Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0E14982g5.705ON89894631e-61
KLTH0E00990g5.705ON89873164e-39
Kpol_YGOB_1043.725.705ON88883001e-36
NCAS0A031805.705ON88872974e-36
Kwal_YGOB_Anc_5.7055.705ON88882932e-35
TDEL0B021505.705ON91822904e-35
YKR095W-A (PCC1)5.705ON88852801e-33
KAFR0H001905.705ON82822731e-32
Smik_11.3595.705ON88882731e-32
Skud_11.3355.705ON94942732e-32
KLLA0A00539g5.705ON87852652e-31
TBLA0G010305.705ON89862636e-31
Suva_11.3325.705ON1111112577e-30
ZYRO0B16368g5.705ON85792522e-29
KNAG0C066205.705ON101862516e-29
TPHA0E002005.705ON85732411e-27
Ecym_40165.705ON125742362e-26
NDAI0E050605.705ON86842272e-25
AFR289W5.705ON81791923e-20
CAGL0G02535g5.705ON140531702e-16
NDAI0G042903.92ON111363660.68
KAFR0A051206.29ON147927650.98
CAGL0J07722g1.116ON26240631.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0E14982g
         (89 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0E14982g Chr5 (1245785..1245822,1245898..1246129) [270 bp, 8...   182   1e-61
KLTH0E00990g Chr5 complement(95824..96055,96120..96157) [270 bp,...   126   4e-39
Kpol_YGOB_1043.72 s1043 (153488..153525,153647..153875) [267 bp,...   120   1e-36
NCAS0A03180 Chr1 complement(626215..626443,626521..626558) [267 ...   119   4e-36
Kwal_YGOB_Anc_5.705 s55 complement(79302..79530,79607..79644) [2...   117   2e-35
TDEL0B02150 Chr2 complement(384337..384592,384661..384680) [276 ...   116   4e-35
YKR095W-A Chr11 (625864..625901,625977..626205) [267 bp, 88 aa] ...   112   1e-33
KAFR0H00190 Chr8 complement(25330..25558,25623..25642) [249 bp, ...   109   1e-32
Smik_11.359 Chr11 (615946..615984,616062..616286) [264 bp, 88 aa...   109   1e-32
Skud_11.335 Chr11 (607394..607432,607436..607453,607509..607733)...   109   2e-32
KLLA0A00539g Chr1 complement(49433..49661,49740..49774) [264 bp,...   106   2e-31
TBLA0G01030 Chr7 (258297..258337,258458..258686) [270 bp, 89 aa]...   105   6e-31
Suva_11.332 Chr11 (610692..610730,610734..610769,610773..611030)...   103   7e-30
ZYRO0B16368g Chr2 (1328001..1328023,1328088..1328322) [258 bp, 8...   101   2e-29
KNAG0C06620 Chr3 (1283525..1283568,1283654..1283915) [306 bp, 10...   101   6e-29
TPHA0E00200 Chr5 complement(25648..25882,26105..26127) [258 bp, ...    97   1e-27
Ecym_4016 Chr4 complement(39497..39874) [378 bp, 125 aa] {ON} si...    96   2e-26
NDAI0E05060 Chr5 (1159116..1159376) [261 bp, 86 aa] {ON} Anc_5.7...    92   2e-25
AFR289W Chr6 (960013..960026,960078..960309) [246 bp, 81 aa] {ON...    79   3e-20
CAGL0G02535g Chr7 (230231..230268,230360..230570,230769..230942)...    70   2e-16
NDAI0G04290 Chr7 complement(1030530..1033871) [3342 bp, 1113 aa]...    30   0.68 
KAFR0A05120 Chr1 (1015307..1019746) [4440 bp, 1479 aa] {ON} Anc_...    30   0.98 
CAGL0J07722g Chr10 complement(753637..754425) [789 bp, 262 aa] {...    29   1.2  

>SAKL0E14982g Chr5 (1245785..1245822,1245898..1246129) [270 bp, 89
          aa] {ON} similar to uniprot|Q3E833 Saccharomyces
          cerevisiae YKR095W-A PCC1 Proposed transcription factor
          involved in the expression of genes regulated by
          alpha-factor and galactose
          Length = 89

 Score =  182 bits (463), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 89/89 (100%), Positives = 89/89 (100%)

Query: 1  MKNTRQMSLDHHLYLEIPLETPSQAIIAMKALKPDPVLKPEDFQVEYSAADYKLCVSFKS 60
          MKNTRQMSLDHHLYLEIPLETPSQAIIAMKALKPDPVLKPEDFQVEYSAADYKLCVSFKS
Sbjct: 1  MKNTRQMSLDHHLYLEIPLETPSQAIIAMKALKPDPVLKPEDFQVEYSAADYKLCVSFKS 60

Query: 61 IDDRVLRVGVSSVIESVKTIIETMDEFGS 89
          IDDRVLRVGVSSVIESVKTIIETMDEFGS
Sbjct: 61 IDDRVLRVGVSSVIESVKTIIETMDEFGS 89

>KLTH0E00990g Chr5 complement(95824..96055,96120..96157) [270 bp,
          89 aa] {ON} similar to uniprot|Q3E833 Saccharomyces
          cerevisiae YKR095W-A PCC1 Protein
          Length = 89

 Score =  126 bits (316), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 59/87 (67%), Positives = 71/87 (81%)

Query: 1  MKNTRQMSLDHHLYLEIPLETPSQAIIAMKALKPDPVLKPEDFQVEYSAADYKLCVSFKS 60
          MK TRQ  L + LYLE+P +T  QA  A+K LKPDP+LKP+DF VEYS+  + LCVSF+ 
Sbjct: 1  MKGTRQSDLAYTLYLEVPFKTAKQAETAVKVLKPDPILKPQDFHVEYSSKAHNLCVSFEG 60

Query: 61 IDDRVLRVGVSSVIESVKTIIETMDEF 87
          +DDRVLRVGVSSVIES+KTIIET+DEF
Sbjct: 61 VDDRVLRVGVSSVIESIKTIIETIDEF 87

>Kpol_YGOB_1043.72 s1043 (153488..153525,153647..153875) [267 bp,
          88 aa] {ON} ANNOTATED BY YGOB -
          Length = 88

 Score =  120 bits (300), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 59/88 (67%), Positives = 68/88 (77%)

Query: 1  MKNTRQMSLDHHLYLEIPLETPSQAIIAMKALKPDPVLKPEDFQVEYSAADYKLCVSFKS 60
          MK  R + +DH L  EIP ET  QA IA++ LKPDP+LKP+DFQV YS+ D  L + FKS
Sbjct: 1  MKTQRTIEMDHTLDFEIPFETARQAEIAVQVLKPDPILKPQDFQVSYSSNDNLLIMKFKS 60

Query: 61 IDDRVLRVGVSSVIESVKTIIETMDEFG 88
          IDDRVLRVGVSSVI+SVKTIIETMDE  
Sbjct: 61 IDDRVLRVGVSSVIDSVKTIIETMDELS 88

>NCAS0A03180 Chr1 complement(626215..626443,626521..626558) [267
          bp, 88 aa] {ON} Anc_5.705 YKR095W-A
          Length = 88

 Score =  119 bits (297), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 59/87 (67%), Positives = 68/87 (78%)

Query: 1  MKNTRQMSLDHHLYLEIPLETPSQAIIAMKALKPDPVLKPEDFQVEYSAADYKLCVSFKS 60
          MKN R+MSLD+ L LEIP  T  QA IA K L PDP+LKP+DFQVEY + D  L V F+ 
Sbjct: 1  MKNGREMSLDYVLNLEIPFTTSRQAQIAAKVLVPDPILKPQDFQVEYLSQDNILAVHFRG 60

Query: 61 IDDRVLRVGVSSVIESVKTIIETMDEF 87
          IDDRVLRVGVSSVI+S+KTIIET+DE 
Sbjct: 61 IDDRVLRVGVSSVIDSIKTIIETIDEL 87

>Kwal_YGOB_Anc_5.705 s55 complement(79302..79530,79607..79644)
          [267 bp, 88 aa] {ON} ANNOTATED BY YGOB -
          Length = 88

 Score =  117 bits (293), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 52/88 (59%), Positives = 71/88 (80%)

Query: 1  MKNTRQMSLDHHLYLEIPLETPSQAIIAMKALKPDPVLKPEDFQVEYSAADYKLCVSFKS 60
          MK++R ++L + LYLE+P +   QA  A++ LKPDP+LKP+DF VEY+++   LCV F+ 
Sbjct: 1  MKSSRPLNLAYTLYLEVPFQNDKQAATAVQVLKPDPILKPQDFHVEYTSSANNLCVLFEG 60

Query: 61 IDDRVLRVGVSSVIESVKTIIETMDEFG 88
          +DDRVLRVGVSSVIES+KTI+ET+DEF 
Sbjct: 61 VDDRVLRVGVSSVIESIKTIVETIDEFS 88

>TDEL0B02150 Chr2 complement(384337..384592,384661..384680) [276
          bp, 91 aa] {ON} Anc_5.705 YKR095W-A
          Length = 91

 Score =  116 bits (290), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 54/82 (65%), Positives = 67/82 (81%)

Query: 7  MSLDHHLYLEIPLETPSQAIIAMKALKPDPVLKPEDFQVEYSAADYKLCVSFKSIDDRVL 66
          MSL+H L LEIP +T +QA IA + L PDP+LKP+DFQV+Y+  D  L V F+SIDDRVL
Sbjct: 1  MSLNHSLKLEIPFQTAAQANIAKQVLLPDPILKPQDFQVDYTTTDNVLVVGFQSIDDRVL 60

Query: 67 RVGVSSVIESVKTIIETMDEFG 88
          RVGVSSVI+S+KTI+ET+DE G
Sbjct: 61 RVGVSSVIDSIKTIVETIDELG 82

>YKR095W-A Chr11 (625864..625901,625977..626205) [267 bp, 88 aa]
          {ON}  PCC1Component of the EKC/KEOPS protein complex
          with Kae1p, Gon7p, Bud32p, and Cgi121p; EKC/KEOPS
          complex is required for t6A tRNA modification and may
          have roles in telomere maintenance and transcription
          Length = 88

 Score =  112 bits (280), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 66/85 (77%)

Query: 1  MKNTRQMSLDHHLYLEIPLETPSQAIIAMKALKPDPVLKPEDFQVEYSAADYKLCVSFKS 60
          M + R+ SLDH L L+IP ET  QA IA K L PDP+LKP+DFQV+YS+    + V F+S
Sbjct: 1  MTSKREKSLDHTLELKIPFETERQATIATKVLSPDPILKPQDFQVDYSSEKNVMLVQFRS 60

Query: 61 IDDRVLRVGVSSVIESVKTIIETMD 85
          IDDRVLRVGVSS+I+S+KTI+E MD
Sbjct: 61 IDDRVLRVGVSSIIDSIKTIVEAMD 85

>KAFR0H00190 Chr8 complement(25330..25558,25623..25642) [249 bp,
          82 aa] {ON} Anc_5.705 YKR095W-A
          Length = 82

 Score =  109 bits (273), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 53/82 (64%), Positives = 62/82 (75%)

Query: 7  MSLDHHLYLEIPLETPSQAIIAMKALKPDPVLKPEDFQVEYSAADYKLCVSFKSIDDRVL 66
          M+LDH L LEIP E   QA IA+  LKPDP+L+P+DFQV Y A D      F+SIDDRVL
Sbjct: 1  MNLDHTLKLEIPFEDAKQANIAVDVLKPDPILRPQDFQVSYKARDNVFVAEFESIDDRVL 60

Query: 67 RVGVSSVIESVKTIIETMDEFG 88
          RVGVS+VI+S+KTIIETMDE  
Sbjct: 61 RVGVSNVIDSLKTIIETMDELS 82

>Smik_11.359 Chr11 (615946..615984,616062..616286) [264 bp, 88 aa]
          {ON} YKR095W-A (REAL)
          Length = 88

 Score =  109 bits (273), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 49/88 (55%), Positives = 67/88 (76%)

Query: 1  MKNTRQMSLDHHLYLEIPLETPSQAIIAMKALKPDPVLKPEDFQVEYSAADYKLCVSFKS 60
          M + R+M L H L L++P +T  QA+IA + L PDP+LKP+DFQ++YS+    + V F+S
Sbjct: 1  MSSKREMPLHHTLELKVPFKTEQQAVIATRVLSPDPILKPQDFQIDYSSEKNVMLVQFRS 60

Query: 61 IDDRVLRVGVSSVIESVKTIIETMDEFG 88
          IDDRVLRVGVSSVI+S+KT++E MDE  
Sbjct: 61 IDDRVLRVGVSSVIDSIKTVVEAMDELS 88

>Skud_11.335 Chr11 (607394..607432,607436..607453,607509..607733)
          [282 bp, 94 aa] {ON} YKR095W-A (REAL)
          Length = 94

 Score =  109 bits (273), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 55/94 (58%), Positives = 69/94 (73%), Gaps = 6/94 (6%)

Query: 1  MKNTRQMSLDHHLY------LEIPLETPSQAIIAMKALKPDPVLKPEDFQVEYSAADYKL 54
          M + R+MSLD+ L       L+IP ET  QA IA K L PDP+LKP+DFQV+YS+    +
Sbjct: 1  MTSKREMSLDYTLVEQVFQELQIPFETEGQASIATKVLSPDPILKPQDFQVDYSSEKNIM 60

Query: 55 CVSFKSIDDRVLRVGVSSVIESVKTIIETMDEFG 88
           V F+SIDDRVLRVGVSSVI+S+KTI+ET+DE  
Sbjct: 61 LVRFRSIDDRVLRVGVSSVIDSIKTIVETIDELS 94

>KLLA0A00539g Chr1 complement(49433..49661,49740..49774) [264 bp,
          87 aa] {ON} highly similar to uniprot|Q3E833
          Saccharomyces cerevisiae YKR095W-A PCC1 Protein
          Length = 87

 Score =  106 bits (265), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 50/85 (58%), Positives = 64/85 (75%)

Query: 3  NTRQMSLDHHLYLEIPLETPSQAIIAMKALKPDPVLKPEDFQVEYSAADYKLCVSFKSID 62
          N    S +H L+LEIP E+  QA +A K L PDP++KPEDFQV YS  D KL   F+S+D
Sbjct: 2  NKGDTSFEHSLHLEIPFESIKQADVARKVLLPDPIMKPEDFQVTYSTQDTKLICDFESVD 61

Query: 63 DRVLRVGVSSVIESVKTIIETMDEF 87
          +R+LRVGV+SVIES+KTI+ET+DE 
Sbjct: 62 ERILRVGVNSVIESIKTIVETIDEL 86

>TBLA0G01030 Chr7 (258297..258337,258458..258686) [270 bp, 89 aa]
          {ON} Anc_5.705 YKR095W-A
          Length = 89

 Score =  105 bits (263), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 64/86 (74%)

Query: 2  KNTRQMSLDHHLYLEIPLETPSQAIIAMKALKPDPVLKPEDFQVEYSAADYKLCVSFKSI 61
          K    M ++H L L IP  T  QA IA + L+PDP+L+P+DFQV+Y++   +L + F+SI
Sbjct: 3  KRDNNMQMEHTLTLNIPFATSKQADIACQVLRPDPILRPQDFQVKYTSKGNELVMEFQSI 62

Query: 62 DDRVLRVGVSSVIESVKTIIETMDEF 87
          DDRVLRVGVSSVI+SVKTIIET DE 
Sbjct: 63 DDRVLRVGVSSVIDSVKTIIETFDEL 88

>Suva_11.332 Chr11 (610692..610730,610734..610769,610773..611030)
           [333 bp, 111 aa] {ON} YKR095W-A (REAL)
          Length = 111

 Score =  103 bits (257), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 55/111 (49%), Positives = 68/111 (61%), Gaps = 23/111 (20%)

Query: 1   MKNTRQMSLDHHLY-----------------------LEIPLETPSQAIIAMKALKPDPV 37
           MK+ R+M LDH L                        L+IP ET  QA IA + L PDP+
Sbjct: 1   MKSQREMPLDHTLVERIFKGRPSEVFTNYGMFQNTRELKIPFETEKQANIATRVLSPDPI 60

Query: 38  LKPEDFQVEYSAADYKLCVSFKSIDDRVLRVGVSSVIESVKTIIETMDEFG 88
           LKP+DFQ +YS+ +  +   F+SIDDRVLRVGVSSVI+S+KTIIETMDE  
Sbjct: 61  LKPQDFQADYSSENNVMLARFRSIDDRVLRVGVSSVIDSIKTIIETMDELS 111

>ZYRO0B16368g Chr2 (1328001..1328023,1328088..1328322) [258 bp, 85
          aa] {ON} similar to uniprot|Q3E833 Saccharomyces
          cerevisiae YKR095W-A
          Length = 85

 Score =  101 bits (252), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 48/79 (60%), Positives = 62/79 (78%)

Query: 9  LDHHLYLEIPLETPSQAIIAMKALKPDPVLKPEDFQVEYSAADYKLCVSFKSIDDRVLRV 68
          LDH+L+L IP      + +A+K L+PDP+L+PEDFQVEY +    L + FKS+DDRVLRV
Sbjct: 4  LDHNLHLTIPFPNDRYSEVAVKVLRPDPILRPEDFQVEYKSKGNLLEIDFKSVDDRVLRV 63

Query: 69 GVSSVIESVKTIIETMDEF 87
          GVSSVI+SVKTI+ET+DE 
Sbjct: 64 GVSSVIDSVKTIVETIDEL 82

>KNAG0C06620 Chr3 (1283525..1283568,1283654..1283915) [306 bp, 101
          aa] {ON} Anc_5.705 YKR095W-A
          Length = 101

 Score =  101 bits (251), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 49/86 (56%), Positives = 61/86 (70%)

Query: 2  KNTRQMSLDHHLYLEIPLETPSQAIIAMKALKPDPVLKPEDFQVEYSAADYKLCVSFKSI 61
          K  R  +LDH L L +P ETP QA+IA + L+PDP+LKP+DF V Y+A    L   F   
Sbjct: 4  KTARPAALDHTLTLNVPFETPRQALIASQVLQPDPILKPQDFAVSYAAQGPCLEARFCGR 63

Query: 62 DDRVLRVGVSSVIESVKTIIETMDEF 87
          D RVLRVGVSSVI+S+KTIIE++DE 
Sbjct: 64 DARVLRVGVSSVIDSLKTIIESLDEL 89

>TPHA0E00200 Chr5 complement(25648..25882,26105..26127) [258 bp,
          85 aa] {ON} Anc_5.705 YKR095W-A
          Length = 85

 Score = 97.4 bits (241), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 59/73 (80%)

Query: 15 LEIPLETPSQAIIAMKALKPDPVLKPEDFQVEYSAADYKLCVSFKSIDDRVLRVGVSSVI 74
          L IP ET  QA IA + LKPDP L+PE+F+V+YS+    L V+F+S+DDRVLRVGVS+VI
Sbjct: 10 LNIPFETSKQASIAAQVLKPDPQLRPEEFKVDYSSQGSDLVVNFQSVDDRVLRVGVSNVI 69

Query: 75 ESVKTIIETMDEF 87
          +S+KTIIET+DE 
Sbjct: 70 DSIKTIIETIDEL 82

>Ecym_4016 Chr4 complement(39497..39874) [378 bp, 125 aa] {ON}
           similar to Ashbya gossypii AFR289W
          Length = 125

 Score = 95.5 bits (236), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 56/74 (75%)

Query: 15  LEIPLETPSQAIIAMKALKPDPVLKPEDFQVEYSAADYKLCVSFKSIDDRVLRVGVSSVI 74
           LE+P E   QA IA + L  DPVL+PEDF+V+Y+    KL V+F SID R LRVGVSSVI
Sbjct: 51  LEVPFENGKQAEIAREVLHHDPVLRPEDFRVDYTIQHEKLLVNFNSIDARSLRVGVSSVI 110

Query: 75  ESVKTIIETMDEFG 88
           ES+KT++ETMDEF 
Sbjct: 111 ESIKTVVETMDEFS 124

>NDAI0E05060 Chr5 (1159116..1159376) [261 bp, 86 aa] {ON}
          Anc_5.705 YKR095W-A
          Length = 86

 Score = 92.0 bits (227), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 47/84 (55%), Positives = 60/84 (71%), Gaps = 4/84 (4%)

Query: 8  SLDHHLYLEIPLETPSQAIIAMKALKPDPVLKPEDFQVEY----SAADYKLCVSFKSIDD 63
          +LD+ L + IP      A IA + L PDP+LKPEDFQVEY    +  +  L V F+SID+
Sbjct: 3  TLDYTLEIRIPFPEERMATIAQQVLSPDPILKPEDFQVEYLKPATQHNNVLLVKFQSIDE 62

Query: 64 RVLRVGVSSVIESVKTIIETMDEF 87
          RVLRVGVSSV++S+KTI+ETMDE 
Sbjct: 63 RVLRVGVSSVLDSIKTILETMDEL 86

>AFR289W Chr6 (960013..960026,960078..960309) [246 bp, 81 aa] {ON}
          Syntenic homolog to Saccharomyces cerevisiae YKR095W-A
          (PCC1); 1-intron
          Length = 81

 Score = 78.6 bits (192), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 53/79 (67%)

Query: 9  LDHHLYLEIPLETPSQAIIAMKALKPDPVLKPEDFQVEYSAADYKLCVSFKSIDDRVLRV 68
          +DH L+L +P E+   A IA +AL PDP+L+PE+  V +++    L +   +ID RVLRV
Sbjct: 1  MDHTLHLHVPFESARLADIAARALAPDPLLRPEELSVSFASDGASLNIKLAAIDARVLRV 60

Query: 69 GVSSVIESVKTIIETMDEF 87
            +S+ E++KT++ET DE 
Sbjct: 61 ATNSIFEALKTVVETADEL 79

>CAGL0G02535g Chr7 (230231..230268,230360..230570,230769..230942)
          [423 bp, 140 aa] {ON} similar to uniprot|Q3E833
          Saccharomyces cerevisiae YKR095W-A PCC1 Protein of
          unknown function
          Length = 140

 Score = 70.1 bits (170), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 39/53 (73%)

Query: 15 LEIPLETPSQAIIAMKALKPDPVLKPEDFQVEYSAADYKLCVSFKSIDDRVLR 67
          L +P ET   A+IA + L+PDP+L+PEDFQVEY A    L + FK+IDDRVLR
Sbjct: 31 LHVPFETARDALIAQRVLQPDPILRPEDFQVEYEAKATVLDIHFKAIDDRVLR 83

>NDAI0G04290 Chr7 complement(1030530..1033871) [3342 bp, 1113 aa]
           {ON} Anc_3.92
          Length = 1113

 Score = 30.0 bits (66), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 32/63 (50%)

Query: 12  HLYLEIPLETPSQAIIAMKALKPDPVLKPEDFQVEYSAADYKLCVSFKSIDDRVLRVGVS 71
           H  L   + +P   I++  A   + V KPE F    + +D +     KSID+ ++++G  
Sbjct: 636 HRRLSASVSSPMLPIVSPPATPRELVKKPELFSKFMNKSDIEWSFYLKSIDEHIIKIGEF 695

Query: 72  SVI 74
           +VI
Sbjct: 696 NVI 698

>KAFR0A05120 Chr1 (1015307..1019746) [4440 bp, 1479 aa] {ON} Anc_6.29
            YOL004W
          Length = 1479

 Score = 29.6 bits (65), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 9/27 (33%), Positives = 18/27 (66%)

Query: 43   FQVEYSAADYKLCVSFKSIDDRVLRVG 69
            F++EY+  D  +C+ + ++DD  L+ G
Sbjct: 1282 FRIEYNKDDRNICIQYIALDDLTLKEG 1308

>CAGL0J07722g Chr10 complement(753637..754425) [789 bp, 262 aa] {ON}
           similar to uniprot|P53853 Saccharomyces cerevisiae
           YNL246w
          Length = 262

 Score = 28.9 bits (63), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 21/40 (52%)

Query: 46  EYSAADYKLCVSFKSIDDRVLRVGVSSVIESVKTIIETMD 85
           +YS  D+++ + F SIDD      VS V + +K  I   D
Sbjct: 94  QYSVGDFRITLHFNSIDDDFNEQTVSKVFKLIKGDINEGD 133

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.133    0.366 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 8,936,620
Number of extensions: 302924
Number of successful extensions: 754
Number of sequences better than 10.0: 26
Number of HSP's gapped: 752
Number of HSP's successfully gapped: 26
Length of query: 89
Length of database: 53,481,399
Length adjustment: 60
Effective length of query: 29
Effective length of database: 46,601,439
Effective search space: 1351441731
Effective search space used: 1351441731
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 59 (27.3 bits)