Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0E14960g5.704ON38438419360.0
Kwal_55.196885.704ON3933868981e-118
KLTH0E01012g5.704ON3863868761e-115
KNAG0C066105.704ON3863738311e-108
ZYRO0G06556g5.704ON3793738251e-107
TDEL0B021605.704ON3753298141e-106
KLLA0A00550g5.704ON3803037961e-103
NCAS0A031905.704ON3983987714e-99
TPHA0D046205.704ON4063687708e-99
KAFR0H002005.704ON3893847583e-97
AFR288C5.704ON4653357611e-96
CAGL0G02519g5.704ON3783246878e-87
NDAI0E050505.704ON4513546486e-80
Kpol_YGOB_Anc_5.7045.704ON2072024135e-48
KNAG0M011106.48ON598102860.049
TPHA0J005306.48ON58985840.072
TDEL0G042206.48ON632122820.15
Kpol_187.28.82ON50191800.23
Skud_12.3406.48ON680121790.31
Smik_12.3356.48ON678121770.57
CAGL0L04554g6.48ON56085770.63
YLR260W (LCB5)6.48ON687122760.71
Skud_15.3336.48ON627121760.82
NDAI0I023706.48ON760177751.0
CAGL0K05995g6.48ON794121751.1
KAFR0G026206.48ON60183741.2
Suva_10.3586.48ON680162731.6
ZYRO0C07084g6.48ON647123722.0
KNAG0E027306.48ON748107703.9
Suva_9.1337.258ON80478695.1
Smik_9.1197.258ON80479695.4
KLLA0C05368g6.100ON160590695.8
TBLA0E031806.48ON69472696.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0E14960g
         (384 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0E14960g Chr5 complement(1244456..1245610) [1155 bp, 384 aa]...   750   0.0  
Kwal_55.19688 s55 (79793..80974) [1182 bp, 393 aa] {ON} [contig ...   350   e-118
KLTH0E01012g Chr5 (96295..97455) [1161 bp, 386 aa] {ON} conserve...   342   e-115
KNAG0C06610 Chr3 complement(1282191..1283351) [1161 bp, 386 aa] ...   324   e-108
ZYRO0G06556g Chr7 (518731..519870) [1140 bp, 379 aa] {ON} conser...   322   e-107
TDEL0B02160 Chr2 (384824..385951) [1128 bp, 375 aa] {ON} Anc_5.704    318   e-106
KLLA0A00550g Chr1 (50099..51241) [1143 bp, 380 aa] {ON} conserve...   311   e-103
NCAS0A03190 Chr1 (626695..627891) [1197 bp, 398 aa] {ON} Anc_5.704    301   4e-99
TPHA0D04620 Chr4 complement(1010489..1011709) [1221 bp, 406 aa] ...   301   8e-99
KAFR0H00200 Chr8 (25900..27069) [1170 bp, 389 aa] {ON} Anc_5.704      296   3e-97
AFR288C Chr6 complement(958787..960184) [1398 bp, 465 aa] {ON} N...   297   1e-96
CAGL0G02519g Chr7 complement(228822..229958) [1137 bp, 378 aa] {...   269   8e-87
NDAI0E05050 Chr5 complement(1156499..1157854) [1356 bp, 451 aa] ...   254   6e-80
Kpol_YGOB_Anc_5.704 s2001 complement(209387..210010) [624 bp, 20...   163   5e-48
KNAG0M01110 Chr13 complement(197296..199092) [1797 bp, 598 aa] {...    38   0.049
TPHA0J00530 Chr10 (120581..122350) [1770 bp, 589 aa] {ON} Anc_6....    37   0.072
TDEL0G04220 Chr7 complement(765502..767400) [1899 bp, 632 aa] {O...    36   0.15 
Kpol_187.2 s187 complement(5603..6799,7040..7348) [1506 bp, 501 ...    35   0.23 
Skud_12.340 Chr12 (606790..608832) [2043 bp, 680 aa] {ON} YLR260...    35   0.31 
Smik_12.335 Chr12 (603893..605929) [2037 bp, 678 aa] {ON} YLR260...    34   0.57 
CAGL0L04554g Chr12 complement(526735..528417) [1683 bp, 560 aa] ...    34   0.63 
YLR260W Chr12 (665844..667907) [2064 bp, 687 aa] {ON}  LCB5Minor...    34   0.71 
Skud_15.333 Chr15 complement(600768..602651) [1884 bp, 627 aa] {...    34   0.82 
NDAI0I02370 Chr9 (540379..542661) [2283 bp, 760 aa] {ON} Anc_6.4...    33   1.0  
CAGL0K05995g Chr11 (583945..586329) [2385 bp, 794 aa] {ON} simil...    33   1.1  
KAFR0G02620 Chr7 complement(541557..543362) [1806 bp, 601 aa] {O...    33   1.2  
Suva_10.358 Chr10 (627071..629113) [2043 bp, 680 aa] {ON} YLR260...    33   1.6  
ZYRO0C07084g Chr3 complement(533008..534951) [1944 bp, 647 aa] {...    32   2.0  
KNAG0E02730 Chr5 complement(542414..544660) [2247 bp, 748 aa] {O...    32   3.9  
Suva_9.133 Chr9 complement(223449..225863) [2415 bp, 804 aa] {ON...    31   5.1  
Smik_9.119 Chr9 complement(207819..210233) [2415 bp, 804 aa] {ON...    31   5.4  
KLLA0C05368g Chr3 (481598..486415) [4818 bp, 1605 aa] {ON} some ...    31   5.8  
TBLA0E03180 Chr5 (801485..803569) [2085 bp, 694 aa] {ON} Anc_6.4...    31   6.0  

>SAKL0E14960g Chr5 complement(1244456..1245610) [1155 bp, 384 aa]
           {ON} conserved hypothetical protein
          Length = 384

 Score =  750 bits (1936), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/384 (95%), Positives = 368/384 (95%)

Query: 1   MAKAVNKPLLQIGSTLYSVDIEKDGSVYSSFVLKAEKXXXXXXXXXXXXXXXXELIILDS 60
           MAKAVNKPLLQIGSTLYSVDIEKDGSVYSSFVLKAEK                ELIILDS
Sbjct: 1   MAKAVNKPLLQIGSTLYSVDIEKDGSVYSSFVLKAEKLSTVSSSLISLPSANSELIILDS 60

Query: 61  VMSGIGRKTQADFSTQVIKPILEKLGAEHKIIKTQSSTSIAEFAREIEPSKSYTIIFLSG 120
           VMSGIGRKTQADFSTQVIKPILEKLGAEHKIIKTQSSTSIAEFAREIEPSKSYTIIFLSG
Sbjct: 61  VMSGIGRKTQADFSTQVIKPILEKLGAEHKIIKTQSSTSIAEFAREIEPSKSYTIIFLSG 120

Query: 121 DTSISEFLNHIPTQNSNSKHALNIYPIPMGTGNAWASSLNLKCPVESFQKFLKNDLIASK 180
           DTSISEFLNHIPTQNSNSKHALNIYPIPMGTGNAWASSLNLKCPVESFQKFLKNDLIASK
Sbjct: 121 DTSISEFLNHIPTQNSNSKHALNIYPIPMGTGNAWASSLNLKCPVESFQKFLKNDLIASK 180

Query: 181 FPLYRASFPNGYSTIFFIILSIGFHANLLHLCNHSKYKVMGVERFKAASAQIFKNYDLKY 240
           FPLYRASFPNGYSTIFFIILSIGFHANLLHLCNHSKYKVMGVERFKAASAQIFKNYDLKY
Sbjct: 181 FPLYRASFPNGYSTIFFIILSIGFHANLLHLCNHSKYKVMGVERFKAASAQIFKNYDLKY 240

Query: 241 KVSIPNRVSGCYAYFAIINTPNLEPTYKPSPLSDPLTSALHLLGFESSLKSSELIKRITR 300
           KVSIPNRVSGCYAYFAIINTPNLEPTYKPSPLSDPLTSALHLLGFESSLKSSELIKRITR
Sbjct: 241 KVSIPNRVSGCYAYFAIINTPNLEPTYKPSPLSDPLTSALHLLGFESSLKSSELIKRITR 300

Query: 301 GRTAQKGDDIMDTGVIYEKLEKDFDIVVEHSPSASDRIKFEICCDGQLLNLLDMQGTEGS 360
           GRTAQKGDDIMDTGVIYEKLEKDFDIVVEHSPSASDRIKFEICCDGQLLNLLDMQGTEGS
Sbjct: 301 GRTAQKGDDIMDTGVIYEKLEKDFDIVVEHSPSASDRIKFEICCDGQLLNLLDMQGTEGS 360

Query: 361 FDGTIKVSFLQDYSPFNLKVLSPA 384
           FDGTIKVSFLQDYSPFNLKVLSPA
Sbjct: 361 FDGTIKVSFLQDYSPFNLKVLSPA 384

>Kwal_55.19688 s55 (79793..80974) [1182 bp, 393 aa] {ON} [contig
           159] FULL
          Length = 393

 Score =  350 bits (898), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 175/386 (45%), Positives = 244/386 (63%), Gaps = 4/386 (1%)

Query: 1   MAKAVNKPLLQIGSTLYSVDIEKDGSVYSSFVL--KAEKXXXXXXXXXXXXXXXXELIIL 58
           MA+ V  PL+   +T +SV +E +GS   SF L                      +++++
Sbjct: 1   MAQIVEVPLVCSHNTQFSVVVETEGSKNVSFSLLRHPNDQFSATLDPELVSRKKGDILVV 60

Query: 59  DSVMSGIGRKTQADFSTQVIKPILEKLGAEHKIIKTQSSTSIAEFAREIEP-SKSYTIIF 117
           DS+ SG GR  + DF T VI+P+  +LG +++++KT++  S+AE  R   P  ++ T+IF
Sbjct: 61  DSIKSGTGRDVKNDFCTNVIQPVFTELGLDYRVVKTENENSVAELGRNFRPCGQNTTVIF 120

Query: 118 LSGDTSISEFLNHIPTQNSNS-KHALNIYPIPMGTGNAWASSLNLKCPVESFQKFLKNDL 176
           LSGDTSISEF+N++  +   + +  +N+  +P+GTGNAWA+SL  +    +  +FL+  L
Sbjct: 121 LSGDTSISEFVNNLTQEQQGTIRPTVNLLALPLGTGNAWANSLGFRTAATALAEFLQGFL 180

Query: 177 IASKFPLYRASFPNGYSTIFFIILSIGFHANLLHLCNHSKYKVMGVERFKAASAQIFKNY 236
               FPLY+A FPNGY  +FFIILSIGFHANLLHLC+  ++K +GVERF+ AS +IF++Y
Sbjct: 181 KPKNFPLYKAIFPNGYEIVFFIILSIGFHANLLHLCDQPRFKKLGVERFRLASKEIFEDY 240

Query: 237 DLKYKVSIPNRVSGCYAYFAIINTPNLEPTYKPSPLSDPLTSALHLLGFESSLKSSELIK 296
            L Y + +  R    Y+YFA+INTPNLE  YKPSP S+PLTS LHLLG+ S L    LI 
Sbjct: 241 ILDYPLQVTQRPLEHYSYFALINTPNLEQNYKPSPKSNPLTSELHLLGYSSGLPQPMLIN 300

Query: 297 RITRGRTAQKGDDIMDTGVIYEKLEKDFDIVVEHSPSASDRIKFEICCDGQLLNLLDMQG 356
           RI +G + Q   DI + GV Y+    D D+V    P    R  F+ICCDG LLN+L  Q 
Sbjct: 301 RIMKGYSNQPETDINEEGVTYQAFSNDLDVVFAQDPELVPRSAFDICCDGHLLNMLSQQP 360

Query: 357 TEGSFDGTIKVSFLQDYSPFNLKVLS 382
             GSFDG I V FL+++S F+LKVLS
Sbjct: 361 AHGSFDGRIHVKFLKEHSSFHLKVLS 386

>KLTH0E01012g Chr5 (96295..97455) [1161 bp, 386 aa] {ON} conserved
           hypothetical protein
          Length = 386

 Score =  342 bits (876), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 166/386 (43%), Positives = 240/386 (62%), Gaps = 3/386 (0%)

Query: 1   MAKAVNKPLLQIGSTLYSVDIEKDGSVYSSFVLKAE-KXXXXXXXXXXXXXXXXELIILD 59
           M + V  PL+    T +   +E D + Y+SF L +                   +++I+D
Sbjct: 1   MKQVVEVPLVSTAKTQFWACVETDDNKYTSFSLVSRPNEYGDASLDPQLTRGQKDILIVD 60

Query: 60  SVMSGIGRKTQADFSTQVIKPILEKLGAEHKIIKTQSSTSIAEFAREIEPSKSYTI-IFL 118
           S+ SG GR ++ +F   V++P+   LG  HK+++TQ S +  +     +PS   TI IFL
Sbjct: 61  SIKSGTGRDSRNNFGKNVLEPLFTLLGIPHKVVRTQDSDAAGQLGHTFQPSTENTILIFL 120

Query: 119 SGDTSISEFLNHIPTQN-SNSKHALNIYPIPMGTGNAWASSLNLKCPVESFQKFLKNDLI 177
           SGDT+ISEFLN +  +     +H L++ P+P+GTGNAWA+SL L+CP  S   FL+  L 
Sbjct: 121 SGDTTISEFLNGLNRRVFEGLRHTLSLVPLPLGTGNAWANSLGLRCPAASLSCFLQGQLT 180

Query: 178 ASKFPLYRASFPNGYSTIFFIILSIGFHANLLHLCNHSKYKVMGVERFKAASAQIFKNYD 237
             KFPLY+A+FPNG+  IFFIILSIGFHANLLHLC   +++ +GVERFK AS +I + Y 
Sbjct: 181 PRKFPLYKATFPNGFEMIFFIILSIGFHANLLHLCKQQRFQSLGVERFKIASLEILQKYP 240

Query: 238 LKYKVSIPNRVSGCYAYFAIINTPNLEPTYKPSPLSDPLTSALHLLGFESSLKSSELIKR 297
           L+Y++ +    +  Y+YFA+INTPNLE +YKPSP S+ L   LH+LG+ S L+ + L+ +
Sbjct: 241 LEYRLQVSGLPTRDYSYFALINTPNLEASYKPSPQSNSLHFQLHVLGYSSKLQQASLVSK 300

Query: 298 ITRGRTAQKGDDIMDTGVIYEKLEKDFDIVVEHSPSASDRIKFEICCDGQLLNLLDMQGT 357
           I +G + + GDDI   GVIYE      ++V +  P       FEICCDG LLN+L +Q  
Sbjct: 301 IMKGYSNRAGDDISGDGVIYEPYNHALEVVFDQVPENVSNTYFEICCDGHLLNMLSLQPQ 360

Query: 358 EGSFDGTIKVSFLQDYSPFNLKVLSP 383
           +  FDG I++ FL+++S F L V+ P
Sbjct: 361 DQKFDGRIRIQFLKNFSSFELNVMVP 386

>KNAG0C06610 Chr3 complement(1282191..1283351) [1161 bp, 386 aa]
           {ON} Anc_5.704
          Length = 386

 Score =  324 bits (831), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 163/373 (43%), Positives = 240/373 (64%), Gaps = 5/373 (1%)

Query: 1   MAKAVNKPLLQIGSTLYSVDIEKDGSVYSSFVLKAEKXXXXXXXXXXXXXXXXELIILDS 60
           M   V K L+       SV+I+KDGS Y+ F L +E                  LI+LDS
Sbjct: 1   MITTVRKHLVDFCGERISVEIDKDGSKYTKFALLSEPCPQECAPPQLFTRE--NLIVLDS 58

Query: 61  VMSGIGRKTQADFSTQVIKPILEKLGAEHKIIKTQSSTSIAEFAREIEPSKSYTIIFLSG 120
           V SG GR +  D +  VI+P+L +L A ++++K+Q+S S+AEF  +++P++SYTI+F+SG
Sbjct: 59  VHSGTGRTSGNDITVNVIEPVLRRLHARYQVVKSQNSKSVAEFGNQLDPTQSYTILFVSG 118

Query: 121 DTSISEFLNHIPTQNSNSKHALNIYPIPMGTGNAWASSLNLKCPVESFQKFLKNDLIASK 180
           DTS+SEF N +     + + +L I PI MGTGNA A+SLNL CPVE+F  FL+ +L+ ++
Sbjct: 119 DTSVSEFFNGVGAGVPSPRSSLTILPIAMGTGNALANSLNLNCPVEAFASFLRGELVTAE 178

Query: 181 FPLYRASFPNG-YSTIFFIILSIGFHANLLHLCNHSKYKVMGVERFKAASAQIFKNYDLK 239
           FPLYRA  P+G  S +FFI+LS+GFHANLLH   + KYK MGVERF+ AS  I +NY L+
Sbjct: 179 FPLYRAILPDGETSVVFFIVLSLGFHANLLHAAENEKYKSMGVERFQEASGDILQNYKLQ 238

Query: 240 YKVSIPNR-VSGCYAYFAIINTPNLEPTYKPSPLSDPLTSALHLLGFESSLKSSELIKRI 298
            ++++  + V+G YAYFA++N PNLE +Y PSP SDP    LHLL + SSL   +L++RI
Sbjct: 239 EQITLDKQGVAGSYAYFALVNVPNLEASYIPSPQSDPFKHELHLLAYSSSLNRKQLLERI 298

Query: 299 TRGRTAQKGDDIM-DTGVIYEKLEKDFDIVVEHSPSASDRIKFEICCDGQLLNLLDMQGT 357
             G   ++GD++  D    Y+++ + F+I +++     +   FE+C DGQL NLL  +  
Sbjct: 299 MAGYKNRRGDELTADPYTTYKRISEGFEIKLQNKQEGPNDPAFELCLDGQLYNLLQYKSD 358

Query: 358 EGSFDGTIKVSFL 370
           +   + TI+V  +
Sbjct: 359 QHQEELTIQVELI 371

>ZYRO0G06556g Chr7 (518731..519870) [1140 bp, 379 aa] {ON} conserved
           hypothetical protein
          Length = 379

 Score =  322 bits (825), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 173/373 (46%), Positives = 229/373 (61%), Gaps = 6/373 (1%)

Query: 12  IGSTLYSVDIEKDGSVYSSFVLKAEKXXXXXXXXXXXXXXXXELIILDSVMSGIGRKTQA 71
            G   Y V   KDGS Y+SF L  EK                 LI+LDS+ SGIGR    
Sbjct: 10  FGEFEYYVTFAKDGSKYTSFQL--EKSHAKQSSRASTRSDDSTLIVLDSLKSGIGRTENN 67

Query: 72  DFSTQVIKPILEKLGAEHKIIKTQSSTSIAEFAREIEPSKSYTIIFLSGDTSISEFLNHI 131
           DF + VI PILE+L   H  IKT S  S+++FA+ ++P + Y I  +SGDT+ISEF N++
Sbjct: 68  DFYSIVIAPILEELNWNHNYIKTTSHDSVSQFAQSLDPLQDYEIWIISGDTTISEFCNNL 127

Query: 132 PTQNSNSKHALNIYPIPMGTGNAWASSLNLKCPVESFQKFLKNDLIASKFPLYRASFPNG 191
           P +   +++ L I P+PMGTGNAWA+SL    P+ +F+ +L ++L     PLYRA+ PNG
Sbjct: 128 PNKKI-TRNPLRILPLPMGTGNAWANSLGFDSPITAFRNYLNHNLKPRDIPLYRAALPNG 186

Query: 192 YSTIFFIILSIGFHANLLHLCNHSKYKVMGVERFKAASAQIFKNYDLKYKVSIPNRVSGC 251
           YS IFF+I S+GFHANLLH C   KY  MG ERF+ A+  I ++Y L   +S+ + +   
Sbjct: 187 YSIIFFMIFSLGFHANLLHACEDPKYAKMGAERFQIAAQSILESYSLDLDISL-DGLRRS 245

Query: 252 YAYFAIINTPNLEPTYKPSPLSDPLTSALHLLGFESSLKSSELIKRITRG-RTAQKGDDI 310
           YAYFA+INTPNLE TYKPSP S+PL   L LLG+ SSL   EL+++I +G +    GD  
Sbjct: 246 YAYFALINTPNLEATYKPSPRSNPLERELRLLGYSSSLGRQELVEKIMQGYQNKPNGDLP 305

Query: 311 MDTGVIYEKLEKDFDIVVEHSPSASDRIKFEICCDGQLLNLLDMQGTEGSF-DGTIKVSF 369
            +  +IY+ +  DF +V+  S   S   KFEICCDG LLNLLD Q  +       I+  F
Sbjct: 306 TNEDMIYKSITHDFTLVLNDSLEDSSMHKFEICCDGILLNLLDYQSPDKHKPSNEIRFQF 365

Query: 370 LQDYSPFNLKVLS 382
           L DYS F L+V S
Sbjct: 366 LNDYSGFQLQVYS 378

>TDEL0B02160 Chr2 (384824..385951) [1128 bp, 375 aa] {ON} Anc_5.704
          Length = 375

 Score =  318 bits (814), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 156/329 (47%), Positives = 223/329 (67%), Gaps = 5/329 (1%)

Query: 55  LIILDSVMSGIGRKTQADFSTQVIKPILEKLGAEHKIIKTQSSTSIAEFAREIEPSKSYT 114
           LI++DSV SG GR  Q D  T V+KPI E +  +H++IKT S  +IA +A  ++ S+S+T
Sbjct: 49  LIVIDSVHSGKGRTAQNDLYTIVMKPIFEAVNIDHRLIKTTSRDTIASYASTLDISQSHT 108

Query: 115 IIFLSGDTSISEFLNHIPTQNSNSKHALNIYPIPMGTGNAWASSLNLKCPVESFQKFLKN 174
           ++FLSGDTSISEF+N++P Q + S + L+I   PMG+GNAWASSL + CPV++F +F++ 
Sbjct: 109 VLFLSGDTSISEFINNLP-QGAPSAN-LSILSFPMGSGNAWASSLGIMCPVKTFGQFIRG 166

Query: 175 DLIASKFPLYRASFPNGYSTIFFIILSIGFHANLLHLCNHSKYKVMGVERFKAASAQIFK 234
           ++  S FPLY+A FPNGYS +FFIILS+GFHANL+H C   +Y+ MG+E+F+ A + I K
Sbjct: 167 EMSHSPFPLYKAVFPNGYSIVFFIILSMGFHANLVHACERPEYQRMGIEKFQLAGSVILK 226

Query: 235 NYDLKYKVSIPNRVSGCYAYFAIINTPNLEPTYKPSPLSDPLTSALHLLGFESSLKSSEL 294
            Y+L  K+++ N ++  Y+YFA+INTPNLEP Y+PSP SDPL   L+LLG+ S L   + 
Sbjct: 227 EYELDLKITV-NSLAASYSYFALINTPNLEPAYRPSPESDPLKEELYLLGYSSGLSKDQF 285

Query: 295 IKRITRGRTAQKGDDI-MDTGVIYEKLEKDFDIVVEHSPSASDRIKFEICCDGQLLNLLD 353
           + ++ +G      D + +D+  IY    K FD+ ++     S R K EICCDG LLNL D
Sbjct: 286 LTKVMKGYELGPSDKLPLDSDTIYVPFTKGFDVTLDFPLLESPRYKSEICCDGVLLNLQD 345

Query: 354 MQGTEGSFDGTIKVSFLQDYSPFNLKVLS 382
           +Q  +        + FL  YS FN+K +S
Sbjct: 346 LQA-DLEVSNKFSIEFLNHYSKFNIKAMS 373

>KLLA0A00550g Chr1 (50099..51241) [1143 bp, 380 aa] {ON} conserved
           hypothetical protein
          Length = 380

 Score =  311 bits (796), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 151/303 (49%), Positives = 205/303 (67%), Gaps = 6/303 (1%)

Query: 54  ELIILDSVMSGIGRKTQADFSTQVIKPILEKLGAEHKIIKTQSSTSIAEFAREIEPSKSY 113
           EL+I+DSV SG GR    DF+T VI    E++   +++IKT S +S+ E A  I+ ++ Y
Sbjct: 60  ELLIVDSVFSGSGRDKDCDFATNVIAQFFEQVIVPYRLIKTTSKSSVIELASSIDSTRQY 119

Query: 114 TIIFLSGDTSISEFLNHIPTQNSNSKHALNIYPIPMGTGNAWASSLNLKCPVESFQKFLK 173
           T++FLSGDTSISEF+N++P  +      +++ P PMGTGNAWASSL L  P   F +F+ 
Sbjct: 120 TVLFLSGDTSISEFVNNLPLNHD----CISVLPFPMGTGNAWASSLKLMDPAVIFSQFVN 175

Query: 174 NDLIASKFPLYRASFPNGYSTIFFIILSIGFHANLLHLCNHSKYKVMGVERFKAASAQIF 233
             L  + FPLYRA+F NGY   FFIILS+GFHANLLHLC   +Y+ MG+ERF+ AS +I 
Sbjct: 176 GKLSCNDFPLYRATFDNGYVLKFFIILSLGFHANLLHLCEEDEYQKMGIERFRVASQRIL 235

Query: 234 KNYDLKYKVSIPNRVSGCYAYFAIINTPNLEPTYKPSPLSDPLTSALHLLGFESSLKSSE 293
           + Y L+ +VSIP+ + G ++YFA+INT NLEPTY PSP SDPL S LH+L ++SSL   E
Sbjct: 236 REYKLESRVSIPDILEGSFSYFALINTTNLEPTYMPSPDSDPLESQLHVLAYQSSLDRVE 295

Query: 294 LIKRITRGRTAQKGDDIMDTGVIYEKLEKDFDIVVEHSPSASDRIKFEICCDGQLLNLLD 353
             KR+  G +  K  +I+  G  Y  L   F++ V   P  S +  FE+CCDGQLLNLL+
Sbjct: 296 FQKRVFMGYSNTKHSNILQNGTFYRPLPFCFNVEVLDDP--SQKSNFEVCCDGQLLNLLE 353

Query: 354 MQG 356
           ++G
Sbjct: 354 LEG 356

>NCAS0A03190 Chr1 (626695..627891) [1197 bp, 398 aa] {ON} Anc_5.704
          Length = 398

 Score =  301 bits (771), Expect = 4e-99,   Method: Compositional matrix adjust.
 Identities = 168/398 (42%), Positives = 232/398 (58%), Gaps = 16/398 (4%)

Query: 1   MAKAVNKPLLQIGSTLYSVDIEKDGSVYSSFVLKAEKXXXXXXXXXXX---XXXXXELII 57
           M+K++ + LL I    Y V+   +GS Y SF L  E                    +LI+
Sbjct: 1   MSKSIKQYLLTIDHDHYYVETVLEGSAYKSFNLLIEDSTPLSVDRKLQFVPLKDTAQLIV 60

Query: 58  LDSVMSGIGRKTQADFSTQVIKPILEKLGAEHKIIKTQSSTSIAEFAREIEPSKSYTIIF 117
           +DS+ SG GR +  DF   V++PI  KL   H ++KT S  S+  FA +++ +K Y I F
Sbjct: 61  IDSIHSGGGRTSDNDFYRNVMEPIFIKLNLTHLLVKTTSKDSVENFASKLDLTKHYEIFF 120

Query: 118 LSGDTSISEFLNHIPTQN---SNSKHALNIYPIPMGTGNAWASSLNLKCPVESFQKFLKN 174
           LSGDT+ISEF+N +P Q+   +++K++L+I P P GTGNA A+SL L CP   F  +L +
Sbjct: 121 LSGDTTISEFINGLPKQSLDVNDAKNSLSILPFPFGTGNALANSLGLTCPTTIFSNYLTS 180

Query: 175 DLIASKFPLYRASFPNGYSTIFFIILSIGFHANLLHLCNHSKYKVMGVERFKAASAQIFK 234
           +   + FPLY+A FPNG   +FF+ILS+GFHANLLH C    YK +GVERF+ AS  I  
Sbjct: 181 NYSINNFPLYKAIFPNGNEIVFFVILSLGFHANLLHCCEAPHYKKLGVERFRIASEDILA 240

Query: 235 NYDLKYKVSI-------PNRVSGCYAYFAIINTPNLEPTYKPSPLSDPLTSALHLLGFES 287
           NYDL   +SI       P   S  Y+YF ++NTP LE  Y PSP S+PL S LH++ + S
Sbjct: 241 NYDLDLNISIESPRGLSPIVPSREYSYFVVVNTPKLEAKYIPSPQSNPLRSQLHIIAYSS 300

Query: 288 SLKSSELIKRITRGRTAQKGDDIMDTGVIYEKLEKDFDIVVEHSPSASDRIKFEICCDGQ 347
           SL   EL+ RI +G     GD + +TGV Y  +E +F I + +S   S   KF++CCDG 
Sbjct: 301 SLPKDELMARILKGYENNIGDVVNNTGVTYLPIEDNFIIKLNYSQEYSPSSKFQLCCDGL 360

Query: 348 LLNLLDM--QGTEGSF-DGTIKVSFLQDYSPFNLKVLS 382
           L NL D   +   G   +  I + FL  YSPF L ++S
Sbjct: 361 LFNLNDFIHKNDNGPCKNNEILIEFLSTYSPFQLSLMS 398

>TPHA0D04620 Chr4 complement(1010489..1011709) [1221 bp, 406 aa]
           {ON} Anc_5.704
          Length = 406

 Score =  301 bits (770), Expect = 8e-99,   Method: Compositional matrix adjust.
 Identities = 165/368 (44%), Positives = 225/368 (61%), Gaps = 17/368 (4%)

Query: 9   LLQIGSTLYSVDIEKDGSVYSSFVLKAEK-XXXXXXXXXXXXXXXXELIILDSVMSGIGR 67
           L+QIG  +Y V  EK GS YSSF L++ K                 EL+++DS+ SG+GR
Sbjct: 13  LVQIGDMVYDVVAEKKGSKYSSFKLESYKCTEESAALEVHSLLASSELVVIDSICSGVGR 72

Query: 68  KTQADFSTQVIKPILEKLGAEHKIIKTQSSTSIAEFAREIEPSKSYTIIFLSGDTSISEF 127
             Q DF   V+KP+ ++   +HK I+T+   SI + A + E SK YTIIFLSGDTS+SEF
Sbjct: 73  TGQNDFYNNVMKPVFKEANFKHKYIRTEGEDSIKDLATKFEASKDYTIIFLSGDTSVSEF 132

Query: 128 LNH---IPTQN----SNSKHALNIYPIPMGTGNAWASSLNLKCPVESFQKFLKNDLIASK 180
           +N+   +  +N    S +K  +NI+ IP+GTGNA ASS++L  P + FQKFL N+LI   
Sbjct: 133 INNLTKVQKENFISCSENKRQMNIFTIPLGTGNALASSIHLSSPHQVFQKFLNNELIIKD 192

Query: 181 FPLYRASFPNGYSTIFFIILSIGFHANLLHLCNHSKYKVMGVERFKAASAQIFKNYDLKY 240
           FPLY  + PN  + IFFII S+GFHANLLH C+  +Y+ MG ERF  AS  IFKNYDL  
Sbjct: 193 FPLYTVTLPNKKTIIFFIIFSMGFHANLLHACDSDEYQKMGTERFAKASENIFKNYDLNI 252

Query: 241 KVSIPN---RVSGCYAYFAIINTPNLEPTYKPSPLSDPLTSALHLLGFESSLKSSELIKR 297
            ++  N    +S  YAYFAIINTPNLE  Y PSP SD   + LHLLG+++SL + +L+ +
Sbjct: 253 GLTTKNGSESISRNYAYFAIINTPNLELNYMPSPDSDVFKNELHLLGYDASLSTEKLVNK 312

Query: 298 ITRGRTAQKGDDI--MDTGVIYEKLE---KDFDIVVE-HSPSASDRIKFEICCDGQLLNL 351
           I  G + ++ + I   D    Y  +        I++E  S    ++ K++ICCDG LLNL
Sbjct: 313 IMAGYSYKEREKINNKDNLTYYYPVNLSGTGLQIILETDSDKKLEKYKYDICCDGLLLNL 372

Query: 352 LDMQGTEG 359
            D+    G
Sbjct: 373 DDINNQHG 380

>KAFR0H00200 Chr8 (25900..27069) [1170 bp, 389 aa] {ON} Anc_5.704
          Length = 389

 Score =  296 bits (758), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 164/384 (42%), Positives = 240/384 (62%), Gaps = 13/384 (3%)

Query: 7   KPLLQI-GSTLYSVDIEKDGSVYSSFVLKAEKXXXXXXXXXXXXXXXXELIILDSVMSGI 65
           +PL  + GS  + V I KDGS Y +F L A++                 ++++DSV SG 
Sbjct: 9   EPLCTVNGSQSFEVKITKDGSKYHAFKLVAKEVKDDKPCSPPHYE---NVVVIDSVSSGT 65

Query: 66  GRKTQADFSTQVIKPILEKLGAEHKIIKTQSSTSIAEFAREIEPSKSYTIIFLSGDTSIS 125
           GR     F   VIKPI +    +H   KT    SI+ +A+ ++ SKSYT+IF+SGDTSIS
Sbjct: 66  GRNKNNHFYNIVIKPIFDIFKIQHHYFKTTGPKSISTYAKSLDLSKSYTVIFISGDTSIS 125

Query: 126 EFLNHIPT--QNSNS-KHALNIYPIPMGTGNAWASSLNLKCPVESFQKFLKNDLIASKFP 182
           EF+N++P   + SN  KH ++I P+PMGTGNA++SS+  KCP+++   FL N    S FP
Sbjct: 126 EFINNLPPLLETSNGLKHTISILPLPMGTGNAFSSSIGHKCPIQTLSSFLHNRTQPSHFP 185

Query: 183 LYRASFPNGYSTIFFIILSIGFHANLLHLC-NHSKYKVMGVERFKAASAQIFKNYDLKYK 241
           LY   FPNG + IFFIILS+G HAN+LHLC N  +YK  G ERFK A  ++   YDL  +
Sbjct: 186 LYEVIFPNGKTVIFFIILSLGLHANVLHLCENDPQYKKYGEERFKLAFEKVMTTYDLNVR 245

Query: 242 VSIPN-RVSGCYAYFAIINTPNLEPTYKPSPLSDPLTSALHLLGFESSLKSSELIKRITR 300
           + IP   +SG ++YF +INTPNLE +Y PSPLSDP    LH+LG+ SSL + +L+  +T+
Sbjct: 246 LQIPELDLSGAFSYFILINTPNLESSYIPSPLSDPFLEQLHVLGYSSSLNNEDLLNYVTQ 305

Query: 301 GRTAQKGDDIMD-TGVIYEKLEKDFDIVVEHSPSASDRIKFEICCDGQLLNLLDMQGTEG 359
           G + + GD++++ + ++Y+ + ++  IV+      S++ K++ICCDG L NL DM     
Sbjct: 306 GYSNKLGDELVESSNMVYKPISRNVSIVLTED-EESEKYKYDICCDGLLFNLRDMLPENP 364

Query: 360 S-FDGTIKVSFL-QDYSPFNLKVL 381
           +  D  +K +F  +D  PF ++VL
Sbjct: 365 TKEDYVLKTNFKSRDSLPFEVQVL 388

>AFR288C Chr6 complement(958787..960184) [1398 bp, 465 aa] {ON}
           NOHBY633; No homolog in Saccharomyces cerevisiae;
           Methionine is very probably wrong'
          Length = 465

 Score =  297 bits (761), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 146/335 (43%), Positives = 209/335 (62%), Gaps = 14/335 (4%)

Query: 55  LIILDSVMSGIGRKTQADFSTQVIKPILEKLGAEHKIIKTQSSTSIAEFAREIEPSKSYT 114
           L++LDSV SG GR+   DF  +V+ P+L  L  EH+ ++T S+ S+ E A     +   T
Sbjct: 137 LVVLDSVRSGAGREPATDFYAKVMGPVLAVLSVEHEYVRTSSAASVRELAETFPRTSETT 196

Query: 115 IIFLSGDTSISEFLNHIPTQNSNSKHALNIYPIPMGTGNAWASSLNLKCPVESFQKFLKN 174
           ++ +SGDT+ISEF+N +      S   + +Y +P+GT NAWA S+ L  P ++ Q F++ 
Sbjct: 197 VLVMSGDTTISEFVNAL-----GSGAGVTVYALPLGTANAWAHSVGLGTPAKALQAFVQG 251

Query: 175 DLIASKFPLYRASFPNGYSTIFFIILSIGFHANLLHLCNHSKYKVMGVERFKAASAQIFK 234
            + A  FPLYRA FP+GYS  FFI+LS GFHANLLHLCN  +Y+ +GVERF+ AS +I  
Sbjct: 252 RVHAVPFPLYRARFPSGYSIRFFIVLSAGFHANLLHLCNDERYQRLGVERFREASTEILD 311

Query: 235 NYDLKYKVSI-----PNRVSGCYAYFAIINTPNLEPTYKPSPLSDPLTSALHLLGFESSL 289
            Y L   V +       +++G YAYFA++NTP+LE TY PSPLSDPL   LH+L FE+ L
Sbjct: 312 RYALAEHVRVRAADGSEQLAGLYAYFALLNTPHLEETYVPSPLSDPLLKQLHVLAFEAEL 371

Query: 290 KSSELIKRITRGRTAQKGDDIMDTGVIYEKLEKDFDIVVEHSPSASDRIKFEICCDGQLL 349
              +L + +  G +  +G  +   G++Y  L   F + +E+   ASDR+  E+C DG LL
Sbjct: 372 SRDKLNELLMAGYSTIRGSALSAPGLVYRNLGDSFTLSIEN--GASDRVANELCVDGHLL 429

Query: 350 NLLDMQGTEGSFDGTIKVSFLQDYSPFNLKVLSPA 384
           NL+D+Q     FDG+I+V  +   + F LK L PA
Sbjct: 430 NLVDLQAPGDVFDGSIEVGVVP--ASFGLKALVPA 462

>CAGL0G02519g Chr7 complement(228822..229958) [1137 bp, 378 aa] {ON}
           similar to KLLA0A00550g Kluyveromyces lactis
          Length = 378

 Score =  269 bits (687), Expect = 8e-87,   Method: Compositional matrix adjust.
 Identities = 138/324 (42%), Positives = 206/324 (63%), Gaps = 6/324 (1%)

Query: 54  ELIILDSVMSGIGRKTQADFSTQVIKPILEKLGAEHKIIKTQSSTSIAEFARE--IEPSK 111
           ++I++DSV SG  R  ++D    VI+P+ + LG E+K IKT+S  SI +FAR    +   
Sbjct: 50  QIIVIDSVKSGTSRNDRSDLYKLVIEPLFQSLGVEYKYIKTESENSIRDFARRTSFQSGF 109

Query: 112 SYTIIFLSGDTSISEFLNHIPTQNSNS-KHALNIYPIPMGTGNAWASSLNLKCPVESFQK 170
            Y I+FLSGDTSISEF+N + T    S K+ ++I P+P+G+GNA A+SL  K P+++   
Sbjct: 110 KYDILFLSGDTSISEFINALDTTILRSAKYRISILPVPLGSGNALATSLGFKTPLQALIT 169

Query: 171 FLKNDLIASKFPLYRASFPNGYSTIFFIILSIGFHANLLHLCNHSKYKVMGVERFKAASA 230
           +L ++   S  PLY A  PN  S IFFIILS+GFHANLLH     KYK MGVERF+ AS 
Sbjct: 170 YLNSNKKCSPLPLYDAQLPNSTSMIFFIILSLGFHANLLHCAEDPKYKSMGVERFQVASK 229

Query: 231 QIFKNYDLKYKVSIPNRVSGCYAYFAIINTPNLEPTYKPSPLSDPLTSALHLLGFESSLK 290
            +F++YDL   +++    S  Y+YFA+I  PNLEPTYKPSP S  L   LH+LG+++ + 
Sbjct: 230 TVFESYDLNVGIAVNGLQSQSYSYFAVIAAPNLEPTYKPSPKSSVLKKELHILGYKAGIC 289

Query: 291 SSELIKRITRGRTAQKGDDIMDTGVIYEKLEKDFDIVVEHSPSASDRIKFEICCDGQLLN 350
             +L  +I RG   + G+DI + G IY+  +K+ ++ ++   +A  + ++++C DG LLN
Sbjct: 290 LEDLQDKIMRGYHNKDGEDIQEIGTIYQCFQKNLELSIKTGHNAP-KYRYDMCIDGYLLN 348

Query: 351 LLDMQGTEGSFDGTIKVSFLQDYS 374
           L D    +  +   I + F+ D++
Sbjct: 349 LEDCNSKDNEY--KILIRFIDDHA 370

>NDAI0E05050 Chr5 complement(1156499..1157854) [1356 bp, 451 aa]
           {ON} Anc_5.704
          Length = 451

 Score =  254 bits (648), Expect = 6e-80,   Method: Compositional matrix adjust.
 Identities = 153/354 (43%), Positives = 211/354 (59%), Gaps = 41/354 (11%)

Query: 54  ELIILDSVMSGIGRKTQADFSTQVIKPILEKLGAEHKIIKTQSSTSIAEFAREI-----E 108
           +LII+DS  SG+GR  + DF   +++PIL KL  + ++ KT S  SI  FA        +
Sbjct: 83  KLIIIDSTHSGLGRNKENDFYAIIMEPILSKLNIKFELFKTTSKDSIKSFANNFSIKTKD 142

Query: 109 PSK-SYTIIFLSGDTSISEFLNHIPTQN-SNSKHALNIYPIPMGTGNAWASSLNLKCPVE 166
            +K  Y +IFLSGDT+ISEF N++P Q    SK  LNI  IPMGT NAW++SLNL CP++
Sbjct: 143 TTKIDYNLIFLSGDTTISEFFNNLPPQQPQTSKINLNILTIPMGTANAWSNSLNLNCPID 202

Query: 167 SFQKFLKNDLIASKFPLYRASFPN------------GYSTI-FFIILSIGFHANLLHLC- 212
            FQKFL N L  S FPLY    P+            G +TI FFI+LS+GFHANLLHLC 
Sbjct: 203 IFQKFLLNKLTVSPFPLYSLILPHSPSSSSSSGKTGGKNTIYFFIVLSMGFHANLLHLCS 262

Query: 213 NHSKYKVMGVERFKAASAQIFKNYDLKYKVSIPNR-------VSGCYAYFAIINTPNLEP 265
           N  KY  +G+ERFK AS +I  NY+L   ++I +        ++  ++YF ++NTP LE 
Sbjct: 263 NDEKYSNLGLERFKLASDEILSNYNLNLNITIESCNDKSHIILNDSFSYFNLMNTPKLEY 322

Query: 266 TYKPSPLSDPLTSALHLLGFESS-LKSSELIKRITRGRTAQKG----DDIMDTGVIYEKL 320
            Y PSPLSDPL + LH+L ++S      +LIK I +G + + G     +I + G+IY  +
Sbjct: 323 NYIPSPLSDPLKNNLHVLAYKSHPYNKQQLIKNIMKGYSNELGQKNIQNIDEDGIIYFPI 382

Query: 321 -EKDFDIVVEHSPSASDRI----KFEICCDGQLLNLLDMQGTEGSFDGTIKVSF 369
            +K F I + +    S  +     +E+CCDG L NLL+ Q  +G  D   K+SF
Sbjct: 383 NDKKFKITLNNPSPISSSLSLSHNYELCCDGMLFNLLNYQTNQGKQD---KISF 433

>Kpol_YGOB_Anc_5.704 s2001 complement(209387..210010) [624 bp, 207
           aa] {ON} ANNOTATED BY YGOB -
          Length = 207

 Score =  163 bits (413), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 91/202 (45%), Positives = 129/202 (63%), Gaps = 8/202 (3%)

Query: 186 ASFPNGYSTIFFIILSIGFHANLLHLCNHSKYKVMGVERFKAASAQIFKNYDLKYKVSIP 245
           A+FP+     FFIILS+GFHA LLH C+  +   MG ERF+ A+ +I + YDL   + + 
Sbjct: 2   ATFPDDSRIYFFIILSLGFHATLLHACSRPELLKMGTERFQLAAKEILETYDLDLNIKV- 60

Query: 246 NRVSGCYAYFAIINTPNLEPTYKPSPLSDPLTSALHLLGFESSLKSSELIKRITRGRTAQ 305
           N+ +  YAYFAIINT NLE TY PSP S+ L ++L LLG+ S L  +EL+ +I +G   +
Sbjct: 61  NKSTRRYAYFAIINTSNLELTYCPSPKSNVLENSLQLLGYSSKLSRAELVDKIMKGYIIR 120

Query: 306 KGDDI-MDTGVIYEKL---EKDFDIVVEHSPSASDRIKFEICCDGQLLNLLDMQGTEGSF 361
           KGD I  D    YE L   +   DI+V+   + S+  KFEICCDG LL+L  M+ ++G  
Sbjct: 121 KGDVIKTDEYTYYETLDLSQSGIDIIVDEKMNNSNTHKFEICCDGLLLDL--MEKSKGRT 178

Query: 362 DG-TIKVSFLQDYSPFNLKVLS 382
           D  TI ++ ++DY  F+L+VL+
Sbjct: 179 DNLTIHINSVKDYLSFDLQVLT 200

>KNAG0M01110 Chr13 complement(197296..199092) [1797 bp, 598 aa] {ON}
           Anc_6.48 YOR171C
          Length = 598

 Score = 37.7 bits (86), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 50/102 (49%), Gaps = 5/102 (4%)

Query: 61  VMSGIGRKTQA-DFSTQVIKPILEKLGAEHKIIKTQSSTSIAEFAREIEPSKSYTIIFLS 119
           +++  G K QA +   Q   PIL+  G+++ I  T+ S    E A  ++  K  TI+  S
Sbjct: 195 IINPFGGKGQAKNLFFQRAAPILDASGSDYDIAYTERSRHAVEIAESLDIDKYDTIVCAS 254

Query: 120 GDTSISEFLNHIPTQNSNSKHALN---IYPIPMGTGNAWASS 158
           GD    E LN +  +  +   A N   +  +P G+GNA + S
Sbjct: 255 GDGIPYEVLNGL-YRRIDRVAAFNKIVVTQLPCGSGNAMSIS 295

>TPHA0J00530 Chr10 (120581..122350) [1770 bp, 589 aa] {ON} Anc_6.48
           YOR171C
          Length = 589

 Score = 37.0 bits (84), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 43/85 (50%), Gaps = 4/85 (4%)

Query: 79  KPILEKLGAEHKIIKTQSSTSIAEFAREIEPSKSYTIIFLSGDTSISEFLNHIPTQNSNS 138
           +PIL+   A   I  T+ +    + ARE++ SK  TI   SGD    E +N +  Q S+ 
Sbjct: 225 EPILKASTATVDIAYTKYAGHAIDIAREVDLSKYDTIACASGDGIPYEVINGL-NQRSDR 283

Query: 139 KHALN---IYPIPMGTGNAWASSLN 160
             A N   +  IP G+GNA + S +
Sbjct: 284 VDAFNKLAVTQIPCGSGNAMSVSCH 308

>TDEL0G04220 Chr7 complement(765502..767400) [1899 bp, 632 aa] {ON}
           Anc_6.48 YOR171C
          Length = 632

 Score = 36.2 bits (82), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 38/122 (31%), Positives = 52/122 (42%), Gaps = 14/122 (11%)

Query: 79  KPILEKLGAEHKIIKTQSSTSIAEFAREIEPSKSYTIIFLSGDTSISEFLNHIPTQNSNS 138
           KPIL           T+ +    + AREI+  K  TI   SGD    E +N +  Q  + 
Sbjct: 267 KPILLASNCSIDTAYTKYAMHAVDIAREIDLDKYDTIACASGDGIPYEVINGL-YQRPDR 325

Query: 139 KHA---LNIYPIPMGTGNA------WAS--SLNLKCPVESFQKFLKNDLIASKFPLYRAS 187
             A   L I  +P G+GNA      W S  S    C V+S +  +  DL+    P Y  +
Sbjct: 326 AEAFTKLAITQLPCGSGNAMSVSCHWTSNPSYAALCLVKSVEARI--DLMCCSQPSYYQN 383

Query: 188 FP 189
           FP
Sbjct: 384 FP 385

>Kpol_187.2 s187 complement(5603..6799,7040..7348) [1506 bp, 501 aa]
           {ON} complement(5603..6799,7040..7348) [1506 nt, 502 aa]
          Length = 501

 Score = 35.4 bits (80), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 42/91 (46%), Gaps = 18/91 (19%)

Query: 146 PIPMGTGNAWASSLNLKCPVESFQKFLKNDLIASKFPLYRASFPNGYSTIFFIILSIGFH 205
           PI      + AS L L+ PV+S +  L+ND+I+  F    +S PN  ++      S G H
Sbjct: 386 PIDRACIQSLASVLGLESPVDSEEITLRNDIISENFNFSNSSDPNTITS------SEGHH 439

Query: 206 ANL------------LHLCNHSKYKVMGVER 224
                          + +C  SKY+V+ ++R
Sbjct: 440 WKRCSVTLLPILTTNVKICPVSKYRVIDIKR 470

>Skud_12.340 Chr12 (606790..608832) [2043 bp, 680 aa] {ON} YLR260W
           (REAL)
          Length = 680

 Score = 35.0 bits (79), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 35/121 (28%), Positives = 53/121 (43%), Gaps = 12/121 (9%)

Query: 79  KPILEKLGAEHKIIKTQSSTSIAEFAREIEPSKSYTIIFLSGDTSISEFLNHIPTQNSNS 138
           KP+L       +++ T+      E ARE++  K  TI   SGD    E +N +  +    
Sbjct: 284 KPLLLASRCSIEVVYTKYPGHAIEIAREMDIDKYDTIACASGDGIPHEVINGLYRRPDRV 343

Query: 139 K--HALNIYPIPMGTGNA------WAS--SLNLKCPVESFQKFLKNDLIASKFPLYRASF 188
           K  + L I  IP G+GNA      W +  S +  C ++S +   K DL+    P Y    
Sbjct: 344 KAFNQLAITEIPCGSGNAMSVSCHWTNNPSYSTLCLIKSVE--TKIDLMCCSQPSYAREH 401

Query: 189 P 189
           P
Sbjct: 402 P 402

>Smik_12.335 Chr12 (603893..605929) [2037 bp, 678 aa] {ON} YLR260W
           (REAL)
          Length = 678

 Score = 34.3 bits (77), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 54/121 (44%), Gaps = 12/121 (9%)

Query: 79  KPILEKLGAEHKIIKTQSSTSIAEFAREIEPSKSYTIIFLSGDTSISEFLNHIPTQNSNS 138
           KP+L       +++ T+      E ARE++  +  TI   SGD    E +N +  +  + 
Sbjct: 284 KPLLLASQCSIEVVYTKYPGHAIEIAREMDIDQYDTIACASGDGIPHEVINGLYRRPDHV 343

Query: 139 K--HALNIYPIPMGTGNA------WAS--SLNLKCPVESFQKFLKNDLIASKFPLYRASF 188
           K  + L I  IP G+GNA      W +  S +  C ++S +   K DL+    P Y    
Sbjct: 344 KAFNKLAITEIPCGSGNAMSVSCHWTNNPSYSTLCLIKSIE--TKIDLMCCSQPSYAKKH 401

Query: 189 P 189
           P
Sbjct: 402 P 402

>CAGL0L04554g Chr12 complement(526735..528417) [1683 bp, 560 aa]
           {ON} similar to uniprot|Q12246 Saccharomyces cerevisiae
           YOR171c LCB4
          Length = 560

 Score = 34.3 bits (77), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 44/85 (51%), Gaps = 2/85 (2%)

Query: 78  IKPILEKLGAEHKIIKTQSSTSIAEFAREIEPSKSYTIIFLSGDTSISEFLN--HIPTQN 135
           I+PIL       ++++T+ S    + AREI+  +  TI   SGD    E +N  ++    
Sbjct: 191 IEPILIASECSFELMETKYSRHATDIAREIDLEEFDTIACASGDGVPYEVINGLYMREDK 250

Query: 136 SNSKHALNIYPIPMGTGNAWASSLN 160
            ++ + + +  +P G+GNA + S +
Sbjct: 251 VDAFNKITVTQLPCGSGNAMSISCH 275

>YLR260W Chr12 (665844..667907) [2064 bp, 687 aa] {ON}  LCB5Minor
           sphingoid long-chain base kinase, paralog of Lcb4p
           responsible for few percent of the total activity,
           possibly involved in synthesis of long-chain base
           phosphates, which function as signaling molecules
          Length = 687

 Score = 33.9 bits (76), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 35/122 (28%), Positives = 53/122 (43%), Gaps = 14/122 (11%)

Query: 79  KPILEKLGAEHKIIKTQSSTSIAEFAREIEPSKSYTIIFLSGDTSISEFLNHIPTQNSNS 138
           KP+L       +++ T+      E ARE++  K  TI   SGD    E +N +  Q  + 
Sbjct: 293 KPLLLASRCSIEVVYTKYPGHAIEIAREMDIDKYDTIACASGDGIPHEVINGL-YQRPDH 351

Query: 139 KHALN---IYPIPMGTGNA------WAS--SLNLKCPVESFQKFLKNDLIASKFPLYRAS 187
             A N   I  IP G+GNA      W +  S +  C ++S +  +  DL+    P Y   
Sbjct: 352 VKAFNNIAITEIPCGSGNAMSVSCHWTNNPSYSTLCLIKSIETRI--DLMCCSQPSYARE 409

Query: 188 FP 189
            P
Sbjct: 410 HP 411

>Skud_15.333 Chr15 complement(600768..602651) [1884 bp, 627 aa] {ON}
           YOR171C (REAL)
          Length = 627

 Score = 33.9 bits (76), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 33/121 (27%), Positives = 56/121 (46%), Gaps = 14/121 (11%)

Query: 80  PILEKLGAEHKIIKTQSSTSIAEFAREIEPSKSYTIIFLSGDTSISEFLNHIPTQNSNSK 139
           PIL + G + +I  T+ +    + AR+++ SK  TI   SGD    E +N +  +  +  
Sbjct: 256 PILVESGCKIEIAYTKYARHAIDIARDLDISKYDTIACASGDGIPYEVINGL-FRRPDRV 314

Query: 140 HALN---IYPIPMGTGNAWASSLNLK--------CPVESFQKFLKNDLIASKFPLYRASF 188
            A N   +  +P G+GNA + S +          C V+S +  +  DL+    P Y   +
Sbjct: 315 DAFNKVAVTQLPCGSGNAMSISCHWTNNPSYAALCLVKSIETRI--DLMCCSQPSYMNEW 372

Query: 189 P 189
           P
Sbjct: 373 P 373

>NDAI0I02370 Chr9 (540379..542661) [2283 bp, 760 aa] {ON} Anc_6.48
           YLR260W
          Length = 760

 Score = 33.5 bits (75), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 45/177 (25%), Positives = 75/177 (42%), Gaps = 19/177 (10%)

Query: 64  GIGRKTQADFSTQVIKPILEKLGAEHKIIKTQSSTSIAEFAREIEPSKSYTIIFLSGDTS 123
           G  RK +  F T+  +P+L       ++  T+      E A+E++  K  TI   SGD  
Sbjct: 362 GGKRKAKKLFMTKA-RPLLLASDCFLEVHYTKYVGHAIEIAKEMDIDKFDTIACASGDGI 420

Query: 124 ISEFLNHIPTQNSNSK--HALNIYPIPMGTGNAWASSLNLK--------CPVESFQKFLK 173
             E +N +  +    K  + L I  IP G+GNA + S +          C ++S +  +K
Sbjct: 421 PHEVINGLYRREDRVKAFNKLTITQIPCGSGNAMSVSCHWTNNPSYATLCLIKSVE--VK 478

Query: 174 NDLIASKFPLYRASFPNGYSTIFFIILSIGFHANLLHLCNHSKYKVMGVERFKAASA 230
            D++    P Y    P     + F+  + G  A+     N   ++ MG  RF+   A
Sbjct: 479 VDVMCCSQPSYVDEHPK----LSFLSQTYGVIAD--SDINTESFRWMGSARFELGVA 529

>CAGL0K05995g Chr11 (583945..586329) [2385 bp, 794 aa] {ON} similar
           to uniprot|Q06147 Saccharomyces cerevisiae YLR260w
           sphingolipid long chain base kinase
          Length = 794

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 32/121 (26%), Positives = 55/121 (45%), Gaps = 12/121 (9%)

Query: 79  KPILEKLGAEHKIIKTQSSTSIAEFAREIEPSKSYTIIFLSGDTSISEFLNHIPTQNSNS 138
           KP+L    +  +I  T+      + ARE++ SK  TI+  SGD    E +N +  +    
Sbjct: 425 KPLLSASRSTVEIKYTKYPQEAIDIAREMDISKYDTIVCASGDGIPYEVINGLYRRPDRV 484

Query: 139 K--HALNIYPIPMGTGNAWASSLNLK--------CPVESFQKFLKNDLIASKFPLYRASF 188
           +  + L I  +P G+GNA + S +          C ++S +  +  DL+    P Y   +
Sbjct: 485 EAFNKLAITQLPCGSGNAMSVSCHWTNNPSYAALCLLKSVEARI--DLMCCSQPSYADEY 542

Query: 189 P 189
           P
Sbjct: 543 P 543

>KAFR0G02620 Chr7 complement(541557..543362) [1806 bp, 601 aa] {ON}
           Anc_6.48 YOR171C
          Length = 601

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 44/83 (53%), Gaps = 2/83 (2%)

Query: 78  IKPILEKLGAEHKIIKTQSSTSIAEFAREIEPSKSYTIIFLSGDTSISEFLNHI--PTQN 135
           ++PIL+    + ++  T+      + AR+++  K  TI+  SGD    E +N +   T  
Sbjct: 250 VEPILKLTFFKFEVKLTEYHRHAMQIARKLDLDKFDTIVCASGDGIPYEVINGLYQRTDR 309

Query: 136 SNSKHALNIYPIPMGTGNAWASS 158
           SN+ + L +  +P G+GNA + S
Sbjct: 310 SNAFNKLCVTQLPCGSGNAMSIS 332

>Suva_10.358 Chr10 (627071..629113) [2043 bp, 680 aa] {ON} YLR260W
           (REAL)
          Length = 680

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 41/162 (25%), Positives = 67/162 (41%), Gaps = 18/162 (11%)

Query: 79  KPILEKLGAEHKIIKTQSSTSIAEFAREIEPSKSYTIIFLSGDTSISEFLNHIPTQNSNS 138
           KP+L       +++ T+      E A ++   K  T++  SGD    E +N +  +  + 
Sbjct: 284 KPLLLASRCSIEVVYTKYPGHAVEIAEDMNIDKYDTVVCASGDGIPHEVMNGLYRRPDHV 343

Query: 139 K--HALNIYPIPMGTGNA------WAS--SLNLKCPVESFQKFLKNDLIASKFPLYRASF 188
           K  + L I  IP G+GNA      W +  S +  C ++S +  +  DL+    P Y    
Sbjct: 344 KAFNKLAITQIPCGSGNAMSVSCHWTNNPSYSTLCLIKSVETRI--DLMCCSQPSYAREH 401

Query: 189 PNGYSTIFFIILSIGFHANLLHLCNHSKYKVMGVERFKAASA 230
           P     I F+  + G  A      N    + MG  RF+   A
Sbjct: 402 PK----ISFLSQTYGLIAET--DINTEFIRWMGPARFELGVA 437

>ZYRO0C07084g Chr3 complement(533008..534951) [1944 bp, 647 aa] {ON}
           similar to uniprot|Q12246 Saccharomyces cerevisiae
           YLR260W LCB5 Minor sphingoid long-chain base kinase
           paralog of Lcb4p responsible for few percent of the
           total activity possibly involved in synthesis of
           long-chain base phosphates which function as signaling
           molecules and similar to YOR171c
          Length = 647

 Score = 32.3 bits (72), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 35/123 (28%), Positives = 54/123 (43%), Gaps = 18/123 (14%)

Query: 79  KPILEKLGAEHKIIKTQSSTSIAEFAREIEPSKSYTIIFLSGDTSISEFLNHIPTQNSNS 138
           +PIL       +I  T+      + ARE++ +K  TI   SGD    E +N +  +   +
Sbjct: 284 RPILLASRCPIEIAYTKYGRHAVDIAREVDLNKYDTIACASGDGIPYEVINGLYQRKDRA 343

Query: 139 K--HALNIYPIPMGTGNA------WAS-----SLNLKCPVESFQKFLKNDLIASKFPLYR 185
              + L+I  +P G+GNA      W S     +L+L   VES     + DL+    P Y 
Sbjct: 344 AAFNKLSITQLPCGSGNAMSVTCHWTSNPSYAALSLVKSVES-----RIDLMCCSQPSYC 398

Query: 186 ASF 188
             F
Sbjct: 399 KEF 401

>KNAG0E02730 Chr5 complement(542414..544660) [2247 bp, 748 aa] {ON}
           Anc_6.48 YOR171C
          Length = 748

 Score = 31.6 bits (70), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 28/107 (26%), Positives = 47/107 (43%), Gaps = 8/107 (7%)

Query: 91  IIKTQSSTSIAEFAREIEPSKSYTIIFLSGDTSISEFLNHIPTQNSNSK--HALNIYPIP 148
           ++ T+ S    E A+ ++  K  TI   SGD    E +N +  ++   +  + L I  IP
Sbjct: 390 LVYTKYSGHAIEIAKNMDIEKYDTIACASGDGIPHEVINGLYRRHDRVRAFNKLAITEIP 449

Query: 149 MGTGNAWASSLNLKCPVESFQKFL------KNDLIASKFPLYRASFP 189
            G+GNA + S N          F+      ++D++    P Y A  P
Sbjct: 450 CGSGNAMSVSCNWTNNPSYATLFIIKSVETRSDIMCLSQPSYEAGVP 496

>Suva_9.133 Chr9 complement(223449..225863) [2415 bp, 804 aa] {ON}
           YIL068C (REAL)
          Length = 804

 Score = 31.2 bits (69), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 19/78 (24%), Positives = 40/78 (51%)

Query: 70  QADFSTQVIKPILEKLGAEHKIIKTQSSTSIAEFAREIEPSKSYTIIFLSGDTSISEFLN 129
           + D S + ++ I E+L  E  +++ Q +    ++  E+E S     +  S  TSI + +N
Sbjct: 14  KGDLSLERVRDIKEQLLKEKSVVEYQLNKESDKYYGEVEESLKLLNLSKSSVTSIKQQIN 73

Query: 130 HIPTQNSNSKHALNIYPI 147
            +    ++++ A+N Y I
Sbjct: 74  EVNRLGNDNRFAINRYDI 91

>Smik_9.119 Chr9 complement(207819..210233) [2415 bp, 804 aa] {ON}
           YIL068C (REAL)
          Length = 804

 Score = 31.2 bits (69), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 20/79 (25%), Positives = 39/79 (49%)

Query: 69  TQADFSTQVIKPILEKLGAEHKIIKTQSSTSIAEFAREIEPSKSYTIIFLSGDTSISEFL 128
            + D S + ++ I E+L  E  +I+ Q +    ++  E+E S     I     TSI + +
Sbjct: 13  VKGDLSLERVRDIKEQLLKEKSVIEYQLNKESDKYYGEVEESLKLLNISKDSVTSIKQQI 72

Query: 129 NHIPTQNSNSKHALNIYPI 147
           N +    ++++ A+N Y I
Sbjct: 73  NEVNKLGNDNRFAINRYDI 91

>KLLA0C05368g Chr3 (481598..486415) [4818 bp, 1605 aa] {ON} some
            similarities with uniprot|Q08562 Saccharomyces cerevisiae
            YOR191W RIS1 Member of the SWI/SNF family of
            DNA-dependent ATPases plays a role in antagonizing
            silencing during mating-type switching contains an N-
            terminal domain that interacts with Sir4p and a
            C-terminal SNF2 domain
          Length = 1605

 Score = 31.2 bits (69), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 37/90 (41%), Gaps = 16/90 (17%)

Query: 86   GAEHKIIKTQSSTSIAEFAREIEPSKSYTIIFLSGDTSISEFLNHIPTQNSNSKHALNIY 145
            G E+   K +S   +AE          Y I+ +S  T  SEF  H P    N +H  +++
Sbjct: 1006 GGENNSSKFRSWKDLAE----------YDIVLVSYQTLASEFKKHWPLSWKNGEHQPDVH 1055

Query: 146  PIPMGTGNAWASSLNLKCPVESFQKFLKND 175
             + +   N   SS       E F  F +ND
Sbjct: 1056 AVDLKLMNQVKSS------DEYFSPFYRND 1079

>TBLA0E03180 Chr5 (801485..803569) [2085 bp, 694 aa] {ON} Anc_6.48
           YOR171C
          Length = 694

 Score = 31.2 bits (69), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 35/72 (48%), Gaps = 2/72 (2%)

Query: 91  IIKTQSSTSIAEFAREIEPSKSYTIIFLSGDTSISEFLNHIPTQNSNSK--HALNIYPIP 148
           I  T+ +    + AR++   K  TI+  SGD    E LN +  +   +K    L I  +P
Sbjct: 355 IAYTKYAAHAIDIARDLNIDKYDTIVCASGDGIPHEVLNGLYQRKDRAKAFDKLCITQLP 414

Query: 149 MGTGNAWASSLN 160
            G+GNA + S +
Sbjct: 415 CGSGNAMSVSCH 426

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.135    0.383 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 38,706,774
Number of extensions: 1651341
Number of successful extensions: 4963
Number of sequences better than 10.0: 48
Number of HSP's gapped: 5090
Number of HSP's successfully gapped: 51
Length of query: 384
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 273
Effective length of database: 40,753,473
Effective search space: 11125698129
Effective search space used: 11125698129
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 67 (30.4 bits)