQNTLEAFVNLGKSVFCQDTF PSQQYMQLVIDNIYQR F +R +GG+ R
Sbjct: 465  GKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRTFVDRNTGGNYR 524

Query: 479  NFPIVEYLKHSEVMLLPSFLESPELQKVVLTFFQQRFGVWPNNVDFFDHKQIFIQDGEKL 538
            N  +++YLKHSEVMLLPSFL S +LQ+VVL +FQ RFG+  +  + FD + +F Q    L
Sbjct: 525  NPDLIDYLKHSEVMLLPSFLGSKDLQQVVLNYFQDRFGIDYSENNIFDTQDMFFQPPSCL 584

Query: 539  RYFFSHAPAFAESHILQLVGFGDPRNPFAI--------------XXXXXXXXXXXXXXXX 584
            R+FF HAPAFAESHILQLVGFG+P+NPFA+                              
Sbjct: 585  RFFFRHAPAFAESHILQLVGFGNPKNPFALLFELPKYLKERRDKKEKNKSKSTSTADVSS 644

Query: 585  XXXXXXXXXXXTNLDDGNG-----SSSISVDHYFENIDSHRVPYSFPQDIQIWQQSLSYL 639
                        N+++G       ++++S   Y +NI++ +     P DI  W +SL ++
Sbjct: 645  TAPKTVDDQATDNVNEGTNDDHELTATLSGPEYLDNIETLKYAIETP-DICTWIKSLDFI 703

Query: 640  NLTSMECSMSVLKKFXXXXXXXXXXXXXXXXXFLVSVAIRISSLSSDALKKFWLVFMRRI 699
            N+TS++CSM VLKKF                 F+++  I+++ L ++   KFW + M+RI
Sbjct: 704  NMTSLKCSMIVLKKFLHGPLLIALPHFLPWTVFIIACGIKVNELENEKNYKFWRILMKRI 763

Query: 700  FPWNSLVSFLNTLMAFLLDNSRNMSSVEKLCEEYNKMDLHTLVEHFTNSEELPEVWKCWG 759
            FPW+++ SFLN L+A++LDN  N + +E+LC +Y+ MDL  ++ HF  SE+LPEVWKCWG
Sbjct: 764  FPWDTITSFLNVLLAYVLDNYGNTTIIEELCMQYSDMDLDDMLAHFNKSEDLPEVWKCWG 823

Query: 760  TLWFDTISNKSELKASSVQSTGIRDHLFLDAPIDGICFDQDDESGLKFWKRACRVIFMFK 819
            TLW+D I NK+ + A +    GI DH+FLD PIDGI FD +DE+G KFWKRA RVIF+FK
Sbjct: 824  TLWYDAICNKNSVDADTFAGFGIGDHMFLDFPIDGIEFDAEDETGAKFWKRALRVIFLFK 883

Query: 820  GMAKEFHYGIRVS-DTPISTRRDVTTLHALKRFSFKFEELPQEWDNEVFLQSDNFIKVFE 878
            G++K+F +G+++S +  +  R +      L+RF+FK E     +D     + + FI + E
Sbjct: 884  GISKKFDFGLKISHEAGVYCRNEKAADSPLRRFTFKLE----SYDEPTSSKFNEFIPLCE 939

Query: 879  PISPINSNFEAVPSLSMIDGESIFEFQGYRRMYPDYYCFNKNGDLITGSLYTSGLLERVA 938
             +S IN++  A PSLS++ GE+IFE+ GYR +  D   F+KNG++++ S+YTS +++   
Sbjct: 940  EVSAINNDALATPSLSVVQGENIFEYMGYRTLGLDKNSFDKNGEIVSSSIYTSWMID--- 996

Query: 939  IQGGDDFNVKRHVENGVL------LAAHNSPVDCN----ERTPETMVEYAERKWLNMC-M 987
              G          +N  +      LAA+ +P+  +     +T  + V   +   LN   +
Sbjct: 997  -TGEAAAAASSATDNNAVSEGQGDLAANGTPISASLSAAGKTTTSHVTDDQDPGLNENDL 1055

Query: 988  DPAFME--SLRDSRFPHGDLACNA--------------DSNVTYFVLDATSWLRHFAHVY 1031
               FM     RD    H  +   +              D   T+F+ DATSWLRHFAH+Y
Sbjct: 1056 FKKFMSLGDPRDRNVYHNMITGKSYLVKNLWESSVDELDRLKTFFIFDATSWLRHFAHIY 1115

Query: 1032 KLATNNVLKFAICLTTFQELRFLRKSKDESVVEAATRAVITARQLYYERKLLPLRFTGNI 1091
            K+ATN VLKF +CLTTFQELRFLRKSKDE+VVEAA RA+IT RQLY E +LLPLRFTGN+
Sbjct: 1116 KIATNGVLKFGVCLTTFQELRFLRKSKDENVVEAAARAIITMRQLYRENRLLPLRFTGNV 1175

Query: 1092 ATHLEEHLEFEEQITWRSHVDEFVIEAVYKSQRKF--KGLNLQARDQGQEYIPTDPKDDD 1149
            A  +EEHLEFEEQITWRSHVDEFVIEAV K+Q KF   G   Q  ++G    P  P    
Sbjct: 1176 ANDIEEHLEFEEQITWRSHVDEFVIEAVMKAQDKFTTAGETKQPEEEGTG-PPRVPLGGK 1234

Query: 1150 KFNFVVLVTDDLNMRTKAEAHDIHIFSSRFMFAFCNQLGYNQKVCIN 1196
            +F++V LVT+D NM+ KA+   I  FS+ F+F+ C++LG +  +C N
Sbjct: 1235 RFHYVTLVTNDQNMKRKAQDQGIKTFSTDFVFSLCSKLGMSLDLCTN 1281

>KAFR0H00180 Chr8 complement(20661..24386) [3726 bp, 1241 aa] {ON}
            Anc_5.706 YIL151C
          Length = 1241

 Score = 1025 bits (2650), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 525/986 (53%), Positives = 672/986 (68%), Gaps = 51/986 (5%)

Query: 240  KHTSQALVQKLQDIYRSIVKQEIELQERCSQLTNSQTTDMKNLWVIYKVNAELINNYISF 299
            K TS+ L++KLQ+IY+ IVKQE+ELQ+RCSQLT SQTT++KNLW IYK+N +LINNYI+F
Sbjct: 278  KKTSRVLIEKLQNIYKIIVKQEMELQQRCSQLTTSQTTELKNLWSIYKLNTDLINNYITF 337

Query: 300  ITTALLPSQPEQDLLIGQEIVEIYRVERRLWVYGTITFLDVLKNFSNFMDPEVCCQFISH 359
            ITTALLPSQ  QD+ IG+EIVEIYR+ERRLWVYGTITFLDVLKNFSNFMDPEVC QFI+H
Sbjct: 338  ITTALLPSQSLQDIQIGEEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCSQFITH 397

Query: 360  VFMSISNMLGDVPPRYSIPWLERLGDLSRMAIALYPSGFIDWKLSAEHWYSQALIYTYGH 419
            VF+S+S ML D+PP++SIPWL+RLGDLSRMAIALYPSGFIDWKLSAEHWY +A+ +TY H
Sbjct: 398  VFISLSTMLIDLPPKHSIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYSH 457

Query: 420  GKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFIPSQQYMQLVIDNIYQRAFAERS-GGSSR 478
            GKLYYHMSTVQQNTLEAFVNLGKSVFCQDTF PSQQYMQLVIDNIYQR F +R+  G+ R
Sbjct: 458  GKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRTFVDRNKNGNVR 517

Query: 479  NFPIVEYLKHSEVMLLPSFLESPELQKVVLTFFQQRFGVWPNNVDFFDHKQIFIQDGEKL 538
            N  +++YLKHSEVMLLPSFLE+ +LQ+VVL +F  RFGV  N+ + F+ + +F Q    L
Sbjct: 518  NSDLIDYLKHSEVMLLPSFLENEDLQQVVLNYFNDRFGVDYNDNNIFETQDMFFQVPASL 577

Query: 539  RYFFSHAPAFAESHILQLVGFGDPRNPFAIXXXXXXXXXXXXXXXXXXXXXXXXXXXTNL 598
            R++F HAPAFAESHILQLVGFG+P+NPFA+                           T  
Sbjct: 578  RFYFRHAPAFAESHILQLVGFGNPKNPFALLFDLPNFLKERKDKKEKNKSKSSTEISTMS 637

Query: 599  DDGNGS------------SSISVDHYFENIDSHRVPYSFPQDIQIWQQSLSYLNLTSMEC 646
             D N S                V  YF+NIDS R+P   P +I +W +SL +LN+TS++C
Sbjct: 638  IDTNDSRGPILNTSAYVNEGNIVTEYFDNIDSLRLPIDHP-NILVWLKSLEHLNMTSLKC 696

Query: 647  SMSVLKKFXXXXXXXXXXXXXXXXXFLVSVAIRISSLSSDALKKFWLVFMRRIFPWNSLV 706
            S+ VL+KF                 F+++  ++  S  + +  KFW + MRRI PWN+L 
Sbjct: 697  SVIVLRKFLRGPLLIALPHVLPWTYFIIATFLKAQSSKNTSSVKFWTIVMRRILPWNTLT 756

Query: 707  SFLNTLMAFLLDNSRNMSSVEKLCEEY-NKMDLHTLVEHFTNSEELPEVWKCWGTLWFDT 765
            SFLN L+A++LDN     S+ KLCE Y N  + + L+++F  +E LPE+WKCWGTLWFD 
Sbjct: 757  SFLNVLLAYILDNFYQTESIAKLCETYSNFENFYELLDYFNRNENLPEIWKCWGTLWFDV 816

Query: 766  ISNKSELKASSVQSTGIRDHLFLDAPIDGICFDQDDESGLKFWKRACRVIFMFKGMAKEF 825
            ISNK  L A +    GI DH+FLD P+DGI FD+ DE+G  FW RA R++F+FKG+A+  
Sbjct: 817  ISNKRALNADTFNGLGIEDHMFLDFPLDGIGFDELDETGENFWNRALRIVFLFKGIAENL 876

Query: 826  HYGIRVSDT-PISTRR-DVTTLHALKRFSFKFEELPQ-EWDNEVFLQSDNFIKVFEPISP 882
              G+RVS T P+  RR D+   H LK FSFK E   +  +  + F   +  + +FE I  
Sbjct: 877  QTGLRVSRTAPVHCRRDDIDPNHILKSFSFKMEGFDESSYSGQPFSTINKLLPLFENIDE 936

Query: 883  INSNFEAVPSLSMIDGESIFEFQGYRRMYPDYYCFNKNGDLITGSLYTSGLLER---VAI 939
             N +F+A P LS++ GE+IFE+ GY++++ + + F++NG+L++ S+YT+ +++    +  
Sbjct: 937  TNLDFDARPMLSVVKGENIFEYVGYKKLFLNNHSFDRNGELVSSSIYTAWVIDNDNSLNN 996

Query: 940  QGGDDF--NVKRHVENGVLLAAHNSPVD-----CNERTPE--TMVEYAERKWLNMCMDPA 990
              G+ +  N++   +   LL              NE T +      Y   + LN  MD A
Sbjct: 997  SQGNQYTSNMQMTQQQRQLLPPEQQNFQMRNFASNEDTEDDFNFELYMNPEKLNKNMDQA 1056

Query: 991  FMESLRDSRFPHGDLACNADSNVTYFVLDATSWLRHFAHVYKLATNNVLKFAICLTTFQE 1050
             + +  +            + N+TYFV DATSWLRHFAH+YKL+TNNVL FA+CLTTFQE
Sbjct: 1057 SIWTTANDEI---------NRNITYFVFDATSWLRHFAHIYKLSTNNVLNFAVCLTTFQE 1107

Query: 1051 LRFLRKSKDESVVEAATRAVITARQLYYERKLLPLRFTGNIATHLEEHLEFEEQITWRSH 1110
            LRFLRKSKDE+VV AA RA+IT RQLY E KLLPLRFTGN+AT +EEHLEFEEQITWRSH
Sbjct: 1108 LRFLRKSKDENVVGAAARAIITMRQLYSEGKLLPLRFTGNVATDIEEHLEFEEQITWRSH 1167

Query: 1111 VDEFVIEAVYKSQRKFKGLNLQARDQGQEYIPTDPKDDDKFNFVVLVTDDLNMRTKAEAH 1170
            VDEFVIEAV K+Q KF   N     +              FN VVLVTDD+NM+ KA+  
Sbjct: 1168 VDEFVIEAVVKAQNKFISANESVTLRK------------GFNHVVLVTDDINMKRKAQEQ 1215

Query: 1171 DIHIFSSRFMFAFCNQLGYNQKVCIN 1196
             I  F++ F+F+ C +LG    VC N
Sbjct: 1216 GIKTFTTHFIFSVCRKLGIQDNVCTN 1241

>Kpol_1043.73 s1043 (155026..158808) [3783 bp, 1260 aa] {ON}
            (155026..158808) [3783 nt, 1261 aa]
          Length = 1260

 Score = 1003 bits (2592), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 520/987 (52%), Positives = 683/987 (69%), Gaps = 74/987 (7%)

Query: 232  IPIVNVPPKHTSQALVQKLQDIYRSIVKQEIELQERCSQLTNSQTTDMKNLWVIYKVNAE 291
            +P V+VPP+ +SQALVQKLQDIY+ I+KQE+ELQERCSQLTNSQTT++KNLWVIYK+NA+
Sbjct: 304  VPSVSVPPRKSSQALVQKLQDIYKIILKQEVELQERCSQLTNSQTTEIKNLWVIYKLNAD 363

Query: 292  LINNYISFITTALLPSQPEQDLLIGQEIVEIYRVERRLWVYGTITFLDVLKNFSNFMDPE 351
            LINNY++FITTAL PSQ + DLLIG+EIV+IY++ERRLWVYGTITFLDVLKNFSNFMDPE
Sbjct: 364  LINNYVTFITTALFPSQSKSDLLIGEEIVDIYKIERRLWVYGTITFLDVLKNFSNFMDPE 423

Query: 352  VCCQFISHVFMSISNMLGDVPPRYSIPWLERLGDLSRMAIALYPSGFIDWKLSAEHWYSQ 411
            VCCQFI+HVF+SIS+ML D+P +Y+IPWL++LGDLSRMA+AL+PSGFIDWKLSAE WY  
Sbjct: 424  VCCQFITHVFISISSMLDDIPQKYAIPWLQKLGDLSRMAVALFPSGFIDWKLSAERWYMA 483

Query: 412  ALIYTYGHGKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFIPSQQYMQLVIDNIYQRAFAE 471
            A+ Y+YG+GKLYYHMSTVQQNTLEAFVNLGKSVFCQ+TF+PSQQY+QLVIDNIYQRAFA+
Sbjct: 484  AMEYSYGYGKLYYHMSTVQQNTLEAFVNLGKSVFCQNTFVPSQQYLQLVIDNIYQRAFAD 543

Query: 472  R-SGGSSRNFP-IVEYLKHSEVMLLPSFLESPELQKVVLTFFQQRFGV--WPNNVDFFDH 527
            R S  +SRN   +V+YLKHSEVMLLP+F+ESP+LQ+VVL +F ++FG+    NNV  F  
Sbjct: 544  RNSSSNSRNCQLLVDYLKHSEVMLLPNFMESPDLQQVVLLYFMEKFGIDYNNNNVKMFQP 603

Query: 528  KQIFIQDGEKLRYFFSHAPAFAESHILQLVGFGDPRNPFAIXXXXXXXXXXXXXXXXXXX 587
            +Q+FIQ+ ++L+++F HA AFAE+ ILQLVG+G+P+NPFA+                   
Sbjct: 604  RQMFIQNNDQLKFYFRHANAFAEAQILQLVGYGNPKNPFALLFSLPKYLKERRDKKEKRK 663

Query: 588  XXXXXXXXTNLDDGNGSSSISV-----------------DHYFENIDSHRVPYSFPQDIQ 630
                       +DG+ ++  SV                 + +F NID   +    P  I 
Sbjct: 664  PKNQIVG----EDGSSTTFSSVSGMEYMVNMETNVFLGSEDFFNNIDKLAINNFMPNSIS 719

Query: 631  IWQQSLSYLNLTSMECSMSVLKKFXXXXXXXXXXXXXXXXXFLVSVAIRISSLSSDALKK 690
            +W  SL Y N T+ +CSM VL+KF                 FL+S+A++I      A+ +
Sbjct: 720  LWNDSLKYHNFTATKCSMIVLQKFLNGPLMVALPHILPWVYFLISIALQIEKYQDTAMME 779

Query: 691  FWLVFMRRIFPWNSLVSFLNTLMAFLLDNSRNMSSVEKLCEEYNKMDLHTLVEHFTNSEE 750
            FW  F++RIFPWNS+V FLN L+A+++DN  + S + +LC++Y  ++L  L+ +F  +E+
Sbjct: 780  FWYAFIKRIFPWNSMVRFLNVLLAYMIDNCWDNSPLNELCDQYGSLNLEELLRNFNANED 839

Query: 751  LPEVWKCWGTLWFDTISNK-SELKASSVQSTGIRDHLFLDAPIDGICFDQDDESGLKFWK 809
            LPEVWKC G+LWFD I  K +     S    GI+D+ FLD P+DGI FD++DE G+KFWK
Sbjct: 840  LPEVWKCRGSLWFDIIDEKRNSQNCDSYTECGIKDYQFLDFPVDGIEFDENDEIGIKFWK 899

Query: 810  RACRVIFMFKGMAKEFH-YG-IRVS-DTPISTRRDVTTLHALKRFSFKFEELPQEWDNEV 866
            R+ RVIF+F+G+ + F+ +G + +S + P+  RR +     L  +SFK   L  + D+ +
Sbjct: 900  RSVRVIFLFRGIVERFNGFGNLAISYNAPVINRRGLGVNSHLVGYSFK---LMAKSDDIM 956

Query: 867  FLQSDNFIKVFEPISPINSNFEAVPSLSMIDGESIFEFQGYRRMYPDYYCFNKNGDLITG 926
            F   D  +  FE I   NS+F A+P LSMI GE+IFE+ GY+R++ DYY F+KNGDLI+ 
Sbjct: 957  F--DDMLVSNFEEIDSNNSDFNAIPLLSMIYGENIFEYVGYKRIHADYYSFDKNGDLIST 1014

Query: 927  SLY-TSGLLERVAIQGGDDFNVKRHVENGVLLAAHNSPVDCNERTPETMVEYAERKWLNM 985
            S Y T  + +   + GG              L+ ++S  +     P       E++  N 
Sbjct: 1015 SFYNTWSINQDTGVNGGP-------------LSNNSSSSNAASSDPMN-----EKELFNK 1056

Query: 986  CMDPAFMESLRD--SRFPHGDLACNADSNV---TYFVLDATSWLRHFAHVYKLATNNVLK 1040
            C DP + +S+ +  ++  + D+       +   TYF+LDATSWLRHFAHVYK+ATN++LK
Sbjct: 1057 CFDPEY-DSVDEFWNKEIYDDIGRKFGMELYEDTYFILDATSWLRHFAHVYKIATNSILK 1115

Query: 1041 FAICLTTFQELRFLRKSKDESVVEAATRAVITARQLYYERKLLPLRFTGNIATHLEEHLE 1100
            F+ICLTTFQELRFLRKSKDE+VVEAATRA+IT RQL+ E KLLPLRFTGN+ATH+EEHLE
Sbjct: 1116 FSICLTTFQELRFLRKSKDENVVEAATRAIITLRQLFSEGKLLPLRFTGNVATHIEEHLE 1175

Query: 1101 FEEQITWRSHVDEFVIEAVYKSQRKFKGLNLQARDQGQEYIPTDPKDDDKFNFVVLVTDD 1160
            FEEQITWRSHVDEFVIEAV K++ K K   +      Q               +VLVTDD
Sbjct: 1176 FEEQITWRSHVDEFVIEAVIKAETKRKEQEMHNMKGFQ---------------IVLVTDD 1220

Query: 1161 LNMRTKAEAHDIHIFSSRFMFAFCNQL 1187
             NM+ KA       FS+RF+FA  N L
Sbjct: 1221 SNMKNKALEKGSKTFSTRFVFAISNYL 1247

>Smik_11.360 Chr11 (616879..620421) [3543 bp, 1180 aa] {ON} YIL151C
            (REAL)
          Length = 1180

 Score =  999 bits (2582), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 500/979 (51%), Positives = 664/979 (67%), Gaps = 74/979 (7%)

Query: 240  KHTSQALVQKLQDIYRSIVKQEIELQERCSQLTNSQTTDMKNLWVIYKVNAELINNYISF 299
            K +  AL+QKLQ++YR IVKQEIELQERCSQLTNSQTT++K+LW IYK+N EL+NNY++F
Sbjct: 250  KRSGIALIQKLQELYRVIVKQEIELQERCSQLTNSQTTELKSLWTIYKINTELVNNYVTF 309

Query: 300  ITTALLPSQPEQDLLIGQEIVEIYRVERRLWVYGTITFLDVLKNFSNFMDPEVCCQFISH 359
            ITTALLPSQP  DL+IGQEIVEIYR+ERRLWVYGTITFLDVLKNFSNFMDPEVCCQFI+H
Sbjct: 310  ITTALLPSQPPHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITH 369

Query: 360  VFMSISNMLGDVPPRYSIPWLERLGDLSRMAIALYPSGFIDWKLSAEHWYSQALIYTYGH 419
            VF+S+S M+ D+P +YSI WL+RLGDLSRMAIALYPS FIDWKLSAEHWY++A+ YTY H
Sbjct: 370  VFISLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYTYNH 429

Query: 420  GKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFIPSQQYMQLVIDNIYQRAFAERSGGSSRN 479
            GKLYYHMSTVQQNTLEAFVNLGKSVFCQ+TF PS QYMQLVIDNIYQRAF ER+ G+ RN
Sbjct: 430  GKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNGNLRN 489

Query: 480  FPIVEYLKHSEVMLLPSFLESPELQKVVLTFFQQRFGVWPNNVDFFDHKQIFIQDGEKLR 539
              ++EYLKHSE MLLPSFLESP+LQ VVL++F ++FG+  N  + F+ + +FIQ+ +  +
Sbjct: 490  SLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFIEKFGIDANGCNIFNCEDMFIQNPDFFK 549

Query: 540  YFFSHAPAFAESHILQLVGFGDPRNPFAIXXXXXXXXXXXXXXXXXXXXXXXXXXXTNLD 599
            YFF H P+FA+SHILQ+VGFG+P+NPFAI                           T   
Sbjct: 550  YFFRHGPSFAQSHILQIVGFGEPKNPFAILFELPKYLKERKDKKERKKTSNNDSSVTESS 609

Query: 600  DGNG-----------SSSISVD------HYFENIDSHRVPYSFPQDI--QIWQQSLSYLN 640
             GN            SS+ S+        +F +ID+ R P   P  +  + W ++L +LN
Sbjct: 610  TGNSRNGNEDDDETMSSTTSMSDPDLLVEFFNDIDTLRRPI-LPSMLTNEAWLETLKFLN 668

Query: 641  LTSMECSMSVLKKFXXXXXXXXXXXXXXXXXFLVSVAIRISSLSSDALKKFWLVFMRRIF 700
            +TS++C M VL+KF                 F++S+ ++ + L+    K+FW+V ++R+F
Sbjct: 669  MTSLKCGMIVLRKFLHGPLGVALPHVLPWIYFIISICLKSNQLNDPISKEFWIVIIKRMF 728

Query: 701  PWNSLVSFLNTLMAFLLDNSRNMSSVEKLCEEYNKMDLHTLVEHFTNSEELPEVWKCWGT 760
            PW+++V+F+N L+A+LLDN  + S +  LC EY+K++L  L+  F  +E+LPE+W CWGT
Sbjct: 729  PWDTMVTFMNVLIAYLLDNETSNSIIGDLCNEYSKLNLSELLNSFNENEDLPEIWGCWGT 788

Query: 761  LWFDTISNKSELKASS---VQSTGIRDHLFLDAPIDGICFDQDDESGLKFWKRACRVIFM 817
            LWFD I  K+    SS    Q  GIRD++ LD+P DGI FD  DE+G KFWKRACR+IF+
Sbjct: 789  LWFDAICQKNTHSISSEDNFQEIGIRDYMALDSPTDGIIFDDKDENGEKFWKRACRIIFL 848

Query: 818  FKGMAKEFHYGIRVSDTPISTRRDVTTLHALKRFSFKFEELPQEWDNEVFLQS-DNFIKV 876
            F+ +++ F  G+ V   P+     + + + L+   +K E L     +   L + ++   +
Sbjct: 849  FREVSRSFPLGVIVRHDPLVNCSSLQSNNILRDLVYKLEPLTNIRSSVPVLSTLESIFDI 908

Query: 877  FEPISPINSNFEAVPSLSMIDGESIFEFQGYRRMYPDYYCFNKNGDLITGSLYTSGLLER 936
             E  S IN++  AVP LS+I+G++IF + GY+++ PDY CF+KNG+ ++ SLYTS  +  
Sbjct: 909  SEARSEINTDLHAVPELSVINGDNIFHYVGYKKLRPDYTCFDKNGEFLSASLYTSWYVP- 967

Query: 937  VAIQGGDDFNVKRHVENGVLLAAHNSPVDCNERTPETMVEYAERKWLNMCMDPAFMESLR 996
                     N   ++E  +  A        NER  E +                F+E ++
Sbjct: 968  ---------NCNNNLETNISYA--------NERENEAL----------------FLECMK 994

Query: 997  DSRFPHGDLAC-NADSNVTYFVLDATSWLRHFAHVYKLATNNVLKFAICLTTFQELRFLR 1055
                 H ++A    D   TYFV DATSWLRH A ++KLA N +L+FAICLTTFQELRFLR
Sbjct: 995  SV---HPEIAYPEIDFKTTYFVFDATSWLRHSARIFKLAQNRLLRFAICLTTFQELRFLR 1051

Query: 1056 KSKDESVVEAATRAVITARQLYYERKLLPLRFTGNIATHLEEHLEFEEQITWRSHVDEFV 1115
            KSKDE+V+EAATR +IT RQLY E K+LPLRFTGN+ATH+EE+LEFEEQITWR+HVDEFV
Sbjct: 1052 KSKDENVMEAATRGIITIRQLYCEDKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFV 1111

Query: 1116 IEAVYKSQRKFKGLNLQARDQGQEYIPTDPKDDDKFNFVVLVTDDLNMRTKAEAHDIHIF 1175
            IE++ K+Q K +       +  Q  I +      +FN+VVL++DD  M+ KAE   I   
Sbjct: 1112 IESIMKAQEKLE-------NAKQPNISS-----HRFNYVVLISDDDTMKKKAEEKKIRTL 1159

Query: 1176 SSRFMFAFCNQLGYNQKVC 1194
            S+RF+F+ C +LG  + +C
Sbjct: 1160 STRFVFSLCTKLGEQRHLC 1178

>Suva_11.333 Chr11 (611602..612061,612092..615195) [3564 bp, 1187 aa]
            {ON} YKR096W (REAL)
          Length = 1187

 Score =  990 bits (2559), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 506/978 (51%), Positives = 659/978 (67%), Gaps = 77/978 (7%)

Query: 240  KHTSQALVQKLQDIYRSIVKQEIELQERCSQLTNSQTTDMKNLWVIYKVNAELINNYISF 299
            K +S AL+QKLQ++Y+ IVKQEIELQERCSQLTNSQTT++K+LW IY++N EL+NNY++F
Sbjct: 262  KKSSIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYRINTELVNNYVTF 321

Query: 300  ITTALLPSQPEQDLLIGQEIVEIYRVERRLWVYGTITFLDVLKNFSNFMDPEVCCQFISH 359
            ITTALLPSQP+ DL+IGQEIVEIYR+ERRLWVYGTITFLDVLKNFSNFMDPEVCCQFI+H
Sbjct: 322  ITTALLPSQPQHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITH 381

Query: 360  VFMSISNMLGDVPPRYSIPWLERLGDLSRMAIALYPSGFIDWKLSAEHWYSQALIYTYGH 419
            VF+S+S M+ D+P +YSI WL+RLGDLSRMAIALYPS FIDWKLSAEHWY++A+ Y Y H
Sbjct: 382  VFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYVYNH 441

Query: 420  GKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFIPSQQYMQLVIDNIYQRAFAERSGGSSRN 479
            GKLYYHMSTVQQNTLEAFVNLGKSVFCQ+TF PS QYMQLVIDNIYQRAF ER+ G+ RN
Sbjct: 442  GKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNGNLRN 501

Query: 480  FPIVEYLKHSEVMLLPSFLESPELQKVVLTFFQQRFGVWPNNVDFFDHKQIFIQDGEKLR 539
              ++EYLKHSE MLLPSFLESP+LQ VVL++F ++FG+  N  + F+ + +FIQ+ +  +
Sbjct: 502  SLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFVEKFGIDANGCNIFNPEDMFIQNPDFFK 561

Query: 540  YFFSHAPAFAESHILQLVGFGDPRNPFAI--------XXXXXXXXXXXXXXXXXXXXXXX 591
            YFF HAP+FA+SHILQ+VGFG+P+NPFAI                               
Sbjct: 562  YFFRHAPSFAQSHILQIVGFGEPKNPFAILFELPKHLKERKDKKERKKSSNNESSITESS 621

Query: 592  XXXXTNLDDGNG---SSSISVD------HYFENIDSHRVP-YSFPQDIQIWQQSLSYLNL 641
                 N +D N    SS+ S+        +F +ID+ R P  S     + W +SL +LN+
Sbjct: 622  TSNSRNENDDNDEIMSSTTSISERDSLIEFFNDIDTLRRPIVSSMLTNEAWLESLKFLNM 681

Query: 642  TSMECSMSVLKKFXXXXXXXXXXXXXXXXXFLVSVAIRISSLSSDALKKFWLVFMRRIFP 701
            TS++C M VL+KF                 F++S+ ++ S LS    K+FW+V ++RIFP
Sbjct: 682  TSLKCGMIVLRKFLHGPLGIALPHFLPWIYFIISICLKSSQLSDPISKEFWIVIVKRIFP 741

Query: 702  WNSLVSFLNTLMAFLLDNSRNMSSVEKLCEEYNKMDLHTLVEHFTNSEELPEVWKCWGTL 761
            W+++V+F+N L+A +LDN      +  LC+EY+ ++L  L++ F   EELPE+W CWGTL
Sbjct: 742  WDTMVTFMNILIACVLDNEMTSPIIGSLCDEYSDLNLAELLDVFKEKEELPEIWGCWGTL 801

Query: 762  WFDTISNKSELKASS---VQSTGIRDHLFLDAPIDGICFDQDDESGLKFWKRACRVIFMF 818
            WFDTI  K+    SS    +  GI+D++ LD+PIDGI FD +DE+G KFWKRACR IF+F
Sbjct: 802  WFDTICQKNTNSISSDDDFEEVGIKDYMALDSPIDGIIFDVNDENGEKFWKRACRTIFLF 861

Query: 819  KGMAKEFHYGIRVSDTPISTRRDVTTLHALKRFSFKFEELPQEWDNEVFLQS-DNFIKVF 877
            + +++ F  G+ +++     R  + + + L   S+K E L     +   L + +  I VF
Sbjct: 862  RELSRSFQIGVIINNESSINRSSLQSNNILGNLSYKLEPLSTLGSSIPTLNTLEGIIDVF 921

Query: 878  EPISPINSNFEAVPSLSMIDGESIFEFQGYRRMYPDYYCFNKNGDLITGSLYTSGLLERV 937
            E  S  N +  AVP LS+I G SIF + GY+++ P+Y CF+KNG+ ++ SLYTS      
Sbjct: 922  ETRSENNIDLHAVPELSVIKGGSIFNYTGYKKLCPNYTCFDKNGEFLSASLYTSW----- 976

Query: 938  AIQGGDDFNVKRHVENGVLLAAHNSPVDCNERTPETMVEYAERKWLNMCMDPAFMESLR- 996
                        +V NG                PET +     K      +  F+E L+ 
Sbjct: 977  ------------YVPNG-------------SNNPETNINSNCEKE----NEGQFLECLKS 1007

Query: 997  DSRFPHGDLACNADSNVTYFVLDATSWLRHFAHVYKLATNNVLKFAICLTTFQELRFLRK 1056
            D R          D N TYFV DATSWLRH A ++KLA N +LKFAICLTTFQELRFLRK
Sbjct: 1008 DDR--------EIDLNTTYFVFDATSWLRHSARIFKLAQNRLLKFAICLTTFQELRFLRK 1059

Query: 1057 SKDESVVEAATRAVITARQLYYERKLLPLRFTGNIATHLEEHLEFEEQITWRSHVDEFVI 1116
            SKDE+V+EAATR +IT RQLYYE K+LPLRFTGN+ATH+EE+LEFEEQITWR+HVDEFVI
Sbjct: 1060 SKDENVMEAATRGIITIRQLYYENKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVI 1119

Query: 1117 EAVYKSQRKFKGLNLQARDQGQEYIPTDPKDDDKFNFVVLVTDDLNMRTKAEAHDIHIFS 1176
            E++ K+Q K +  N              P    +FN+V+L++DD  M+ KAE   I   S
Sbjct: 1120 ESIMKAQEKLENANQL------------PVSSCRFNYVILISDDDTMKKKAEEKKIKTLS 1167

Query: 1177 SRFMFAFCNQLGYNQKVC 1194
            +RF+F+ C +LG  + +C
Sbjct: 1168 TRFVFSLCTKLGEQRHLC 1185

>Skud_11.336 Chr11 (608311..608769,608800..608948,608994..611952)
            [3567 bp, 1188 aa] {ON} YKR096W (REAL)
          Length = 1188

 Score =  982 bits (2539), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 499/978 (51%), Positives = 657/978 (67%), Gaps = 77/978 (7%)

Query: 240  KHTSQALVQKLQDIYRSIVKQEIELQERCSQLTNSQTTDMKNLWVIYKVNAELINNYISF 299
            K +S AL+QKLQ++Y+ IVKQEIELQERCSQLTNSQTT++K+LW IY++N ELINNY++F
Sbjct: 263  KRSSIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYRINTELINNYVTF 322

Query: 300  ITTALLPSQPEQDLLIGQEIVEIYRVERRLWVYGTITFLDVLKNFSNFMDPEVCCQFISH 359
            ITTALLPSQP  DLLIGQEIVEIYR+ERRLWVYGTITFLDVLKNFSNFMDPEVCCQFI+H
Sbjct: 323  ITTALLPSQPLHDLLIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITH 382

Query: 360  VFMSISNMLGDVPPRYSIPWLERLGDLSRMAIALYPSGFIDWKLSAEHWYSQALIYTYGH 419
            VF+S+S M+ D+P +YSI WL+RLGDLSRMAIALYPS FIDWKLSAEHWY++A+ Y Y H
Sbjct: 383  VFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYIYNH 442

Query: 420  GKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFIPSQQYMQLVIDNIYQRAFAERSGGSSRN 479
            GKLYYHMSTVQQNTLEAFVNLGKSVFCQ+TF PS QYMQLVIDNIYQRAF ER+ G+ RN
Sbjct: 443  GKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNGNLRN 502

Query: 480  FPIVEYLKHSEVMLLPSFLESPELQKVVLTFFQQRFGVWPNNVDFFDHKQIFIQDGEKLR 539
              ++EYLKHSE MLLPSFLESP+LQ VV+++F ++FG+  N  + F+ + +FIQ+ +  +
Sbjct: 503  SLLIEYLKHSEAMLLPSFLESPDLQNVVVSYFVEKFGIDANGCNIFNPEDMFIQNPDFFK 562

Query: 540  YFFSHAPAFAESHILQLVGFGDPRNPFAIXXXXXXXXXXXXXXXXXXXXXXXXXXXTNLD 599
            YFF HAP+FA+SHILQ+VGFG+P+NPFAI                           T   
Sbjct: 563  YFFRHAPSFAQSHILQIVGFGEPKNPFAILFELPKYLKERKDKKERKKSSNNDSSVTESS 622

Query: 600  DGNG-----------SSSISV-DH-----YFENIDSHRVPYSFPQDI--QIWQQSLSYLN 640
             GN            SS+ S+ DH     +F +ID+ R P   P  +  + W ++L +LN
Sbjct: 623  TGNSRNDNNDDDEIMSSTASISDHDFLAEFFNDIDTLRRPI-LPSMLTSEAWLETLKFLN 681

Query: 641  LTSMECSMSVLKKFXXXXXXXXXXXXXXXXXFLVSVAIRISSLSSDALKKFWLVFMRRIF 700
            +TS++C M VL+KF                 F+++  ++ + LS    K FW++ ++R+F
Sbjct: 682  MTSLKCGMIVLRKFLHGPLGIALPHILPWIYFIIATCLKSNQLSDPTSKDFWMIIVKRVF 741

Query: 701  PWNSLVSFLNTLMAFLLDNSRNMSSVEKLCEEYNKMDLHTLVEHFTNSEELPEVWKCWGT 760
            PW+++V+F+N L+A+LLDN      + +LC +Y  ++L  L+E F  SEELPE+W CWGT
Sbjct: 742  PWDTIVTFMNVLIAYLLDNEALNPIIGELCSKYGTLNLAGLLESFNESEELPEIWNCWGT 801

Query: 761  LWFDTISNKSELKASS---VQSTGIRDHLFLDAPIDGICFDQDDESGLKFWKRACRVIFM 817
            LWFDTI  K+    SS    Q  GI+D++ LDAP DGI FD  DESG KFWKRACR+IF+
Sbjct: 802  LWFDTICQKNAHSISSDDNFQEIGIKDYMALDAPTDGIIFDDKDESGEKFWKRACRIIFL 861

Query: 818  FKGMAKEFHYGIRVSDTPISTRRDVTTLHALKRFSFKFEELPQEWDNEVFLQS-DNFIKV 876
            F+ +++ F  G+ VS+ P+       +   L+   +K E L     N   L + +N + +
Sbjct: 862  FRELSRTFPIGVIVSNDPLIKCSSSQSSIILRNLVYKLEPLSNIRSNTPILTALENSVDI 921

Query: 877  FEPISPINSNFEAVPSLSMIDGESIFEFQGYRRMYPDYYCFNKNGDLITGSLYTSGLLER 936
             E  S  N +  AVP LS+  G++IF + GY+++ PDY CF++NG+ ++ SLYT      
Sbjct: 922  SEARSKNNIDLYAVPELSVNSGDNIFHYTGYKKLRPDYTCFDRNGEFLSASLYT------ 975

Query: 937  VAIQGGDDFNVKRHVENGVLLAAHNSPVDCNERTPETMVEYAERKWLNMCMDPAFMESLR 996
                       + ++ NG          + +E    + +E  +      CM P       
Sbjct: 976  -----------RWYLPNG---------NNISEALVNSDIEKGDEDLFLECMKPD------ 1009

Query: 997  DSRFPHGDLACNADSNVTYFVLDATSWLRHFAHVYKLATNNVLKFAICLTTFQELRFLRK 1056
                         D   TYFV DATSWLRH A ++KLA N +LKFAICLTTFQELRFLRK
Sbjct: 1010 ---------CPGIDFETTYFVFDATSWLRHSARIFKLAQNRLLKFAICLTTFQELRFLRK 1060

Query: 1057 SKDESVVEAATRAVITARQLYYERKLLPLRFTGNIATHLEEHLEFEEQITWRSHVDEFVI 1116
            SKDE+V+EAATR +IT RQLYYE K+LPLRFTGN+ATH+EE+LEFEEQITWR+HVDEFVI
Sbjct: 1061 SKDENVMEAATRGIITIRQLYYEDKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVI 1120

Query: 1117 EAVYKSQRKFKGLNLQARDQGQEYIPTDPKDDDKFNFVVLVTDDLNMRTKAEAHDIHIFS 1176
            E++ K+Q K +       + GQ ++   P+     N+VVL++DD  M+ KAE  +I   S
Sbjct: 1121 ESIKKAQEKLE-------NAGQPHV--TPRHS---NYVVLISDDDTMKKKAEEKEIKTLS 1168

Query: 1177 SRFMFAFCNQLGYNQKVC 1194
            ++F+F+ C +LG  + +C
Sbjct: 1169 TKFVFSLCTKLGEKRHLC 1186

>CAGL0G02541g Chr7 (231428..235315) [3888 bp, 1295 aa] {ON} similar to
            uniprot|P36168 Saccharomyces cerevisiae YKR096w
          Length = 1295

 Score =  981 bits (2536), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 509/965 (52%), Positives = 662/965 (68%), Gaps = 47/965 (4%)

Query: 243  SQALVQKLQDIYRSIVKQEIELQERCSQLTNSQTTDMKNLWVIYKVNAELINNYISFITT 302
            +QALVQKLQDIY++IV+QE+ELQE+C+QLT+SQTTD+ ++W IY++N EL+ NY++FI+T
Sbjct: 367  TQALVQKLQDIYKNIVRQEVELQEKCAQLTSSQTTDLNSIWSIYRINVELVTNYVTFIST 426

Query: 303  ALLPSQPEQDLLIGQEIVEIYRVERRLWVYGTITFLDVLKNFSNFMDPEVCCQFISHVFM 362
            ALL SQ + DL+IGQEIVE YR+ RRLWVYGTITFLDVLKNFS+FMDPEVC QFI+HVF+
Sbjct: 427  ALLSSQSQYDLMIGQEIVETYRIGRRLWVYGTITFLDVLKNFSSFMDPEVCSQFITHVFI 486

Query: 363  SISNMLGDVPPRYSIPWLERLGDLSRMAIALYPSGFIDWKLSAEHWYSQALIYTYGHGKL 422
            SIS ML D+P +YSIPW++RLGDLSRMAIALYPSGFIDWKLS+E+WY+QAL YTYG+GKL
Sbjct: 487  SISTMLADIPTKYSIPWMQRLGDLSRMAIALYPSGFIDWKLSSEYWYNQALKYTYGYGKL 546

Query: 423  YYHMSTVQQNTLEAFVNLGKSVFCQDTFIPSQQYMQLVIDNIYQRAFAERSGGSSRNFPI 482
            YYHMST+QQNTLEAFVNLGKSVFCQDTFIPS QYMQLVIDNIYQRAF ER   ++RN  +
Sbjct: 547  YYHMSTIQQNTLEAFVNLGKSVFCQDTFIPSPQYMQLVIDNIYQRAFIERGSNNTRNSQL 606

Query: 483  VEYLKHSEVMLLPSFLESPELQKVVLTFFQQRFGVWPNNVDFFDHKQIFIQDGEKLRYFF 542
            +EYLKHSEVMLLP+F+ +  LQKVV+T+F+ +FG   ++++ F  + IF+Q+ E L+YFF
Sbjct: 607  IEYLKHSEVMLLPNFIGNENLQKVVMTYFEHKFGTDLHDLNIFQPRDIFLQNPENLKYFF 666

Query: 543  SHAPAFAESHILQLVGFGDPRNPFAIXXXXXXXXXXXXXXXXXXXXXXXXXXXTN----- 597
             HAPAFAESHILQ VGFGD +NPFA+                           +N     
Sbjct: 667  RHAPAFAESHILQTVGFGDSKNPFALLFDLPKFLKEKKDKKDRKKTKSSGEPTSNESVMS 726

Query: 598  LDDGNGSSSISVDHYFENIDSHRVPYSFPQDIQIWQQSLSYLNLTSMECSMSVLKKFXXX 657
            LD+ +  S IS D YF N++S + PY  P    IW +SLSYLNLT+++C + VL+KF   
Sbjct: 727  LDNISTDSLISSDQYFSNLESMQHPYLPPPRYDIWLKSLSYLNLTAVQCGVIVLRKFLHG 786

Query: 658  XXXXXXXXXXXXXXFLVSVAIRISSLSSDALKKFWLVFMRRIFPWNSLVSFLNTLMAFLL 717
                          F++SV ++  +L  +  + FW  FMRR+ P NS+VSFLN L+A+ L
Sbjct: 787  PFVVALPHLMVWTYFIISVCLKSETLVDEESRYFWSSFMRRLLPLNSIVSFLNVLIAYAL 846

Query: 718  DNSRNMSSVEKLCEEYNKMDLHTLVEHFTNSEELPEVWKCWGTLWFDTISNKSELKASSV 777
            DNS   + +  + EE + MDL  L+  F N+EELPEVWKCWGTLWFD I++KS    +S 
Sbjct: 847  DNSYYSTLISSISEELDSMDLQELLTKFNNNEELPEVWKCWGTLWFDAITDKSNTDTNSY 906

Query: 778  QSTGIRDHLFLDAPIDGICFDQDDESGLKFWKRACRVIFMFKGMAKEFHYGIRVSDT-PI 836
            +  G+ DHLF D+PIDGI FD  DE+G KFWKRA R+IF+FK +A+ F  GI +S T P+
Sbjct: 907  EKIGVSDHLFFDSPIDGIVFDSKDENGEKFWKRALRIIFLFKKIAETFDIGITLSHTAPV 966

Query: 837  STRRDVTTL-HALKRFSFKFEELPQEWDNEVFLQSDN----FIKVFEPISPINSNFEAVP 891
              RRD   L H L  FSFK E+      N V ++ +N     I++ E  + +N   +A P
Sbjct: 967  YCRRDDVELNHILGSFSFKIEQHLLN-GNTVQVEIENCLGAIIEMTEMPNEVNITMDATP 1025

Query: 892  SLSMIDGESIFEFQGYRRMYPDYYCFNKNGDLITGSLYTSGLLERVAIQGGDDFNVKRHV 951
             +S+ + E+IFE+ GY+R+ P+   F+KNG+L + + YTS    +  +            
Sbjct: 1026 PMSLQENENIFEYTGYKRIAPELQNFDKNGELRSAANYTSWYSAQEIVPKS-----AASP 1080

Query: 952  ENGVLLAAHNSPVDCNERTPETMVEYAERKWLNMCMDPAFMESLRDSRFPHGDLACNADS 1011
            EN V   A +SP                R + +  ++        +       L    + 
Sbjct: 1081 ENSV---AGSSP---------------GRSFQSQDVEENIFSVFTNEEENSTSLLDGLNL 1122

Query: 1012 NVTYFVLDATSWLRHFAHVYKLATNNVLKFAICLTTFQELRFLRKSKDESVVEAATRAVI 1071
              T FVLDATSWLRH AH+YKLA+N+ L F+ICLTTFQELRFLRKSKDE+V+EAA RA+I
Sbjct: 1123 ETTSFVLDATSWLRHSAHIYKLASNSFLVFSICLTTFQELRFLRKSKDENVMEAAARAII 1182

Query: 1072 TARQLYYERKLLPLRFTGNIATHLEEHLEFEEQITWRSHVDEFVIEAVYKSQRKFKGLNL 1131
              RQLY + K++PLRFTGNIATH+EEHLEFEEQITWRSHVDEFVIE++ K+Q+KF    L
Sbjct: 1183 IIRQLYSDGKVIPLRFTGNIATHIEEHLEFEEQITWRSHVDEFVIESISKAQKKF----L 1238

Query: 1132 QARDQGQEYIPTDPKDDDKFNFVVLVTDDLNMRTKAEAHDIHIFSSRFMFAFCNQLGYNQ 1191
            Q   Q       +P D+D   F VLV+DD NM+ KA   +I  F++RF+FA C+++G  +
Sbjct: 1239 QPFVQ-------NPVDNDS-RFFVLVSDDENMKRKAHEKEIRTFTTRFVFALCSEMGKGR 1290

Query: 1192 KVCIN 1196
             +C N
Sbjct: 1291 LICTN 1295

>YKR096W Chr11 (626793..630380) [3588 bp, 1195 aa] {ON} Protein of
            unknown function that may interact with ribosomes, based
            on co-purification experiments; green fluorescent protein
            (GFP)-fusion protein localizes to the nucleus and
            cytoplasm; predicted to contain a PINc domain
          Length = 1195

 Score =  969 bits (2506), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 495/979 (50%), Positives = 665/979 (67%), Gaps = 78/979 (7%)

Query: 240  KHTSQALVQKLQDIYRSIVKQEIELQERCSQLTNSQTTDMKNLWVIYKVNAELINNYISF 299
            K +  AL+QKLQ++Y+ IVKQEIELQERCSQLTNSQTT++K+LW IYK+N +L+NNY++F
Sbjct: 269  KRSGIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYKINTDLVNNYVTF 328

Query: 300  ITTALLPSQPEQDLLIGQEIVEIYRVERRLWVYGTITFLDVLKNFSNFMDPEVCCQFISH 359
            ITTALLPSQP  DL+IGQEIVEIYR+ERRLWVYGTITFLDVLKNFSNFMDPEVCCQFI+H
Sbjct: 329  ITTALLPSQPPHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITH 388

Query: 360  VFMSISNMLGDVPPRYSIPWLERLGDLSRMAIALYPSGFIDWKLSAEHWYSQALIYTYGH 419
            VF+S+S M+ D+P +YSI WL+RLGDLSRMAIALYPS FIDWKLSAEHWY++A+ Y Y H
Sbjct: 389  VFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYIYNH 448

Query: 420  GKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFIPSQQYMQLVIDNIYQRAFAERSGGSSRN 479
            GKLYYHMSTVQQNTLEAFVNLGKSVFCQ+TF PS QYMQLVIDNIYQRAF ER+ G+ RN
Sbjct: 449  GKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNGNLRN 508

Query: 480  FPIVEYLKHSEVMLLPSFLESPELQKVVLTFFQQRFGVWPNNVDFFDHKQIFIQDGEKLR 539
              ++EYLKHSE MLLPSFLESP+LQ VVL++F ++FG+  N  + F+ + +F+Q+ +  +
Sbjct: 509  SLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFIEKFGIDANGCNIFNAEDMFVQNPDFFK 568

Query: 540  YFFSHAPAFAESHILQLVGFGDPRNPFAIXXXXXXXXXXXXXXXXXXXXXXXXXXXTNLD 599
            YFF H P+FA+SHILQ+VGFG+P+NPFAI                           T   
Sbjct: 569  YFFRHGPSFAQSHILQIVGFGEPKNPFAILFELPKYLKERKDKKERKKSSNNDSSVTESS 628

Query: 600  DGNG-----------SSSISV-DH-----YFENIDSHRVPYSFPQDI--QIWQQSLSYLN 640
             GN            SS+ S+ DH     +F +ID+ R P   P  +  + W ++L +LN
Sbjct: 629  TGNSRNDNEDDDEIMSSTTSISDHDLLAEFFNDIDTLRRPI-LPSMLTNEAWLETLKFLN 687

Query: 641  LTSMECSMSVLKKFXXXXXXXXXXXXXXXXXFLVSVAIRISSLSSDALKKFWLVFMRRIF 700
            +TS++C + VL+KF                 F++S+ ++ S LS    K+FW++ ++R F
Sbjct: 688  MTSLKCGIIVLRKFLHGPLGIALPHILPWIYFIISICLKSSQLSDPVSKEFWMIIVKRAF 747

Query: 701  PWNSLVSFLNTLMAFLLDNSRNMSSVEKLCEEYNKMDLHTLVEHFTNSEELPEVWKCWGT 760
            PW+++V+F+N L+ +LLDN  + S +  LC++Y+K+ L  L+E F   EELPE+  CWGT
Sbjct: 748  PWDTMVTFMNVLIVYLLDNQTSNSIIGDLCDDYDKLSLSELLELFNEGEELPEILGCWGT 807

Query: 761  LWFDTISNKSELKASS---VQSTGIRDHLFLDAPIDGICFDQDDESGLKFWKRACRVIFM 817
            LWFDTI  K+    SS    Q  GI+D++ LD+P DGI FD+ DE+G KFWKRACR IF+
Sbjct: 808  LWFDTICEKNTHSISSEDNFQEIGIKDYMALDSPTDGIIFDEKDENGEKFWKRACRTIFL 867

Query: 818  FKGMAKEFHYGIRVSDTPISTRRDVTTLHALKRFSFKFEELPQEWDNEVFLQS-DNFIKV 876
            F+ +++ F  G+ + + P+  R      + L    FK E L    +N   L + ++ I +
Sbjct: 868  FRELSRSFPIGVIIRNDPLIYRSSFQNTNILGSLVFKLEPLCNIHNNIPVLGALESIIDI 927

Query: 877  FEPISPINSNFEAVPSLSMIDGESIFEFQGYRRMYPDYYCFNKNGDLITGSLYTSGLLER 936
             E  S  N++  AVP LS+ +G++IF + GY+++  DY CF+KNG+ ++ SLYT+     
Sbjct: 928  SEARSENNTDLHAVPELSVNEGDNIFHYVGYKKLRADYTCFDKNGEFLSASLYTTWY--- 984

Query: 937  VAIQGGDDFNVKRHVENGVLLAAHNSPVDCNERTPETMVEYAERKWLNMCMDPAFMESLR 996
              +   ++ N++ ++        +NS     E+  E +                F+E ++
Sbjct: 985  --VPNSNNTNIEDNIN-------YNS-----EKENEGL----------------FLECIK 1014

Query: 997  DSRFPHGDLACNADSNVTYFVLDATSWLRHFAHVYKLATNNVLKFAICLTTFQELRFLRK 1056
             S +P  D         TYFV DATSWLRH A ++KLA N +L+FAICLTTFQELRFLRK
Sbjct: 1015 -SDYPEIDFK------TTYFVFDATSWLRHSARIFKLAQNRLLRFAICLTTFQELRFLRK 1067

Query: 1057 SKDESVVEAATRAVITARQLYYERKLLPLRFTGNIATHLEEHLEFEEQITWRSHVDEFVI 1116
            SKDE+V+EAATR +IT RQLYYE K+LPLRFTGN+ATH+EE+LEFEEQITWR+HVDEFVI
Sbjct: 1068 SKDENVMEAATRGIITIRQLYYENKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVI 1127

Query: 1117 EAVYKSQRKFKGLNLQARDQGQEYIPTDPK-DDDKFNFVVLVTDDLNMRTKAEAHDIHIF 1175
            E+V K+Q K +               ++P+    +FN+VVL++DD  M+ KAE  +I   
Sbjct: 1128 ESVMKAQEKLES-------------ASEPRLSPRRFNYVVLISDDDAMKKKAEEKEIKTL 1174

Query: 1176 SSRFMFAFCNQLGYNQKVC 1194
            S+RF+F+ C +LG  + +C
Sbjct: 1175 STRFVFSLCTKLGEQRHLC 1193

>NCAS0A03170 Chr1 complement(621400..625359) [3960 bp, 1319 aa] {ON}
            Anc_5.706 YIL151C
          Length = 1319

 Score =  954 bits (2467), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 517/1049 (49%), Positives = 671/1049 (63%), Gaps = 115/1049 (10%)

Query: 240  KHTSQALVQKLQDIYRSIVKQEIELQERCSQLTNSQTTDMKNLWVIYKVNAELINNYISF 299
            K T +ALV+KLQDIY+ IVKQEIELQERCSQLT SQTTD+KNLW IYKVN +LINNY++F
Sbjct: 294  KKTGEALVRKLQDIYKVIVKQEIELQERCSQLTTSQTTDLKNLWTIYKVNIDLINNYVTF 353

Query: 300  ITTALLPSQPEQDLLIGQEIVEIYRVERRLWVYGTITFLDVLKNFSNFMDPEVCCQFISH 359
            ITTALL SQ +QDL IG+EI+EIYR+ERRLWVYGTITFLDVLKNFSNFMDPEVCCQFI+H
Sbjct: 354  ITTALLSSQSQQDLHIGEEIIEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITH 413

Query: 360  VFMSISNMLGDVPPRYSIPWLERLGDLSRMAIALYPSGFIDWKLSAEHWYSQALIYTYGH 419
            VF+S+S ML D+P +YSIPWL+RLGDLSRMAIALYPSGFIDWKLSAE WY +A+ +TY H
Sbjct: 414  VFISLSTMLADIPTKYSIPWLQRLGDLSRMAIALYPSGFIDWKLSAEEWYMEAMKFTYNH 473

Query: 420  GKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFIPSQQYMQLVIDNIYQRAFAERSGGSSRN 479
            GKLYYHMSTVQQNTLEAFVNLGKSVFCQ+TF PSQQYMQLVIDNIYQRAF ER+ G++RN
Sbjct: 474  GKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAFVERNNGNNRN 533

Query: 480  FPIVEYLKHSEVMLLPSFLESPELQKVVLTFFQQRFGVWP----------------NN-- 521
              ++EYLKHSEVMLLP+FLE+ ELQ+VVL +FQ++FG+                  NN  
Sbjct: 534  LQLIEYLKHSEVMLLPTFLENSELQQVVLLYFQEKFGILEVTIPSTSETISINTMNNNTR 593

Query: 522  -VDFFDHKQIFIQDGEKLRYFFSHAPAFAESHILQLVGFGDPRNPFAIX----------- 569
             +D F  + +FIQ+ E+L+YFF HAPAFAESHILQLVGFGDP+NPFA+            
Sbjct: 594  TIDMFRSRDMFIQNPEQLKYFFRHAPAFAESHILQLVGFGDPKNPFALLFELPKYLKERK 653

Query: 570  ---------------XXXXXXXXXXXXXXXXXXXXXXXXXXTNLDDGNGSSSISVDHYFE 614
                                                      NL   N  + ++ + +F+
Sbjct: 654  DKKEKKKSKSNSNSNNNNNASTAGDGSMMSIDNSEMGEDDINNLFSDNVMNQVTSEEFFQ 713

Query: 615  NIDSHRVPYSFPQDIQIWQQSLSYLNLTSMECSMSVLKKFXXXXXXXXXXXXXXXXXFLV 674
            NI+  R  Y  P  ++IW  SL+++NL S++CSM VLKKF                 F++
Sbjct: 714  NIEQLRFDYFIPNSLEIWMASLNHINLISLKCSMIVLKKFLHGPLLIALPHLLPWCYFII 773

Query: 675  SVAIRISSLSSDALKKFWLVFMRRIFPWNSLVSFLNTLMAFLLDN-------------SR 721
            S+ ++   L+ +  K FW+  ++ IFPWN +++FLN L+ + LDN              +
Sbjct: 774  SILLKREGLTHEDSKIFWIGILKTIFPWNDIINFLNVLLRYTLDNIGLPTPSAVNDTKQK 833

Query: 722  NMSS-VEKLCEEYNKMDLHTLVEHFTNSEELPEVWKCWGTLWFDTISNKSELKASSVQST 780
            +M+  +  LC +Y+ M    L++HF  +E+LPEVWKCWGTLWFDTISNK+ + A S ++ 
Sbjct: 834  DMNVFILDLCNKYSTMGFADLLQHFNENEDLPEVWKCWGTLWFDTISNKNGMDADSFENL 893

Query: 781  GIRDHLFLDAPIDGICFDQDDESGLKFWKRACRVIFMFKGMAKEF-HYGIRVSDTPISTR 839
            GI+DH+FLD PIDGI +  +DE+G  FWKR  R+IF+FKG+A+ F   G++VS    +  
Sbjct: 894  GIKDHMFLDFPIDGIGYVLEDETGENFWKRTLRIIFLFKGIAENFDSLGLKVSYNAGTEY 953

Query: 840  RD--VTTLHALKRFSFKF-------------EELPQEWDNEVFLQSDNFIKVFEPISPIN 884
            R+  V   + LK FSFK+             +EL + + N +  +   F+ + EPI   N
Sbjct: 954  RNNNVPMDNILKMFSFKWAGSNADYVDANLGDEL-EIYTNTIINRITEFVDIKEPIHETN 1012

Query: 885  SNFEAVPSLSMIDGESIFEFQGYRRMYPDYYCFNKNGDLITGSLYTSGLLERVAIQGGDD 944
             NFE  P  SMI  E IF++ GY+++ P+   F+KNG+      ++SG +        D 
Sbjct: 1013 LNFEIPPLKSMIANEDIFDYTGYKKLEPNSRSFDKNGE------FSSGSIYTAWPMDYDQ 1066

Query: 945  FNVKRHVENGVLLAAHNSPVDCNERTPETMVEYAERKWLNMCMDPAFMESLRDSRFPHGD 1004
              + ++        A +   D    T              + +D      L+   F    
Sbjct: 1067 LILAQNNN--NNTNATDEMTDLFTGT--------------LSIDELSFRQLKRPEFRDKS 1110

Query: 1005 LACNADSN------VTYFVLDATSWLRHFAHVYKLATNNVLKFAICLTTFQELRFLRKSK 1058
               ++ S        TYFV DATSWLRHFAH+YKLA+N+VLKFA+CLTTFQELRFLRKSK
Sbjct: 1111 TLLSSTSTEPFNRYKTYFVFDATSWLRHFAHIYKLASNHVLKFAVCLTTFQELRFLRKSK 1170

Query: 1059 DESVVEAATRAVITARQLYYERKLLPLRFTGNIATHLEEHLEFEEQITWRSHVDEFVIEA 1118
            D +VVEA+TRA+IT RQLY +  LLPLRFTGN+AT +EEHLEFEEQITWRSHVDEFVIEA
Sbjct: 1171 DANVVEASTRAIITMRQLYSDGNLLPLRFTGNVATDIEEHLEFEEQITWRSHVDEFVIEA 1230

Query: 1119 VYKSQRKFKGL----NLQARDQGQEYIPT-------DPKDDDKFNFVVLVTDDLNMRTKA 1167
            V K+Q KF       N++      E   T       + +  + F +VVL+TDD +MR KA
Sbjct: 1231 VMKAQEKFVKSKTVENMEGTSNWGEIDATTTTVSAEEEEKSNLFKYVVLITDDDSMRMKA 1290

Query: 1168 EAHDIHIFSSRFMFAFCNQLGYNQKVCIN 1196
            +   I  F ++ +F+ C+ +G ++ VC N
Sbjct: 1291 QLKGISTFGTQVVFSVCSMMGIDEGVCTN 1319

 Score = 37.0 bits (84), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 32/111 (28%), Positives = 47/111 (42%), Gaps = 11/111 (9%)

Query: 30  LHQKRHXXXXXXXXXXGYAKRR----PNTLSQNVSQNDELAASAA---CFLDSNLTPSKH 82
           + QKRH            A +R    P  +S     N E   +       +    TPSK 
Sbjct: 52  IRQKRHSSNSYSNAKNNPAVKRRIAKPEEVSLKYIDNMEYGTATTGNNSIICQQQTPSKG 111

Query: 83  QECT-PSSFQRATDETPQP--FYPADTPQSPFYLPTTS-SSNLEAASKVIT 129
                PS  ++  + TPQP  +  ++ P SPFYLP  S S+N E +  ++T
Sbjct: 112 TLSRRPSLIKKQMNSTPQPMSYVVSEVPASPFYLPANSFSNNYERSPALLT 162

>TPHA0E00190 Chr5 complement(20436..24521) [4086 bp, 1361 aa] {ON}
            Anc_5.706 YIL151C
          Length = 1361

 Score =  928 bits (2399), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 496/1021 (48%), Positives = 660/1021 (64%), Gaps = 85/1021 (8%)

Query: 232  IPIVNVPPKHTSQALVQKLQDIYRSIVKQEIELQERCSQLTNSQTTDMKNLWVIYKVNAE 291
            IP V+VP + +SQ LVQKLQDIY++IVKQEIELQERC +LTNSQTT++KNLW IY+VN+E
Sbjct: 370  IPSVSVPLRKSSQVLVQKLQDIYKTIVKQEIELQERCGRLTNSQTTELKNLWTIYRVNSE 429

Query: 292  LINNYISFITTALLPSQPEQDLLIGQEIVEIYRVERRLWVYGTITFLDVLKNFSNFMDPE 351
            L++NYI+FITTA+ P+QPE D  IG+EI+EIY++ERRLWVYGTITFLD+LKNFSNFMDPE
Sbjct: 430  LVDNYITFITTAIHPTQPESDQQIGKEIIEIYKIERRLWVYGTITFLDLLKNFSNFMDPE 489

Query: 352  VCCQFISHVFMSISNMLGDVPPRYSIPWLERLGDLSRMAIALYPSGFIDWKLSAEHWYSQ 411
            VCCQFI HVF+SISNML D+P +Y + W ++LGDLSRMAIALYPS FIDWKLSAE WY  
Sbjct: 490  VCCQFIFHVFISISNMLADIPQKYRVSWYQKLGDLSRMAIALYPSNFIDWKLSAERWYMA 549

Query: 412  ALIYTYGHGKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFIPSQQYMQLVIDNIYQRAFAE 471
            A+ +TYGHGKLYYHMSTVQQNTLEAFVNLGKS+FC++TF+PSQQY+QLVI NIYQRA+A+
Sbjct: 550  AMEFTYGHGKLYYHMSTVQQNTLEAFVNLGKSLFCKNTFVPSQQYLQLVIGNIYQRAYAD 609

Query: 472  --RSGGSSRNFPIVEYLKHSEVMLLPSFLESPELQKVVLTFFQQRFGVWPNNV--DFFDH 527
               S     +  +V+Y+KH EV LLP+F ES ELQ+VVL +F  +FGV  NN   + F  
Sbjct: 610  SNNSNNGRNDQLLVDYIKHCEVTLLPNFKESQELQQVVLMYFIDKFGVDYNNSSNNMFIS 669

Query: 528  KQIFIQDGEKLRYFFSHAPAFAESHILQLVGFGDPRNPFAIXXXXXXXXXXXXXXXXXXX 587
            +++F+Q+ ++ + F+ ++ AFAES ILQ+VG+G+ ++PF++                   
Sbjct: 670  RKMFVQNNDQFKCFYRYSAAFAESQILQIVGYGNLKSPFSLLFELPKYLKDRKEKKEKRK 729

Query: 588  XXXXXXXX------------TNLDD-GNGSSSISVDHYFENIDSHRVPYSFPQDIQIWQQ 634
                                T L    N +  ++ + +FENID+   P   P  + IW  
Sbjct: 730  PKTMLILKITQPRLYHRWVGTTLPTMPNNNVFLTAEEFFENIDTINYPSFMPNSVDIWNH 789

Query: 635  SLSYLNLTSMECSMSVLKKFXXXXXXXXXXXXXXXXXFLVSVAIRISSLSSDALKKFWLV 694
            SL Y N  S++CSM V KKF                 F++S+ +++    + A+ +FW+ 
Sbjct: 790  SLQYANHVSIKCSMIVWKKFLHAPFMIALPHTLPWCYFIISIVLQLDKHKNVAMNEFWVE 849

Query: 695  FMRRIFPWNSLVSFLNTLMAFLLDNSRNMSSVEKLCEEYNKMDLHTLVEHFTNSEELPEV 754
            F+RRIFPWNS+V FLN L+A+++DN    S + +LC  YN M L  L+ +F  +EELPEV
Sbjct: 850  FVRRIFPWNSIVKFLNVLLAYMVDNCWEQSILNELCPFYNSMSLDELLTYFNENEELPEV 909

Query: 755  WKCWGTLWFDTISNKSELKA--------------SSVQSTGIRDHLFLDAPIDGICFDQD 800
            WKC G+LWFDTI  KS L                +  +  G++D+ F D PIDG  FD+ 
Sbjct: 910  WKCRGSLWFDTIMEKSNLNKDKNPEVINGSDFNINDYKGNGVKDYKFFDFPIDGTDFDES 969

Query: 801  DESGLKFWKRACRVIFMFKGMAKEFH--YGIRVS-DTPISTRRD-----VTTLHALKRFS 852
            DE G +FWKRA RVIF+FK +A+ +    G+ +S + P+  RR       T    L  FS
Sbjct: 970  DEIGERFWKRAARVIFLFKKLAESYTGLGGLILSYEAPVFNRRKDEYKVNTVCQELLEFS 1029

Query: 853  FKFEELPQEWDNEVFLQSDNFIKVFEPISPINSNFEAVPSLSMIDGESIFEFQGYRRMYP 912
            FK         + V L  D+ I+ FE    +N +    P LSM+DG+SIF++ GY+R+ P
Sbjct: 1030 FKLNAS----SDGVML--DDIIESFETPDEVNYDTHKTPMLSMVDGDSIFDYVGYKRVCP 1083

Query: 913  DYYCFNKNGDLITGSLYTS-------GLLERVAIQGGDDFNVKRHVENGVLLAAHNSPVD 965
            ++Y F+KNGD I+ S + S         L R       D  +     N    A+ N    
Sbjct: 1084 NFYSFDKNGDFISTSFFNSWSIKNLTNELSRNTCSSITDDAISSGSGNDSAAASTN---- 1139

Query: 966  CNERTPETMVEYAERKWLNMCMDPAFMESLRDSRFPHGDLACNADSNV-----TYFVLDA 1020
             N+   E +V        N C DP + ++L +  F   ++  ++ +N+     TYF+LDA
Sbjct: 1140 -NDPMNELLV-------FNECFDPKY-KTLEE--FWSQEIYPDSQTNISLQGKTYFILDA 1188

Query: 1021 TSWLRHFAHVYKLATNNVLKFAICLTTFQELRFLRKSKDESVVEAATRAVITARQLYYER 1080
            TSWLRHFAH+YK+AT+ +LKFAICLTTFQELR+LRKSKD +VVEAATRA+IT RQLY+E 
Sbjct: 1189 TSWLRHFAHIYKIATSKILKFAICLTTFQELRYLRKSKDHNVVEAATRAIITLRQLYHEN 1248

Query: 1081 KLLPLRFTGNIATHLEEHLEFEEQITWRSHVDEFVIEAVYKSQRKFKGLNLQARDQGQEY 1140
             LLPLRFTGN+ATH+EEHLEFEEQITWRSHVDEFVIEAV K++ K      +        
Sbjct: 1249 NLLPLRFTGNVATHIEEHLEFEEQITWRSHVDEFVIEAVLKAEEK------RTDRLNDIN 1302

Query: 1141 IPTDPKDDDKFNFVVLVTDDLNMRTKAEAHDIHIFSSRFMFAFCNQL-----GYNQKVCI 1195
            + TD K+   F  ++LVTDD+ M+ KA    I  FS+RF+F+  N +     G+N K+ I
Sbjct: 1303 MDTDEKEKSIFG-IILVTDDITMKNKAMDRKIKTFSTRFIFSMANYIRTMEEGHN-KLAI 1360

Query: 1196 N 1196
            N
Sbjct: 1361 N 1361

>CAGL0H06611g Chr8 (653472..657320) [3849 bp, 1282 aa] {ON} similar to
            uniprot|P36168 Saccharomyces cerevisiae YKR096w
          Length = 1282

 Score =  917 bits (2369), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 508/1169 (43%), Positives = 710/1169 (60%), Gaps = 127/1169 (10%)

Query: 104  ADTPQSPFYLPTTSSSNL----EAASKVITNDNSSVQLPDICIDNXXXXXXXXXXXXXXX 159
             D P SPFYLPT + SN+    +A + +   ++S V+   I  +                
Sbjct: 165  VDIPGSPFYLPTRTHSNILETTQADAPLHPVNSSEVEQESIGPE-------LNLIEEQYN 217

Query: 160  VNHDDKKITRNAANGEQKESITDELQGTDNTPHEQSSNTHADTNQQSDQHNXXXXXXXXX 219
             N ++ +I  N    + +   T +     +T +E+ + T A T+ QS             
Sbjct: 218  SNLENGEINYNTEVSDFESLPTKDANSVTSTEYEKGTRT-AMTSHQS------------- 263

Query: 220  XXXXENNRENSGIPIVNVPPKHTSQALVQKLQDIYRSIVKQEIELQERCSQLTNSQTTDM 279
                          I+      ++QAL+ KLQDIY+SI+ QE+ELQ  CS +T+SQTTD+
Sbjct: 264  --------------ILPTTWNRSTQALISKLQDIYKSILVQEVELQNCCSAITSSQTTDL 309

Query: 280  KNLWVIYKVNAELINNYISFITTALLPSQPEQDLLIGQEIVEIYRVERRLWVYGTITFLD 339
            K +W +YK+N EL+NNY+ FITTALLPSQ + DLLIGQEI+++Y++ERRLWVYGTITFLD
Sbjct: 310  KKIWEVYKINVELVNNYVIFITTALLPSQSQTDLLIGQEIIDVYKIERRLWVYGTITFLD 369

Query: 340  VLKNFSNFMDPEVCCQFISHVFMSISNMLGDVPPRYSIPWLERLGDLSRMAIALYPSGFI 399
            VLK+FSNFMDPE+CCQFI HVF+SI+NM   +P ++SIPW  RLGDLSRMA ALYP G  
Sbjct: 370  VLKHFSNFMDPEICCQFIIHVFISIANMSDYIPKKFSIPWFSRLGDLSRMATALYPPGAT 429

Query: 400  DWKLSAEHWYSQALIYTYGHGKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFIPSQQYMQL 459
            DWKLSAE+WY +A+ YTYG GKLYYHM+TVQQN+L AF+NLGKSVFC+D F+P+QQY+QL
Sbjct: 430  DWKLSAEYWYGEAMKYTYGVGKLYYHMATVQQNSLAAFINLGKSVFCRDAFVPTQQYLQL 489

Query: 460  VIDNIYQRAFAERSGGSSRNFPIVEYLKHSEVMLLPSFLESPELQKVVLTFFQQRFGVWP 519
            VIDNIYQRA+  R   SS N  I++YLKH+E+M+LP+F+E+ ELQ++   +F ++FG   
Sbjct: 490  VIDNIYQRAYISRGEESSSNVQILDYLKHNEIMVLPNFMENFELQRMAYVYFSEKFGQDF 549

Query: 520  NNVDFFDHKQIFIQDGEKLRYFFSHAPAFAESHILQLVGFGDPRNPFAIXXXXXXXXXXX 579
               +FFD + +F+Q+ E ++++F H+P FA++HILQ+VG+G+  N FA+           
Sbjct: 550  VGNNFFDTRSMFVQNLESVKFYFRHSPLFAQAHILQVVGYGNIGNAFAL------LYELP 603

Query: 580  XXXXXXXXXXXXXXXXTNLDDG---------NGSSSISVDHYFENIDSHRVPYSFPQDIQ 630
                            T +D+          +G+    V  YF ++++    ++ P ++ 
Sbjct: 604  KFIKDNEISRQRKKSKTGVDNMSIDTLSFQVSGNEIHDVGEYFNSLENIDKEFTLPPNVD 663

Query: 631  IWQQSLSYLNLTSMECSMSVLKKFXXXXXXXXXXXXXXXXXFLVSVAIRISSLSSDALKK 690
            IW QSL Y N T + C M VL+KF                 FL+SVA +I +L     + 
Sbjct: 664  IWIQSLQYTNTTGIFCGMMVLQKFLQGPFVTALPHLLPWVYFLISVAFKIETLRDTNSQY 723

Query: 691  FWLVFMRRIFPWNSLVSFLNTLMAFLLDNSRNMSSVEKLCEEYNKMDLHTLVEHFTNSEE 750
            FW +F+RRIFPWN++++FLN L+AFL DNS + S V +LCE Y+++ L  ++ +F+ +EE
Sbjct: 724  FWKLFIRRIFPWNTIINFLNVLIAFLKDNSDSCSLVNQLCETYSQLSLDEILTNFSENEE 783

Query: 751  LPEVWKCWGTLWFDTISNKSELKASSVQSTGIRDHLFLDAPIDGICFDQDDESGLKFWKR 810
            LPEVW CWG+LWFDTI NKSE   S +++ GI+D  FLDAP DGI FD++D++G KFWKR
Sbjct: 784  LPEVWNCWGSLWFDTIKNKSETSYSGLKTAGIKDVNFLDAPYDGIVFDEEDDNGNKFWKR 843

Query: 811  ACRVIFMFKGMAKEFHYGIRVS--DTPISTRRDVTTLHALKR---FSFKFEE----LP-Q 860
            ACR++F+FKG A++F  G+R++  ++  S   ++ T    KR   F FKF+     LP  
Sbjct: 844  ACRILFLFKGYAEKFDQGLRLTNINSLNSEEENIFTKKQEKRNIDFLFKFDPTYDLLPID 903

Query: 861  EWDNEVFLQSDNF---IKVFEPISPINSNFEAVPSLSMIDGESIFEFQGYRRMYPDYYCF 917
            E  N+ F     F   +  FE IS  N   +AVP LS+IDGESIF++ GY+++ P YY +
Sbjct: 904  EASNKYFQVYSLFTEKLPAFESISENNIILDAVPQLSVIDGESIFDYVGYKKLLPCYYYY 963

Query: 918  NKNGDLITGSLYT---------SGLLERVA------IQGGDDFNVKRHVENGVLLAAHNS 962
            +KNG++  G++Y+         +GL  R+       I G DD +    +    L A +  
Sbjct: 964  DKNGNVNKGAIYSNWEAFNQLGNGLKPRMENGSSFIIDGLDD-SKNFEIREKRLFAKY-- 1020

Query: 963  PVDCNERTPETMVEYAERK-----------WLNMCMDPAFMESLRDSRFPHGDLACNADS 1011
             ++C+E + E+    AE +             N      +  + RD       +  N + 
Sbjct: 1021 -LECDE-SQESSDHLAEVEREGDETEDETEETNSRKVDKYYTNQRDLDTIFKTIKINGEM 1078

Query: 1012 NV----TYFVLDATSWLRHFAHVYKLATNNVLKFAICLTTFQELRFLRKSKDESVVEAAT 1067
             V    TYF+ DAT+WLRHFAH+YK+A + +L F ICLTTFQELRFLR+S+DE+V+EAAT
Sbjct: 1079 RVAYYSTYFIFDATTWLRHFAHIYKIAYSGLLNFVICLTTFQELRFLRRSRDENVMEAAT 1138

Query: 1068 RAVITARQLYYERKLLPLRFTGNIATHLEEHLEFEEQITWRSHVDEFVIEAVYKSQRK-- 1125
            RAVI  R LY  +K++PLRF G IA+H+EEHLEFEEQITWRSHV+EFVIEAV KSQ    
Sbjct: 1139 RAVIVIRLLYKLKKVIPLRFNGKIASHIEEHLEFEEQITWRSHVNEFVIEAVAKSQENGM 1198

Query: 1126 ------------FKGLNLQARD------QGQEYIPTDPKDDDKFNFVVLVTDDLNMRTKA 1167
                        F   N+   D      +G     T+ K        VLVTDD NM +KA
Sbjct: 1199 FDELHNESAKADFDAENMDTADSADTKQRGNSNASTNSKV-----LSVLVTDDRNMDSKA 1253

Query: 1168 EAHDIHIFSSRFMFAFCNQLGYNQKVCIN 1196
            +   I   S+RF+F+ C+QLG    +C N
Sbjct: 1254 KERGIRTCSTRFIFSICSQLGMKYGICTN 1282

>Suva_9.37 Chr9 complement(51993..55343) [3351 bp, 1117 aa] {ON}
            YIL151C (REAL)
          Length = 1117

 Score =  899 bits (2324), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 461/975 (47%), Positives = 636/975 (65%), Gaps = 69/975 (7%)

Query: 237  VPPKHTSQALVQKLQDIYRSIVKQEIELQERCSQLTNSQTTDMKNLWVIYKVNAELINNY 296
            +P    +Q  ++KLQ+IY+ IV QE ELQ+RC  LT SQTT++K+LW IYK+N ELI NY
Sbjct: 197  LPSAQPNQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYKLNTELIKNY 256

Query: 297  ISFITTALLPSQPEQDLLIGQEIVEIYRVERRLWVYGTITFLDVLKNFSNFMDPEVCCQF 356
            I+FI TALL +QP  DL++GQEI++IYR+E+RLWVYG ITFLDVLK+FSNFMDPEVCCQF
Sbjct: 257  INFIITALLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKSFSNFMDPEVCCQF 316

Query: 357  ISHVFMSISNMLGDVPPRYSIPWLERLGDLSRMAIALYPSGFIDWKLSAEHWYSQALIYT 416
            I++ F+ ISNML D+P +YSI W +RLGDLSRMAI+LYPSGFIDW+LSAE+WY++++ Y 
Sbjct: 317  ITYAFICISNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYI 376

Query: 417  YGHGKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFIPSQQYMQLVIDNIYQRAFAERSGGS 476
            YG GKLYYH++T+QQN+LEAFVNLGKSVFCQD F PSQQ +QL+I+NIYQ AF +RS G+
Sbjct: 377  YGCGKLYYHIATIQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRSSGN 436

Query: 477  S-------RNFPIVEYLKHSEVMLLPSFLESPELQKVVLTFFQQRFGVWPNNVDFFDHKQ 529
            +       RN  +++YLKH+EVMLLPSFLE+ +LQ VVL +F+ +FG   N  D F  K 
Sbjct: 437  TNNNETAHRNSQLIDYLKHTEVMLLPSFLENLDLQHVVLLYFKDKFGKDFNGNDVFSTKD 496

Query: 530  IFIQDGEKLRYFFSHAPAFAESHILQLVGFGDPRNPFAIXXXXXXXXXXXXXXXXXXXXX 589
            +F Q+ E LRY+F HAPAFAES ILQL+GFG+P+NPFA+                     
Sbjct: 497  MFCQNPESLRYYFRHAPAFAESQILQLIGFGNPKNPFALLFQLPKHLKFKKDKREKKKSG 556

Query: 590  XXXXXXTN--LDDGNGSSSISVDHYFENIDSHRVPYSF-PQDIQIWQQSLSYLNLTSMEC 646
                       DD   S S     YF+NID+    ++  P +I IW  SL+Y+N+TS++C
Sbjct: 557  AAEIPHYRDPFDDQGSSES-----YFQNIDTLNSDFNDPPTNIGIWLDSLNYINMTSIQC 611

Query: 647  SMSVLKKFXXXXXXXXXXXXXXXXXFLVSVAIRISSLSSDALKKFWLVFMRRIFPWNSLV 706
            S+ VL KF                 F+++V  ++ +++S+ +  FW+ F+RR  PWNS+V
Sbjct: 612  SIQVLTKFLHAPLAVALPHFLIWLHFIIAVLKKLETINSEQVTAFWIHFLRRTMPWNSMV 671

Query: 707  SFLNTLMAFLLDNSRNMSSVEKLCEEYNKMDLHTLVEHFTNSEELPEVWKCWGTLWFDTI 766
            +F N L+ ++LDN      +EK  E++  ++L  L+E+F  +E LPEVWKCWG+LWFD +
Sbjct: 672  TFSNVLVCYMLDNLHPF--LEKQLEKFYSLELDDLIEYFNENENLPEVWKCWGSLWFDAV 729

Query: 767  SNKSELKASSVQSTGIRDHLFLDAPIDGICFDQDDESGLKFWKRACRVIFMFKGMAKEF- 825
                  K   ++  G++DHLF D+P+DGI FD+ DE G KFW R+ R I   KG+AK+F 
Sbjct: 730  K-----KCDVMEIPGVQDHLFFDSPLDGIVFDKKDEIGEKFWIRSVRTILTLKGIAKKFP 784

Query: 826  HYGIRVS--DTPISTRRDVTTLHALKRFSFKFEELPQEW--DNEVFLQSDNFIKVFEPIS 881
              G++V+   +    R D++  + LK  +FK +   ++   DN    +  + I++ E I 
Sbjct: 785  DLGLKVNFQASVFCRRNDISPDYFLKNLTFKLDPYEEDAFNDNNELDELYDTIEINELIE 844

Query: 882  PINSNFEAVPSLSMIDGESIFEFQGYRRMYPDYYCFNKNGDLITGSLYTSGLLERVAIQG 941
             +N + +A P LS++ GESIFE+ GY R+  DY+CF+KNG   +  +YT           
Sbjct: 845  TVNIDLQATPKLSVVSGESIFEYTGYTRLTQDYHCFDKNGGFNSAFIYTQW--------- 895

Query: 942  GDDFNVKRHVENGVLLAAHNSPVDCNERTPETMVEYAERKWLNMCMDPAFMESLRDSRFP 1001
                    +V NGV L         +E   ++        W  +  D  F       +  
Sbjct: 896  -------SNVGNGVTLDV------SSESLYDSTTNDLSLHWAKILFDKVFTI----GKNT 938

Query: 1002 HGDLACNADSNVTYFVLDATSWLRHFAHVYKLATNNVLKFAICLTTFQELRFLRKSKDES 1061
              D +C+      YFV+DATSWLRHFAH++KLA NN+LKFAICLTTFQELR+LR SKD++
Sbjct: 939  DDDGSCSV-----YFVIDATSWLRHFAHIFKLAKNNILKFAICLTTFQELRYLRGSKDDN 993

Query: 1062 VVEAATRAVITARQLYYERKLLPLRFTGNIATHLEEHLEFEEQITWRSHVDEFVIEAVYK 1121
            VVEAATR+VIT RQLY E+K++P+RFTGNIATH+EE+LEFEEQITW++HVDEFVI+A+ K
Sbjct: 994  VVEAATRSVITIRQLYDEKKIIPMRFTGNIATHIEENLEFEEQITWKTHVDEFVIDAIAK 1053

Query: 1122 SQRKFKGLNLQARDQGQEYIPTDPKDDDKFNFVVLVTDDLNMRTKAEAHDIHIFSSRFMF 1181
              + F+      +++G+              F VLVTDD NM  KA+   I   +++++F
Sbjct: 1054 LNQNFQTERTIDKNKGRSK-----------EFAVLVTDDDNMNQKAKDKMIKTCNTKYLF 1102

Query: 1182 AFCNQLGYNQKVCIN 1196
            +  ++LG N  +C N
Sbjct: 1103 SLGSKLGINSGLCTN 1117

>YIL151C Chr9 complement(57338..60694) [3357 bp, 1118 aa] {ON}
            Putative protein of unknown function, predicted to
            contain a PINc domain
          Length = 1118

 Score =  898 bits (2320), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 461/979 (47%), Positives = 645/979 (65%), Gaps = 71/979 (7%)

Query: 234  IVNVPPKHTSQALVQKLQDIYRSIVKQEIELQERCSQLTNSQTTDMKNLWVIYKVNAELI 293
            I  +P    +Q  ++KLQ+IY+ IV QE ELQ+RC  LT SQTT++K+LW IY++N ELI
Sbjct: 195  IRQLPSAQPNQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYRLNTELI 254

Query: 294  NNYISFITTALLPSQPEQDLLIGQEIVEIYRVERRLWVYGTITFLDVLKNFSNFMDPEVC 353
             NYI+FI TALL +QP  DL++GQEI++IYR+E+RLWVYG ITFLDVLKNFSNFMDPEVC
Sbjct: 255  KNYINFIITALLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKNFSNFMDPEVC 314

Query: 354  CQFISHVFMSISNMLGDVPPRYSIPWLERLGDLSRMAIALYPSGFIDWKLSAEHWYSQAL 413
            CQFI + F+S+SNML D+P +YSI W +RLGDLSRMAI+LYPSGFIDW+LSAE+WY++++
Sbjct: 315  CQFIIYAFISVSNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESM 374

Query: 414  IYTYGHGKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFIPSQQYMQLVIDNIYQRAFAERS 473
             Y YG GKLYYH++TVQQN+LEAFVNLGKSVFCQD F PSQQ +QL+I+NIYQ AF +RS
Sbjct: 375  KYIYGCGKLYYHIATVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRS 434

Query: 474  GGSS-------RNFPIVEYLKHSEVMLLPSFLESPELQKVVLTFFQQRFGVWPNNVDFFD 526
             GS+       RN  +++YLKH+EVMLLPSFLE+ +LQ VVL +F+ +FG   N  D FD
Sbjct: 435  SGSANNNEIAHRNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFKDKFGKDFNGNDVFD 494

Query: 527  HKQIFIQDGEKLRYFFSHAPAFAESHILQLVGFGDPRNPFAIXXXXXXXXXXXXXXXXXX 586
             K +F Q+ E LRY+F HAPAFAES +LQL+GFG+P+NPFA+                  
Sbjct: 495  TKDMFCQNPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFAL---LFQLPKYLKLKKDKR 551

Query: 587  XXXXXXXXXTNLDDGNGSSSISVDHYFENIDSHRVPYS-FPQDIQIWQQSLSYLNLTSME 645
                     T+         IS + YF+NID+    ++  P ++ IW  SL+++N+TS++
Sbjct: 552  EKKRSEATETSSYTDPFDVQISSESYFQNIDALNSSFNDIPTNLNIWLDSLNHINMTSIQ 611

Query: 646  CSMSVLKKFXXXXXXXXXXXXXXXXXFLVSVAIRISSLSSDALKKFWLVFMRRIFPWNSL 705
            CS+ VL KF                 F+V++  ++  ++S  +  FW+ F+RR  PWNS+
Sbjct: 612  CSIHVLTKFLHAPLVVALPHFLTWLHFIVAILKKLEMVNSKQVVAFWIHFLRRTMPWNSI 671

Query: 706  VSFLNTLMAFLLDNSRNMSSVEKLCEEYNKMDLHTLVEHFTNSEELPEVWKCWGTLWFDT 765
            V+  N L+ ++LDN      ++K  E++  ++L  L+E++  +E LPE+WKCWGTLWFD 
Sbjct: 672  VTLGNVLVCYMLDNLHPF--LKKELEKFYSLELDDLIEYYNENENLPEIWKCWGTLWFDA 729

Query: 766  ISNKSELKASSVQSTGIRDHLFLDAPIDGICFDQDDESGLKFWKRACRVIFMFKGMAKEF 825
            I      K   ++  G++DHLF D+P+DGI FD+ DE G KFW R+ R + + KG+AK+F
Sbjct: 730  IK-----KCDVMEIPGVQDHLFFDSPLDGIVFDEKDEVGEKFWMRSVRAVLLLKGIAKKF 784

Query: 826  -HYGIRVS--DTPISTRRDVTTLHALKRFSFKFEELPQE--WDNEVFLQSDNFIKVFEPI 880
               G++VS   +    R D+   + LK  +FK +   ++   DN       + I++ E I
Sbjct: 785  PDLGLKVSFQASVFCRRNDIPPDYFLKNLTFKLDAYDEDNYNDNNELDDLYDTIEINEEI 844

Query: 881  SPINSNFEAVPSLSMIDGESIFEFQGYRRMYPDYYCFNKNGDLITGSLYTSGLLERVAIQ 940
              +N + +A P+LS++ GESIFE+ GY R+ PDY+CF+KNG   +  +Y+          
Sbjct: 845  EAVNMDPQATPNLSVVSGESIFEYTGYTRLAPDYHCFDKNGGFNSAFIYSQW-------- 896

Query: 941  GGDDFNVKRHVENGVLLAAHNSPVDCNERTPETMVEYAERKWLNMCMDPAFMESLRDSRF 1000
                     +V NGV L          + + E++ + A    L++  +  F +     + 
Sbjct: 897  --------SNVGNGVTL----------DVSGESIYDVANNN-LSLHWEKIFFD-----KI 932

Query: 1001 PHGDLACNADSNVT-YFVLDATSWLRHFAHVYKLATNNVLKFAICLTTFQELRFLRKSKD 1059
                   + + N T YFV+DATSWLRHFAH++KLA NN LKFAICLTTFQELR+LR SKD
Sbjct: 933  AAASKGSDENYNCTLYFVIDATSWLRHFAHIFKLAKNNTLKFAICLTTFQELRYLRGSKD 992

Query: 1060 ESVVEAATRAVITARQLYYERKLLPLRFTGNIATHLEEHLEFEEQITWRSHVDEFVIEAV 1119
            ++VVEAATR+VIT RQLY E+K++P+RFTGNIATH+EE+LEFEEQITW++HVDEFVI+A+
Sbjct: 993  DTVVEAATRSVITIRQLYDEKKIIPMRFTGNIATHVEENLEFEEQITWKTHVDEFVIDAI 1052

Query: 1120 YKSQRKFKGLNL--QARDQGQEYIPTDPKDDDKFNFVVLVTDDLNMRTKAEAHDIHIFSS 1177
             K  ++F+   L  + +++G+E             F VLVTDD NM  KA+   I   ++
Sbjct: 1053 AKLNQRFQAERLTDENKNKGKE-------------FAVLVTDDDNMNQKAKDRMIKTCNT 1099

Query: 1178 RFMFAFCNQLGYNQKVCIN 1196
            +++F+  ++LG N  +C N
Sbjct: 1100 KYLFSLGSKLGINSGLCTN 1118

>Skud_9.17 Chr9 complement(34389..37745) [3357 bp, 1118 aa] {ON}
            YIL151C (REAL)
          Length = 1118

 Score =  894 bits (2310), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 462/978 (47%), Positives = 642/978 (65%), Gaps = 75/978 (7%)

Query: 237  VPPKHTSQALVQKLQDIYRSIVKQEIELQERCSQLTNSQTTDMKNLWVIYKVNAELINNY 296
            +P    +Q  ++KLQ+IYR IV QE ELQ+RC  LT SQTT++K+LW IY++N ELI NY
Sbjct: 198  LPSAQPNQTFIKKLQEIYRIIVVQETELQQRCLFLTTSQTTELKSLWAIYRLNTELIKNY 257

Query: 297  ISFITTALLPSQPEQDLLIGQEIVEIYRVERRLWVYGTITFLDVLKNFSNFMDPEVCCQF 356
            I+FI TALL +QP  DL++GQEI++IYR+E+RLWVYG ITFLDVLKNFSNFMDPEVCCQF
Sbjct: 258  INFIITALLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKNFSNFMDPEVCCQF 317

Query: 357  ISHVFMSISNMLGDVPPRYSIPWLERLGDLSRMAIALYPSGFIDWKLSAEHWYSQALIYT 416
            I + F+S+S+ML D+P +YSI W +RLGDLSRMAI+LYPSGFIDW+LSAE+WY++++ Y 
Sbjct: 318  IIYAFISVSSMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYI 377

Query: 417  YGHGKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFIPSQQYMQLVIDNIYQRAFAERSGGS 476
            YG GKLYYH++TVQQN+LEAFVNLGKSVFCQD F PSQQ +QL+I+NIYQ AF +RS   
Sbjct: 378  YGCGKLYYHIATVQQNSLEAFVNLGKSVFCQDLFTPSQQTLQLLIENIYQSAFIDRSSAG 437

Query: 477  S-------RNFPIVEYLKHSEVMLLPSFLESPELQKVVLTFFQQRFGVWPNNVDFFDHKQ 529
            +       RN  +++YLKH+EVMLLPSFLE+ +LQ VVL +F+ +FG   N  D FD K 
Sbjct: 438  TNNNETAHRNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFKDKFGKDFNGNDIFDTKD 497

Query: 530  IFIQDGEKLRYFFSHAPAFAESHILQLVGFGDPRNPFAIXXXXXXXXXXXXXXXXXXXXX 589
            +F Q+ E LRY+F HAPAFAES +LQL+GFG+P+NPFA+                     
Sbjct: 498  MFCQNPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQLPKYLKLKRHKREKKKSG 557

Query: 590  XXXXXXTN--LDDGNGSSSISVDHYFENIDSHRVPY-SFPQDIQIWQQSLSYLNLTSMEC 646
                       DD      IS + YF+NIDS    +   P ++ IW  SL+++N+TS++C
Sbjct: 558  ATEVPQYRDPFDD-----QISSESYFQNIDSLTSNFDDIPTNLNIWLDSLNHINMTSIQC 612

Query: 647  SMSVLKKFXXXXXXXXXXXXXXXXXFLVSVAIRISSLSSDALKKFWLVFMRRIFPWNSLV 706
            S+ VL KF                 F+V++  ++ +++S A+  FW+ F+RR  PWNS+V
Sbjct: 613  SIHVLTKFLHAPLVVALPHFLTWLHFIVAILKKLETVNSKAVSGFWIHFLRRTMPWNSMV 672

Query: 707  SFLNTLMAFLLDNSRNMSSVEKLCEEYNKMDLHTLVEHFTNSEELPEVWKCWGTLWFDTI 766
            +  N L+ ++LDN      +E+  E +  ++L  L+E+F  +E LPE+WKCWG+LWFD I
Sbjct: 673  NLANVLVCYMLDNIHPF--LERELERFYSLELDDLIEYFNENENLPEIWKCWGSLWFDAI 730

Query: 767  SNKSELKASSVQSTGIRDHLFLDAPIDGICFDQDDESGLKFWKRACRVIFMFKGMAKEF- 825
                  K   ++  G++DHLF D+P+DGI FD+ DE G +FW R+ R I + KG+AK+F 
Sbjct: 731  K-----KCDVMEIPGVQDHLFFDSPLDGIVFDEKDEIGERFWIRSIRTILILKGVAKKFP 785

Query: 826  HYGIRVS-DTPISTRR-DVTTLHALKRFSFKFEELPQ--EWDNEVFLQSDNFIKVFEPIS 881
              G++V+   P+  RR D++  + LK F+FK +E  +    DN    +  + I++ E I 
Sbjct: 786  DLGLKVNFQAPVFCRRNDISPDYFLKNFTFKLDEYEENDHNDNNELDELYDTIEINEKIE 845

Query: 882  PINSNFEAVPSLSMIDGESIFEFQGYRRMYPDYYCFNKNGDLITGSLYTSGLLERVAIQG 941
             +N +  A P+LS++ GE+IFE+ GY R+ PDY+CF+KNG   +  +Y+           
Sbjct: 846  RVNRDLRATPNLSVVSGENIFEYTGYTRLTPDYHCFDKNGGFNSAFIYSQW--------- 896

Query: 942  GDDFNVKRHVENGVLLAAHNSPVDCNERTPETMVEYAERKWLNMCMDPAFMESLRDSRFP 1001
                    +V NG++L          + + E+M + A     N  + P + +   D    
Sbjct: 897  -------SNVGNGMVL----------DVSSESMYDAA-----NNNLSPHWEKIFFDRITT 934

Query: 1002 HGDLACNADSN---VTYFVLDATSWLRHFAHVYKLATNNVLKFAICLTTFQELRFLRKSK 1058
             G    N D N     YFV+DATSWLRHFAH++KLA NN+LKFAICLTTFQELR+LR SK
Sbjct: 935  AGH---NGDKNGNCSVYFVIDATSWLRHFAHIFKLAKNNILKFAICLTTFQELRYLRGSK 991

Query: 1059 DESVVEAATRAVITARQLYYERKLLPLRFTGNIATHLEEHLEFEEQITWRSHVDEFVIEA 1118
            D++VVEAATR+VIT RQLY E+K++PLRFTGNIAT++EE+LEFEEQITW +HVDEFVI+A
Sbjct: 992  DDNVVEAATRSVITIRQLYDEKKIIPLRFTGNIATNVEENLEFEEQITWETHVDEFVIDA 1051

Query: 1119 VYKSQRKFKGLNLQARDQGQEYIPTDPKDDDKFNFVVLVTDDLNMRTKAEAHDIHIFSSR 1178
            + K  + F+   L  +++ +              + VLVTDD NM  KA+   I   +++
Sbjct: 1052 IAKLNQNFQTERLIDKNKNKNNA-----------YAVLVTDDDNMDGKAKDKMIKTCNTK 1100

Query: 1179 FMFAFCNQLGYNQKVCIN 1196
            ++F+  +++G N  +C N
Sbjct: 1101 YLFSLGSKIGINSGLCTN 1118

>Smik_9.18 Chr9 complement(34956..38312) [3357 bp, 1118 aa] {ON}
            YIL151C (REAL)
          Length = 1118

 Score =  885 bits (2286), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 457/979 (46%), Positives = 639/979 (65%), Gaps = 68/979 (6%)

Query: 233  PIV-NVPPKHTSQALVQKLQDIYRSIVKQEIELQERCSQLTNSQTTDMKNLWVIYKVNAE 291
            P+V  +P    +Q  ++KLQ+IY+ IV QE ELQ+RC  LT SQTT++K+LW IY++N E
Sbjct: 193  PVVRQLPSAQPNQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYRLNTE 252

Query: 292  LINNYISFITTALLPSQPEQDLLIGQEIVEIYRVERRLWVYGTITFLDVLKNFSNFMDPE 351
            LI NYI+FI TALL +QP  DL++GQEI++IY +E+RLWVYG ITFLDVLKNFSNFMDPE
Sbjct: 253  LIKNYINFIITALLTTQPINDLIMGQEILDIYGMEKRLWVYGIITFLDVLKNFSNFMDPE 312

Query: 352  VCCQFISHVFMSISNMLGDVPPRYSIPWLERLGDLSRMAIALYPSGFIDWKLSAEHWYSQ 411
            VCCQFI + F+S+SNML D+P +YSI W +RLGDLSRMAI+LYPSGFIDW+LSAE+WY++
Sbjct: 313  VCCQFIIYAFISVSNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTE 372

Query: 412  ALIYTYGHGKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFIPSQQYMQLVIDNIYQRAFAE 471
            ++ Y YG GKLYYH++TVQQN+LEAFVNLGKSVFCQD F PSQQ +QL+I+NIYQ AF +
Sbjct: 373  SMKYIYGCGKLYYHIATVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFID 432

Query: 472  RSGGSS-------RNFPIVEYLKHSEVMLLPSFLESPELQKVVLTFFQQRFGVWPNNVDF 524
            R    +       +N  +++YLKH+EVMLLPSFLE+ +LQ VVL +F+ +FG   N  D 
Sbjct: 433  RGSSGTNNNETAHKNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFKNKFGKDFNGNDV 492

Query: 525  FDHKQIFIQDGEKLRYFFSHAPAFAESHILQLVGFGDPRNPFAIXXXXXXXXXXXXXXXX 584
            FD K +F Q+ E LRY+F HAPAFAES +LQL+GFG+P+NPFA+                
Sbjct: 493  FDTKDMFCQNPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQLPKYLKLKKDKRE 552

Query: 585  XXXXXXXXXXXTNLDDGNGSSSISVDHYFENIDSHRVPY-SFPQDIQIWQQSLSYLNLTS 643
                             +  S    + YF+NID+    +   P ++ IW +SL+++N+TS
Sbjct: 553  KKRSSATETPQYRDPFHDKKSP---ESYFQNIDALSSNFDDIPTNLNIWLESLNHINMTS 609

Query: 644  MECSMSVLKKFXXXXXXXXXXXXXXXXXFLVSVAIRISSLSSDALKKFWLVFMRRIFPWN 703
            ++CS+ VL KF                 FLV++  R+ +++S  +  FW+ F+RR  PWN
Sbjct: 610  IQCSIHVLTKFLHAPFVIALPHFLTWLYFLVAILKRLETINSKQVIAFWIHFLRRTMPWN 669

Query: 704  SLVSFLNTLMAFLLDNSRNMSSVEKLCEEYNKMDLHTLVEHFTNSEELPEVWKCWGTLWF 763
            S+VS  N L+ ++LDN      ++K  E +   +L  L+EHF  +E LPE+WKCWG+LWF
Sbjct: 670  SMVSLANVLVCYMLDNLHPF--LKKELESFYSFELDDLIEHFNENENLPEIWKCWGSLWF 727

Query: 764  DTISNKSELKASSVQSTGIRDHLFLDAPIDGICFDQDDESGLKFWKRACRVIFMFKGMAK 823
            D I      K   ++  G++DHLF D+P+DGI FD+ DE G +FW R+ R I + KG+AK
Sbjct: 728  DAIK-----KCDVMEIPGVQDHLFFDSPLDGIVFDEKDEIGERFWVRSVRAISLLKGIAK 782

Query: 824  EF-HYGIRVS-DTPISTRR-DVTTLHALKRFSFKFEELPQEWDNEVFLQSDNF--IKVFE 878
            +F   G++V+   P+  RR D+   + L++F+FK +   +  +N+     + +  I++ E
Sbjct: 783  KFPDLGLKVNFQAPVFCRRNDIPQDYFLRKFTFKLDAYDEGNNNDNNELDELYETIEINE 842

Query: 879  PISPINSNFEAVPSLSMIDGESIFEFQGYRRMYPDYYCFNKNGDLITGSLYTSGLLERVA 938
             I  +N +  A P+LS++ GESIFE+ GY R+ PDY+CF+KNG   +  +Y+        
Sbjct: 843  KIDNVNLDLRATPNLSVVFGESIFEYTGYTRLAPDYHCFDKNGGFNSAFIYSQW------ 896

Query: 939  IQGGDDFNVKRHVENGVLLAAHNSPVDCNERTPETMVEYAERKWLNMCMDPAFMESLRDS 998
                       +V NGV +   N P+   + T   +  + E+ + +              
Sbjct: 897  ----------SNVGNGVPIDVSNEPI--YDVTDNDLSLHWEKIFFD-------------- 930

Query: 999  RFPHGDLACNADSNVT-YFVLDATSWLRHFAHVYKLATNNVLKFAICLTTFQELRFLRKS 1057
            R       C+ + N T YFV+DATSWLRHFAH++KLA N++L FAICLTTFQELR+LR S
Sbjct: 931  RIAAAYKNCDENDNCTIYFVVDATSWLRHFAHIFKLAKNSILDFAICLTTFQELRYLRGS 990

Query: 1058 KDESVVEAATRAVITARQLYYERKLLPLRFTGNIATHLEEHLEFEEQITWRSHVDEFVIE 1117
            KD++VVEAATR+VIT RQLY ERK++P+RFTGNIATH+EE+LEFEEQITW++HVDEFVI+
Sbjct: 991  KDDNVVEAATRSVITIRQLYDERKIIPMRFTGNIATHVEENLEFEEQITWKTHVDEFVID 1050

Query: 1118 AVYKSQRKFKGLNLQARDQGQEYIPTDPKDDDKFNFVVLVTDDLNMRTKAEAHDIHIFSS 1177
            A+ K  + F+   + A ++ +              F VLVTDD NM  KA+   I   ++
Sbjct: 1051 AIAKLNQNFQTERMIAENKNKNK-----------QFAVLVTDDDNMNKKAKDKMIKTCNT 1099

Query: 1178 RFMFAFCNQLGYNQKVCIN 1196
            +++F+  ++LG N  +C N
Sbjct: 1100 KYLFSLGSKLGINSGLCTN 1118

>NDAI0E05070 Chr5 (1159816..1164486) [4671 bp, 1556 aa] {ON}
           Anc_5.706 YIL151C
          Length = 1556

 Score =  493 bits (1269), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 245/375 (65%), Positives = 294/375 (78%), Gaps = 43/375 (11%)

Query: 237 VPPKHTSQALVQKLQDIYRSIVKQEIELQERCSQLTNSQTTDMKNLWVIYKVNAELINNY 296
           +  K +SQAL+QKLQDIY+ IVKQEI+LQ+RCSQLT SQTTD+KNLW IYK+N +LINNY
Sbjct: 389 ITTKTSSQALIQKLQDIYKLIVKQEIQLQDRCSQLTTSQTTDLKNLWTIYKINLDLINNY 448

Query: 297 ISFITTALLPSQPEQDLLIGQEIVEIYRVERRLWVYGTITFLDVLKNFSNFMDPEVCCQF 356
           I+FIT ALLP+Q + DL IG+EI+EIYR+ERRLWVYGTITFLDVLK+FSNFMDPEVCCQF
Sbjct: 449 INFITNALLPTQSKNDLHIGEEIIEIYRIERRLWVYGTITFLDVLKSFSNFMDPEVCCQF 508

Query: 357 ISHVFMSISNMLGDVPPRYSIPWLERLGDLSRMAIALYPSGFIDWKLSAEHWYSQALIYT 416
           ISHVF++IS +L D+P +YSI WL+RLGDLSRMAIALYPSGFIDWKLSAEHWY++A+ +T
Sbjct: 509 ISHVFIAISLILNDIPMKYSIQWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYNEAMKFT 568

Query: 417 YGHGKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFIPSQQYMQLVIDNIYQRAFAERSGGS 476
           Y HGKLYYHMSTVQQNTLEAFVNLGKSVFCQ+TF PSQQYMQLVIDNIYQRAF ER+ G+
Sbjct: 569 YSHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAFVERNNGN 628

Query: 477 SRNFPIVEYLKHSEVMLLPSFLESPELQKVVLTFFQQRFGVWPN---------------- 520
            RN  ++EYLKH+EVMLLP+FLES +LQ VVL +FQ +FG+  +                
Sbjct: 629 HRNLQLIEYLKHTEVMLLPTFLESLDLQNVVLVYFQTKFGILDSTPQPQTSDNNNNTNGA 688

Query: 521 ---------------------------NVDFFDHKQIFIQDGEKLRYFFSHAPAFAESHI 553
                                       +D F ++ +FIQ+ + L+YFF H+  FA+SHI
Sbjct: 689 NVNIPYSSSSTTTSSSSSSDNTTRSFTTIDIFRNQDMFIQNPDHLKYFFRHSGTFAQSHI 748

Query: 554 LQLVGFGDPRNPFAI 568
           LQLVGFGDP+NPFA+
Sbjct: 749 LQLVGFGDPKNPFAL 763

 Score =  406 bits (1043), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 236/596 (39%), Positives = 340/596 (57%), Gaps = 69/596 (11%)

Query: 602  NGSSSISVDHYFENIDSHRVPYSFPQDIQIWQQSLSYLNLTSMECSMSVLKKFXXXXXXX 661
            N  S+I  + +FENID  + PY  PQ I+IW +SL  +NL S++CS+ VLKKF       
Sbjct: 858  NNYSNILCEEFFENIDLLQFPYKIPQTIEIWLESLKNINLISLKCSIIVLKKFLNGPILI 917

Query: 662  XXXXXXXXXXFLVSVAIRI-SSLSSDALKKFWLVFMRRIFPWNSLVSFLNTLMAFLLDN- 719
                      F++S+ ++I +S++ +  K FW  F++ I PWNS+V+FLN LM +LLDN 
Sbjct: 918  ALPHLLTWIHFIISILLKIENSITDNQSKIFWYSFLKCIIPWNSIVNFLNVLMVYLLDNI 977

Query: 720  -SRNMSSVEKLCEEYNKMD---LHTLVEHFTNSEELPEVWKCWGTLWFDTISNK---SEL 772
               N   +  L  +YN M    L+ +++ F  +E LPE+WKCWGTLWFD I NK   S+ 
Sbjct: 978  NDENFKLIISLSNKYNSMSSSSLNEMLKFFNQNENLPEIWKCWGTLWFDVICNKNINSDT 1037

Query: 773  KA---------------------------SSVQSTGIRDHLFLDAPIDGICFDQDDESGL 805
                                          ++++ GI DH  LD P+DGI F  +DE G+
Sbjct: 1038 TFLNQNNNNTTTTTKNNGEDILNDNYDTDKTLRAMGIEDHTILDCPLDGIGFVANDEDGI 1097

Query: 806  KFWKRACRVIFMFKGMAKEF-HYGIRVSDTPISTRRDVTTLH--ALKRFSFKFEEL---- 858
             F+KR+ R+IF+ K M + F + G+++S    +  R+        L  F+FK   L    
Sbjct: 1098 NFYKRSIRLIFLCKSMIETFPNLGLKISHETSNYCRNTKIPQNFILNNFAFKLTNLYDPS 1157

Query: 859  ----PQ----------------EWDNEVFLQSDNFIKVFEPISPINSNFEAVPSLSMIDG 898
                PQ                E++  +      F ++ EPI  IN N +  P LS++ G
Sbjct: 1158 LIIIPQTEQNIENENENENDDLEFNKSILSNIMEFFQIHEPIEEINLNLQLQPPLSILGG 1217

Query: 899  -ESIFEFQGYRRMYPDYYCFNKNGDLITGSLYTSGLLERVAI-QGGDDFNVKRHVENGVL 956
             E+IF + GY+R+  +   F++NG++I+GS+Y+S  ++     +       + H+ N   
Sbjct: 1218 NENIFNYLGYKRLNFNIQSFHENGEIISGSIYSSWPIDYNKFKEQQQQQQQQEHLVNDST 1277

Query: 957  LAAHNSPVDCNERTPETMVEYAERKWLNMCMDPAFMESLRDSRFPHGDLACNADSNVTYF 1016
            +   N  V   + TPE    + E   L+  +  +   +   ++  H  +  + + + T+F
Sbjct: 1278 MKNEN--VTVGDITPED-ASFKEFMKLSFHLKLSTRSNNSQTQNTH-KMGVSINKHRTFF 1333

Query: 1017 VLDATSWLRHFAHVYKLATNNVLKFAICLTTFQELRFLRKSKDESVVEAATRAVITARQL 1076
            V DATSWLRHFAH+YKL+ N  LKFA+CLTTFQELRFLRKSKD +VVEA+TRA+IT RQL
Sbjct: 1334 VFDATSWLRHFAHIYKLSKNGFLKFAVCLTTFQELRFLRKSKDGNVVEASTRAIITMRQL 1393

Query: 1077 YYERKLLPLRFTGNIATHLEEHLEFEEQITWRSHVDEFVIEAVYKSQRKFKGLNLQ 1132
            Y E KLLPLRFTGN+AT +EEHLEFEEQITWRSHVDEFVIEA+ +SQ +FK  ++Q
Sbjct: 1394 YKEGKLLPLRFTGNVATDIEEHLEFEEQITWRSHVDEFVIEAIIRSQERFKTKSIQ 1449

>TBLA0E01710 Chr5 complement(411712..416292) [4581 bp, 1526 aa] {ON}
           Anc_5.706 YIL151C
          Length = 1526

 Score =  397 bits (1021), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 187/300 (62%), Positives = 234/300 (78%), Gaps = 23/300 (7%)

Query: 240 KHTSQALVQKLQDIYRSIVKQEIELQERCSQLTNSQTTDMKNLWVIYKVNAELINNYISF 299
           K ++Q L+QKLQ+IY+ IV QE+ELQ++C++L+ SQ+T +K LW IYK+N +LINNYI F
Sbjct: 263 KKSNQNLIQKLQNIYKLIVSQELELQDKCNKLSTSQSTKLKYLWSIYKLNHDLINNYILF 322

Query: 300 ITTALLPSQPEQDLLIGQEIVEIYRVERRLWVYGTITFLDVLKNFSNFMDPEVCCQFISH 359
           I T+L PSQ   D LIG+EI+EIY++ERRLW+YGTITFLD+LKNF+NFMDPE+  QFI+H
Sbjct: 323 ILTSLSPSQSINDQLIGKEILEIYKIERRLWIYGTITFLDILKNFANFMDPEILSQFITH 382

Query: 360 VFMSISNMLGDVPPRYSIPWLERLGDLSRMAIALYPSGFIDWKLSAEHWYSQALIYTYGH 419
           VF SISNM+ D+P  +  PW +RLGDLSRMAIALYPS FIDWKLS+E+WY +++ +T+ H
Sbjct: 383 VFESISNMISDLPIDFINPWYQRLGDLSRMAIALYPSNFIDWKLSSEYWYIESMKFTFSH 442

Query: 420 GKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFIPSQQYMQLVIDNIYQRAFAER------- 472
           GKLYYH+STVQQN LEAFVNLGKSVFC DTFIPSQ+YMQLVIDNIYQRAF ER       
Sbjct: 443 GKLYYHISTVQQNPLEAFVNLGKSVFCFDTFIPSQRYMQLVIDNIYQRAFIERNSNSSSS 502

Query: 473 -------------SGGSSRNFP---IVEYLKHSEVMLLPSFLESPELQKVVLTFFQQRFG 516
                        +   ++NF    ++EYLKHSEVMLLP+FLE+  L+ VVL +F   FG
Sbjct: 503 NNAGSSSNPNHFMTSSFAKNFQQRFLIEYLKHSEVMLLPNFLENDHLKTVVLNYFTNSFG 562

 Score =  275 bits (702), Expect = 8e-75,   Method: Compositional matrix adjust.
 Identities = 157/345 (45%), Positives = 209/345 (60%), Gaps = 47/345 (13%)

Query: 877  FEPISPINSNFEAVPSLSMIDGESIFEFQGYRRMYPDYYCFNKNGDLITGSLYTSGLLER 936
            FE  S  N++    P LS+I+ ES+FE++GY+R  PD+  F+KNG+LI+ SLYTS +++ 
Sbjct: 1150 FEKNSIQNTDLNCEPGLSLIENESLFEYEGYKRFIPDFSNFDKNGELISTSLYTSTIIDT 1209

Query: 937  V--------AIQGGDDFNVKRHVENGVLLAAHNSPVDCNERTPETMVEY--AERKWLNMC 986
            +         I    + N + + ++     ++ +    N  T     E    E++  N  
Sbjct: 1210 INGSSSNANIINTTTNANDESNNDSSATAGSNQNKESSNSTTNIDNKELFLMEKEIFNKI 1269

Query: 987  MDPAFM--------ESLRDSRFPHGDLACNADSNVTYFVLDATSWLRHFAHVYKLATNNV 1038
            +DP +         E   D+     D         TYFVLDATSWLRHFAHVYKLATN +
Sbjct: 1270 LDPDYKNIDEIWRGEMFHDTSIQFSD---------TYFVLDATSWLRHFAHVYKLATNGI 1320

Query: 1039 LKFAICLTTFQELRFLRKSKDESVVEAATRAVITARQLYYERKLLPLRFTGNIATHLEEH 1098
            LKFAICLTTFQELRFLRKSKDE+V+EAATRA+IT RQLY E++LLPLRFTGNIATH+EEH
Sbjct: 1321 LKFAICLTTFQELRFLRKSKDENVMEAATRAIITLRQLYSEKRLLPLRFTGNIATHIEEH 1380

Query: 1099 LEFEEQITWRSHVDEFVIEAVYKSQRKFKGLNLQARDQGQEYIPTDPKDDDKFN------ 1152
            LEFEEQITWRSHVDEFVIEA+ ++Q K +      R+Q    + +   +    N      
Sbjct: 1381 LEFEEQITWRSHVDEFVIEAIKRAQLKRR----DNRNQEDSNVTSSNNNPIINNNENNGN 1436

Query: 1153 ------FVVLVTDDLNMRTKAEA----HDIHIFSSRFMFAFCNQL 1187
                    VLVTDD++M  K +     +DI  FS++F+F+ CN L
Sbjct: 1437 LNVTDMIFVLVTDDISMIKKRQEEKSDNDIITFSTKFVFSLCNML 1481

 Score =  196 bits (499), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 101/262 (38%), Positives = 161/262 (61%), Gaps = 8/262 (3%)

Query: 606  SISVDHYFENIDSHRVPYSFPQDIQIWQQSLSYLNLTSMECSMSVLKKFXXXXXXXXXXX 665
            ++S   +F N++S ++ +  P  ++IW +SL Y+N+ S+ CS+ VLKKF           
Sbjct: 785  NLSPQDFFNNLESLKLSFFLPNSLEIWNESLKYINIISLNCSIIVLKKFLNGPLFVSLPH 844

Query: 666  XXXXXXFLVSVAIRISSLSSDALKKFWLVFMRRIFPWNSLVSFLNTLMAFLLDNSRNMSS 725
                  F++S+A+RI SL +   + FWL F+R+IFPWNS+VS+LN +++ LLDN    S 
Sbjct: 845  MLPWSYFIISLALRIESLENIESRIFWLQFIRKIFPWNSIVSYLNVIISVLLDNCYENSM 904

Query: 726  VEKLCEEYNKMDLHTLVEHFTNSE-ELPEVWKCWGTLWFDTISNKSELKASSV-QSTGIR 783
            + KL   Y+  +L  L+  F  +E ELPEVWKC+G+LWFD I+   ++ +    ++  ++
Sbjct: 905  ITKLINNYSNKNLDELLVEFNENEYELPEVWKCYGSLWFDVIAENYQIYSRDCSKNISMK 964

Query: 784  DHLFLDAPIDGICFDQDDESGLKFWKRACRVIFMFKGMAKEFH--YGIRV-SDTPI-STR 839
            D   L+ PIDG+ FD+ +E+G  FWKR+CR+IF+FK M   F+   G+ + S+T +   R
Sbjct: 965  DTKCLNYPIDGLPFDEMEENGTNFWKRSCRLIFLFKTMITRFNGFGGLTISSNTSVYCNR 1024

Query: 840  RDVTTLHALKRFSFKFEELPQE 861
             D+   H L+ F+FK   LP +
Sbjct: 1025 SDIPNNHILRTFAFKL--LPDD 1044

 Score = 65.1 bits (157), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 39/50 (78%), Gaps = 1/50 (2%)

Query: 520 NNVDFFDHKQIFIQ-DGEKLRYFFSHAPAFAESHILQLVGFGDPRNPFAI 568
           N ++ F+ + IF Q + + L+YFF ++  FAESHILQL+GFGDP+NPFA+
Sbjct: 618 NAINLFNFRNIFKQKNSDILKYFFKNSATFAESHILQLIGFGDPKNPFAL 667

>TPHA0D04640 Chr4 (1012556..1015444) [2889 bp, 962 aa] {ON} Anc_5.706
            YIL151C
          Length = 962

 Score = 83.6 bits (205), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 95/460 (20%), Positives = 184/460 (40%), Gaps = 88/460 (19%)

Query: 632  WQQSLSYLNLTSMECSMSVLKKFXXXXXXXXXXXXXXXXXFLVSVAIRISSLSSDALKKF 691
            W+  +  ++ T +  +  + KKF                 F +SVA  +++++   +   
Sbjct: 481  WKILIEQMDDTLLHSNKLLFKKFLMLNVAISQPFILPWLLFYISVASEVANVTDRHVLLL 540

Query: 692  WLVFMRRIFPWNSLVSFLNTLMAFLLDNSRNMSSVEKLCEEYNKMDLHTLVEHFTNSEEL 751
            W   ++ + PW+ +V++LN  +  +  +S N  ++  L +      L+ L+ +       
Sbjct: 541  WKDLLQNLLPWDDIVTYLNESIDMVNKHSINSKTLRALIKNIKSCSLYDLLYYMMYESNF 600

Query: 752  PEVWKCWGTLWFDTISNKSELKASSVQSTGIRDHLFLDAPIDGICFDQDDESGLKFWKRA 811
             E+  C G +WFD++++K + +AS   +  +      +A  D + +D DD+   K W RA
Sbjct: 601  QEISMCEGFIWFDSLASKIK-QASITTNESLMKFKSYNASEDSLIYDDDDQVYTKMWTRA 659

Query: 812  CRVIFMFKGMAKEFHYGIRVSD-----TPISTRRDVTTLHALKRFSFKFEELPQEWDNEV 866
              +I + K +  ++   I VS      T  S  ++  +L     F + FE          
Sbjct: 660  LLIILLIKNVINDYPELIDVSIRGQSLTNSSCIKNSDSLTNDYLFDWGFE---------- 709

Query: 867  FLQSDNFIKVFEPISPINSNFEAVPSLSMIDGESIFEFQGYRRMYPDYYCFNKNGDLITG 926
                            +N+N   +   ++     IF+F       PD+  F+KNGD+  G
Sbjct: 710  ----------------LNNNNAVIIDDTLHGRNRIFKFS----YIPDFQDFDKNGDITWG 749

Query: 927  SLYTSGLLERVAIQGGDDFNVKRHVENG--------VLLAAHNSPVDCNERTPETMVEYA 978
                  L+        +DFN +   E+G         LL+AHN              +Y+
Sbjct: 750  ----YSLISNYDYIYSNDFNSE---EDGNFFQRYSRRLLSAHN--------------DYS 788

Query: 979  ERKWLNMCMDPAFMESLRDSRFPHGDLACNADSNVTYFVLDATSWLRHFAHVYKLATNNV 1038
            E K         ++  L ++                YF++D  +WL+H   + +      
Sbjct: 789  EDK------SKKYLPKLENN----------------YFMVDTLAWLKHSNKLKRFIAEEK 826

Query: 1039 LKFAICLTTFQELRFLRK-SKDESVVEAATRAVITARQLY 1077
            +K  + ++   +L  L+  S+ ESV  +A+R +I    LY
Sbjct: 827  VKVILSVSILNDLNELKNYSEHESVRSSASRVMIVINYLY 866

 Score = 74.3 bits (181), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 73/327 (22%), Positives = 146/327 (44%), Gaps = 57/327 (17%)

Query: 285 IYKVNAELINNYISFITTALLPSQPEQDLLIGQEIVEIYRVERRLWVYGTITFLDVLKNF 344
           ++K++ ++++ Y  FI  AL  +  ++DL+ G+E V   R+  RL  +     L++++N+
Sbjct: 147 LFKLHTKIVSRYTEFIAIALNINNTQEDLIRGKEYVTKGRLNERLINHCLKPLLEIIENY 206

Query: 345 SNFM----------DPEVCCQFISHVFMSISNMLGDVPPRYSIPWLERLGDLSRMAIALY 394
            N M          + +   +FI    + I++ML ++P ++   W   +GDL+R+ + L 
Sbjct: 207 KNHMKINGINVSVINNDNIIEFIQSFIIDITHMLEEIPLKFHYDWELHIGDLNRLLMLLS 266

Query: 395 PSGFIDWKLSAEHWYS-----QALIYTYGHGK----------LYYHMSTVQQNTLEAFVN 439
                 ++L++ H Y+      A+ Y+  +GK           Y+++S VQ ++L   V 
Sbjct: 267 VKDQEVYRLNSLHRYNIIAPVVAVNYSPNNGKESDIKNHMCNYYFNLSKVQHSSLARIVT 326

Query: 440 LGKSVFCQDTFIPSQQYMQLVIDNIY------QRAFAERSGGSSRNFPIVEYLKHSEVML 493
           L K +  ++T +  +   QL ID I       Q    +  GG++    +++Y       L
Sbjct: 327 LSKCLCIENTNVYQKSMAQLAIDKIISKLLNKQVNLKQSMGGTT---ILMKYFT-----L 378

Query: 494 LPSFLESPE------LQKVVLTFFQQRFGVWPNNVDFFDHKQIFIQDGEKLR-------- 539
           L  F  S        +++  L +F   F     N    ++  +      K R        
Sbjct: 379 LSLFFGSTSSSQLSGMERSSLHYFWNEFA----NEYHLNYSSLRKPVNCKYRQKEINYSM 434

Query: 540 YFFSHAPAFAESHILQLVGFGDPRNPF 566
           ++F++AP F+   I++ +      NPF
Sbjct: 435 FYFNNAPLFSLISIVETIIMNKKLNPF 461

>Smik_12.450 Chr12 (788896..791106) [2211 bp, 736 aa] {ON} YLR362W
            (REAL)
          Length = 736

 Score = 37.0 bits (84), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 35/127 (27%), Positives = 58/127 (45%), Gaps = 20/127 (15%)

Query: 978  AERKWLNMCMDPAFMESLRDSRFPHGDLACNADSNVT-------YFVLDATSWLRHFAHV 1030
            A++  +N C +   ++     R PH  LA N+D  VT        FVLD    + H  + 
Sbjct: 140  AKKVNVNGCFNADSIKKRLIRRLPHELLATNSDGEVTKMVQDYDVFVLDYAKNVLHLLYD 199

Query: 1031 YKLATNNVLKFAICLTT--FQELRFLRKSKDESVVEAATRAVITARQLYYERKLLPLRFT 1088
             +L T       IC      ++ R +  SKD++    + +A+ T+++LY  R L  L   
Sbjct: 200  VELVT-------ICHANDRVEKNRLIFVSKDQT---PSDKAISTSKKLYL-RTLSALSQV 248

Query: 1089 GNIATHL 1095
            G+  +HL
Sbjct: 249  GSNTSHL 255

>NDAI0F01300 Chr6 complement(317724..322409) [4686 bp, 1561 aa] {ON}
           Anc_6.269 YPL242C
          Length = 1561

 Score = 34.3 bits (77), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 43/86 (50%), Gaps = 9/86 (10%)

Query: 56  SQNVSQNDELAASAACFLDSNLTPSKHQECTPSS-----FQ--RATDETPQPFYPADTPQ 108
           SQN+ +N  +       +  +L  +K +  +  S     +Q  R   +TP+P+Y A+TP 
Sbjct: 300 SQNIPKNVPIPEKLTTTVKKDLPNNKVERVSSVSKSTEFYQEPRTPTKTPRPYYSAETPP 359

Query: 109 SPFYLPTTSSSNLEAASKVITNDNSS 134
           SP   P+T  +++E  S    ND SS
Sbjct: 360 SPD--PSTLVTDIETKSAHRLNDYSS 383

>KNAG0K01940 Chr11 complement(389710..392088) [2379 bp, 792 aa] {ON}
           Anc_3.130 YOL076W
          Length = 792

 Score = 33.5 bits (75), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 19/91 (20%), Positives = 43/91 (47%), Gaps = 6/91 (6%)

Query: 858 LPQEWDNEV--FLQSDNFIKVFEPISPINSNFEAVPSLSMIDGESIFEFQ----GYRRMY 911
           +  +W++EV   ++  NF + FE ++ +   +     L +++  + +        Y+ + 
Sbjct: 1   MESKWESEVQELIRRSNFRQCFEQLTVLRKRYPKSAFLELLELYAKYRQSPAAFDYKALI 60

Query: 912 PDYYCFNKNGDLITGSLYTSGLLERVAIQGG 942
            + YC +K    +TG L+   LL R  ++ G
Sbjct: 61  VEPYCRDKRSPRVTGDLHALDLLHRFLVELG 91

>NCAS0J01870 Chr10 (352527..359471) [6945 bp, 2314 aa] {ON} Anc_4.310
          Length = 2314

 Score = 33.1 bits (74), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 30/121 (24%), Positives = 59/121 (48%), Gaps = 14/121 (11%)

Query: 967  NERTPETMVEYAERKWLNMCMDPAFMESLR-DSRFPHGDLACNADSNVTYFVLDATSWL- 1024
            N+ T E M ++ +  W    +D  +  +L+  S++ + +L      N T   L+ +  L 
Sbjct: 738  NDTTDEEMTKFWQLSW--QFLDTIYRCTLKWASKYEYSEL-----ENFTKDTLELSRSLV 790

Query: 1025 ---RHFAHVYKLATNNVLKFAICLTTFQELRFLRKSKDESVVEAATRAVITARQLYYERK 1081
               R F+ V  L  N    F   L TF+ + +  +  D+S++E+  R +I A ++ +E+K
Sbjct: 791  DSYREFSDV--LTNNKRDLFQSVLNTFKNMLYWLRLSDDSLLESCVRLIIKASEIAHEKK 848

Query: 1082 L 1082
            +
Sbjct: 849  I 849

>SAKL0H09328g Chr8 (791744..793534) [1791 bp, 596 aa] {ON} similar
           to uniprot|P38125 Saccharomyces cerevisiae YBR180W DTR1
           Multidrug resistance dityrosine transporter of the major
           facilitator superfamily essential for spore wall
           synthesis facilitates the translocation of bisformyl
           dityrosine through the prospore membrane
          Length = 596

 Score = 32.7 bits (73), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 26/118 (22%), Positives = 55/118 (46%), Gaps = 12/118 (10%)

Query: 174 GEQKESITDELQGTDNTPHEQSSN---THADTNQQSDQHNXXXXXXXXXXXXXENNRENS 230
           GE+   I DE++  D+TP    +     + + N  S+QH              E + E S
Sbjct: 5   GEENSIIMDEIKSGDSTPLGDPTEWVLVNPEENINSEQH-IQSKNDLIEQEKVEVSSEKS 63

Query: 231 -------GIPIVNVPPKHTSQALVQKLQDIYRSIVKQEIELQERCSQLTNSQTTDMKN 281
                   + +VN P +     +++  +DI +   K+E+++++R +  T+++ T +K+
Sbjct: 64  FHSSDSQIVKLVNKPLQKVPSPIIESEEDIEKK-SKEELKIEKRIATATSTEETSLKS 120

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.134    0.405 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 124,602,741
Number of extensions: 5447180
Number of successful extensions: 16346
Number of sequences better than 10.0: 40
Number of HSP's gapped: 16622
Number of HSP's successfully gapped: 81
Length of query: 1196
Length of database: 53,481,399
Length adjustment: 121
Effective length of query: 1075
Effective length of database: 39,606,813
Effective search space: 42577323975
Effective search space used: 42577323975
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 72 (32.3 bits)