Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0E14938g5.703ON57457428370.0
KLTH0E01034g5.703ON58356513431e-180
Kwal_55.196915.703ON46646812451e-167
TDEL0B021705.703ON56758411301e-148
Skud_9.185.703ON57158911071e-144
ZYRO0G06578g5.703ON56958810951e-142
Suva_9.385.703ON56958510951e-142
AFR287W5.703ON61155810931e-142
YIL150C (MCM10)5.703ON57159010801e-140
Smik_9.195.703ON57258910771e-140
NCAS0G002205.703ON59251310571e-136
Kpol_1043.715.703ON58559010261e-132
NDAI0F002805.703ON61061610221e-131
KAFR0D022105.703ON58459610141e-130
TBLA0G010205.703ON5946069751e-124
KNAG0L021505.703ON6166219661e-123
CAGL0H06589g5.703ON5836209281e-117
TPHA0E002105.703ON5445598991e-113
KLLA0A00572g5.703ON5775888811e-110
KLLA0F03993g2.273ON77993800.46
TDEL0C061601.85ON103062761.5
Kpol_1062.205.446ON36553732.4
NDAI0A065903.401ON236996725.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0E14938g
         (574 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0E14938g Chr5 (1242645..1242714,1242780..1244434) [1725 bp, ...  1097   0.0  
KLTH0E01034g Chr5 complement(97462..99128,99197..99281) [1752 bp...   521   e-180
Kwal_55.19691 s55 complement(80960..82360) [1401 bp, 466 aa] {ON...   484   e-167
TDEL0B02170 Chr2 complement(385955..387658) [1704 bp, 567 aa] {O...   439   e-148
Skud_9.18 Chr9 complement(38082..39797) [1716 bp, 571 aa] {ON} Y...   431   e-144
ZYRO0G06578g Chr7 complement(519877..521586) [1710 bp, 569 aa] {...   426   e-142
Suva_9.38 Chr9 complement(55663..57372) [1710 bp, 569 aa] {ON} Y...   426   e-142
AFR287W Chr6 (956955..958790) [1836 bp, 611 aa] {ON} Syntenic ho...   425   e-142
YIL150C Chr9 complement(61013..62728) [1716 bp, 571 aa] {ON}  MC...   420   e-140
Smik_9.19 Chr9 complement(38635..40353) [1719 bp, 572 aa] {ON} Y...   419   e-140
NCAS0G00220 Chr7 complement(31595..33373) [1779 bp, 592 aa] {ON}...   411   e-136
Kpol_1043.71 s1043 (151546..153303) [1758 bp, 585 aa] {ON} (1515...   399   e-132
NDAI0F00280 Chr6 complement(58035..59867) [1833 bp, 610 aa] {ON}...   398   e-131
KAFR0D02210 Chr4 complement(441977..443731) [1755 bp, 584 aa] {O...   395   e-130
TBLA0G01020 Chr7 (256107..257891) [1785 bp, 594 aa] {ON} Anc_5.7...   380   e-124
KNAG0L02150 Chr12 (386276..388126) [1851 bp, 616 aa] {ON} Anc_5....   376   e-123
CAGL0H06589g Chr8 (649740..651491) [1752 bp, 583 aa] {ON} simila...   362   e-117
TPHA0E00210 Chr5 complement(26313..27947) [1635 bp, 544 aa] {ON}...   350   e-113
KLLA0A00572g Chr1 complement(51265..52910,52994..53081) [1734 bp...   343   e-110
KLLA0F03993g Chr6 complement(375915..378254) [2340 bp, 779 aa] {...    35   0.46 
TDEL0C06160 Chr3 complement(1114395..1117487) [3093 bp, 1030 aa]...    34   1.5  
Kpol_1062.20 s1062 (46681..47778) [1098 bp, 365 aa] {ON} (46681....    33   2.4  
NDAI0A06590 Chr1 complement(1496544..1503653) [7110 bp, 2369 aa]...    32   5.0  

>SAKL0E14938g Chr5 (1242645..1242714,1242780..1244434) [1725 bp, 574
           aa] {ON} similar to uniprot|P32354 Saccharomyces
           cerevisiae YIL150C MCM10 Essential chromatin-associated
           protein involved in the initiation of DNA replication
           required for the association of the MCM2-7 complex with
           replication origins
          Length = 574

 Score = 1097 bits (2837), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 536/574 (93%), Positives = 536/574 (93%)

Query: 1   MEDPREPREIDIFDELSCDEDDDLHKRLDELEREKKDLKQRLQDISQRKKKIDPNFSGVE 60
           MEDPREPREIDIFDELSCDEDDDLHKRLDELEREKKDLKQRLQDISQRKKKIDPNFSGVE
Sbjct: 1   MEDPREPREIDIFDELSCDEDDDLHKRLDELEREKKDLKQRLQDISQRKKKIDPNFSGVE 60

Query: 61  VPRSPSKSKHVAVKETSRSKDDRESCFPAHENLNELQVQKKASLSSISTPYFAQNFSSSK 120
           VPRSPSKSKHVAVKETSRSKDDRESCFPAHENLNELQVQKKASLSSISTPYFAQNFSSSK
Sbjct: 61  VPRSPSKSKHVAVKETSRSKDDRESCFPAHENLNELQVQKKASLSSISTPYFAQNFSSSK 120

Query: 121 KAQEVESRRKMEMLNCRVHTFDGPDFVREYSPIAVNEEEEFSGKWISKRYITAEQARKIL 180
           KAQEVESRRKMEMLNCRVHTFDGPDFVREYSPIAVNEEEEFSGKWISKRYITAEQARKIL
Sbjct: 121 KAQEVESRRKMEMLNCRVHTFDGPDFVREYSPIAVNEEEEFSGKWISKRYITAEQARKIL 180

Query: 181 RETKVLRLPKLFAKVRPPTFTEPQYSNWVTIGIISAKSSVKMTTGTKPSRYFTLTLTDFK 240
           RETKVLRLPKLFAKVRPPTFTEPQYSNWVTIGIISAKSSVKMTTGTKPSRYFTLTLTDFK
Sbjct: 181 RETKVLRLPKLFAKVRPPTFTEPQYSNWVTIGIISAKSSVKMTTGTKPSRYFTLTLTDFK 240

Query: 241 HTINIYLFGNKNVEKYYNLKVGDIIAVLNPEIWPWRPSKVEHEQSSQAVIKSFNLCIKHN 300
           HTINIYLFGNKNVEKYYNLKVGDIIAVLNPEIWPWRPSKVEHEQSSQAVIKSFNLCIKHN
Sbjct: 241 HTINIYLFGNKNVEKYYNLKVGDIIAVLNPEIWPWRPSKVEHEQSSQAVIKSFNLCIKHN 300

Query: 301 FNSILEIGTSRDFGFCSIYNKLQGKTCGTPINKSVEDRCYYHQEVQFRQVNAKRLELNGN 360
           FNSILEIGTSRDFGFCSIYNKLQGKTCGTPINKSVEDRCYYHQEVQFRQVNAKRLELNGN
Sbjct: 301 FNSILEIGTSRDFGFCSIYNKLQGKTCGTPINKSVEDRCYYHQEVQFRQVNAKRLELNGN 360

Query: 361 KSLRSPTKNGVKHILYGKNKSGKYDLLPDRYAPQTQSKDSQNVLYFSNPNAARAFFDDDY 420
           KSLRSPTKNGVKHILYGKNKSGKYDLLPDRYAPQTQSKDSQNVLYFSNPNAARAFFDDDY
Sbjct: 361 KSLRSPTKNGVKHILYGKNKSGKYDLLPDRYAPQTQSKDSQNVLYFSNPNAARAFFDDDY 420

Query: 421 QNPDFLNNLDSXXXXXXXXXXXXXXXXXXXXXXXXSNSNLFKNETSTKQDEIRRATKNAL 480
           QNPDFLNNLDS                        SNSNLFKNETSTKQDEIRRATKNAL
Sbjct: 421 QNPDFLNNLDSKRRKLEVGKKEKLLQKQLQQVIGKSNSNLFKNETSTKQDEIRRATKNAL 480

Query: 481 ESGLIKKIGFDPTSGRMSSVLKNNSKGLKEQAKNSAVXXXXXXXXXXXXXXPSKEALRQK 540
           ESGLIKKIGFDPTSGRMSSVLKNNSKGLKEQAKNSAV              PSKEALRQK
Sbjct: 481 ESGLIKKIGFDPTSGRMSSVLKNNSKGLKEQAKNSAVEEILQIKKEKIELKPSKEALRQK 540

Query: 541 FKKREEVWNHHFKKEENPNPGVESSDGDSELEIV 574
           FKKREEVWNHHFKKEENPNPGVESSDGDSELEIV
Sbjct: 541 FKKREEVWNHHFKKEENPNPGVESSDGDSELEIV 574

>KLTH0E01034g Chr5 complement(97462..99128,99197..99281) [1752 bp,
           583 aa] {ON} similar to uniprot|P32354 Saccharomyces
           cerevisiae YIL150C MCM10 Essential chromatin-associated
           protein involved in the initiation of DNA replication
          Length = 583

 Score =  521 bits (1343), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 267/565 (47%), Positives = 371/565 (65%), Gaps = 14/565 (2%)

Query: 3   DPREPREIDIFDELSCDEDDD--LHKRLDELEREKKDLKQRLQDISQRKKKIDPNFSGVE 60
           DPRE  ++D+ D ++ DED+D  + ++LDELER+++DL+ RL+  + RKK    +   VE
Sbjct: 6   DPREVLQLDVHDIVTSDEDEDTKIKQQLDELERQQRDLRDRLEQKASRKKAQRQSLERVE 65

Query: 61  VPRSPSKSKHVAVKETSRSKDDRESCFPAHENLNELQVQKKASLSSISTPYFAQNFSSSK 120
           VP SP + +       S+ K  +     A+ N + ++V  K   S+ +T YF +NF +++
Sbjct: 66  VPASPKEERKSKASPQSQ-KSSKGITLAANSNNDSIEVPWKNGPSN-TTSYFVENFVNAR 123

Query: 121 KAQEVESRRKMEMLNCRVHTFDGPDFVREYSPIAVNEEEEFSGKWISKRYITAEQARKIL 180
           K +E + + +  +L+CRVHTF G D ++   P+ V+E+E +SG  IS+RY++  +  +I+
Sbjct: 124 KVEEQKIQHRSSLLSCRVHTFKGIDSLKGSQPVNVDEKELYSGFNISRRYMSTSELDEIM 183

Query: 181 RETKVLRLPKLFAKVRPPTFTEPQYSNWVTIGIISAKSSVKMTTGTKPSRYFTLTLTDFK 240
           RE KVLRLPKLF+KVRPP FTEP Y+NWV IGIIS KS VK+T+ +KPS+YF +TLTDF 
Sbjct: 184 REIKVLRLPKLFSKVRPPKFTEPDYANWVAIGIISFKSEVKLTSSSKPSKYFKMTLTDFT 243

Query: 241 HTINIYLFGNKNVEKYYNLKVGDIIAVLNPEIWPWRPSKVEHEQSSQAVIKSFNLCIKHN 300
           H ++IY+F NKNVEKYYNL+VGDIIA+LNP+I PWRPS+V +++ S  V+KSFNL I+HN
Sbjct: 244 HNLDIYIFNNKNVEKYYNLRVGDIIAILNPDILPWRPSQVNNDEFSGPVVKSFNLSIRHN 303

Query: 301 FNSILEIGTSRDFGFCSIYNKLQGKTCGTPINKSVEDRCYYHQEVQFRQVNAKRLELNGN 360
           F+ +LEIGTS+D GFC I NK   K CG PIN++  DRC YHQ+V+FR VNA+R+ELNG+
Sbjct: 304 FDCVLEIGTSKDLGFCRIPNKATRKACGAPINRAATDRCEYHQDVRFRHVNAQRVELNGS 363

Query: 361 KSLRSPTKNGVKHILYGKNKSG---KYDLLPDRYAPQTQSKDSQNVLYFSNPNAARAFFD 417
            SLRSP KNG K  LYG   SG   K  LLPD++APQ Q  +SQN L+FSNPN A+AFFD
Sbjct: 364 TSLRSPVKNGKKQALYG--TSGVKRKLQLLPDKHAPQAQDGESQNTLFFSNPNYAKAFFD 421

Query: 418 DDYQNPDFLNNLDSXXXXXXXXXXXXXXXXXXXXXXXXSNSNLFKNETSTKQDEIRRATK 477
           D YQNPD LNNL++                        +    F N++  +Q +++ AT+
Sbjct: 422 DSYQNPDMLNNLENKRRKLKDSEKERTLQNQLNSAIGKTGYQSFNNKSKEEQKQMKDATE 481

Query: 478 NALESGLIKKIGFDPTSGRMSSVL---KNNSKGLKEQAKNSAVXXXXXXXXXXXXXXPSK 534
             L SGL++ IGFDP  G+M  VL   KN + GL   +K+S V              PSK
Sbjct: 482 QVLNSGLLRDIGFDPFRGKMREVLKFGKNVNSGL--NSKSSQVKEIMSFKKSNVSLAPSK 539

Query: 535 EALRQKFKKREEVWNHHFKKEENPN 559
              +++  +RE+VW  HF  E+  N
Sbjct: 540 AEQKKRLLRREQVWREHFDTEKLAN 564

>Kwal_55.19691 s55 complement(80960..82360) [1401 bp, 466 aa] {ON}
           YIL150C (DNA43) - (putative) involved in DNA replication
           [contig 159] FULL
          Length = 466

 Score =  484 bits (1245), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 235/468 (50%), Positives = 317/468 (67%), Gaps = 10/468 (2%)

Query: 114 QNFSSSKKAQEVESRRKMEMLNCRVHTFDGPDFVREYSPIAVNEEEEFSGKWISKRYITA 173
           +NF++S+KA+E   + + EML+ RVHTF G    +   PIAV E+E  SG W+S+RYI +
Sbjct: 2   ENFANSRKAEESRIKHRGEMLDSRVHTFRGLKATKSRKPIAVEEKEPASGLWVSRRYIAS 61

Query: 174 EQARKILRETKVLRLPKLFAKVRPPTFTEPQYSNWVTIGIISAKSSVKMTTGTKPSRYFT 233
           ++  +IL++ K+LRLPKLF+KVRPP FTEP Y+NWV +GI+  KS VKMT+ +KP++YF 
Sbjct: 62  DELAEILKDIKILRLPKLFSKVRPPKFTEPDYANWVAVGILCHKSVVKMTSSSKPTKYFK 121

Query: 234 LTLTDFKHTINIYLFGNKNVEKYYNLKVGDIIAVLNPEIWPWRPSKVEHEQSSQAVIKSF 293
           +T+TDF H++++Y+F N NVEKYYNL+VGDIIA+LN +I PWRPS+V +++ S A +KSF
Sbjct: 122 MTITDFTHSLDVYVFNNPNVEKYYNLRVGDIIAILNADILPWRPSQVGNDEFSGASVKSF 181

Query: 294 NLCIKHNFNSILEIGTSRDFGFCSIYNKLQGKTCGTPINKSVEDRCYYHQEVQFRQVNAK 353
           NL I+ N++ +LEIGTSRD GFC IYNK +GK CG PIN++  DRC YHQE++FRQVNA+
Sbjct: 182 NLSIRGNYDCVLEIGTSRDLGFCQIYNKAKGKVCGAPINRAAVDRCDYHQEIRFRQVNAQ 241

Query: 354 RLELNGNKSLRSPTKNGVKHILYGKNKSG---KYDLLPDRYAPQTQSKDSQNVLYFSNPN 410
           R+ELNG+ SLRSP KNG K  LYG   SG   K +LLPD++APQ Q ++SQN LYFSNPN
Sbjct: 242 RVELNGSMSLRSPVKNGKKQALYG--SSGVKRKLNLLPDKHAPQQQDRESQNTLYFSNPN 299

Query: 411 AARAFFDDDYQNPDFLNNLDSXXXXXXXXXXXXXXXXXXXXXXXXSNSNLFKNETSTKQD 470
            A+AFFDD YQNPD L NLDS                             F  +T  +Q 
Sbjct: 300 YAKAFFDDTYQNPDLLENLDSKRRKMRDTESERQLQVQLSRALGKDGQQRFSEKTKQEQK 359

Query: 471 EIRRATKNALESGLIKKIGFDPTSGRMSSVLK--NNSKGLKEQAKNSAVXXXXXXXXXXX 528
           ++++AT+  + SGL+K IGFDPT G+M  VLK   NSK   +  K+  V           
Sbjct: 360 QMKQATEQTIHSGLLKNIGFDPTKGKMRDVLKVGKNSKNSTD-TKSIQVREIIETRKTNV 418

Query: 529 XXXPSKEALRQKFKKREEVWNHHFKKEENP--NPGVESSDGDSELEIV 574
              PSK   +++  +RE+VW  HF+ + +P  N  + S   DS+LEIV
Sbjct: 419 SLAPSKADQKKRLLRREQVWKEHFETKTDPTANNQIPSDSSDSDLEIV 466

>TDEL0B02170 Chr2 complement(385955..387658) [1704 bp, 567 aa] {ON}
           Anc_5.703 YIL150C
          Length = 567

 Score =  439 bits (1130), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 248/584 (42%), Positives = 350/584 (59%), Gaps = 27/584 (4%)

Query: 1   MEDPREPREIDIFDELSCDEDD--DLHKRLDELEREKKDLKQRLQDISQRKKKIDPNFSG 58
           M DPRE  + D F EL+ DE+D  +L  ++ E+ER+K+DL +RL+   Q K K DPNF  
Sbjct: 1   MNDPREVVQTDPFGELTSDEEDQRELEDQIVEIERQKRDLVERLKSKRQLKSK-DPNFDA 59

Query: 59  VEVPRSPSKSKHVAVK-ETSRSKDDRESCFPAHENLNELQVQKKASLSSISTPYFAQNFS 117
           ++V  SP K    ++K E SR+K   +      ENLNE +V+ ++ + + +T YF  NF 
Sbjct: 60  IQVESSPVKKPAESIKVEPSRTKRVLDI-----ENLNEKKVESRSQIPANTTSYFIDNFR 114

Query: 118 SSKKAQEVESRRKMEMLNCRVHTFDGPDFVREYSPIAVNEEEEFSGKWISKRYITAEQAR 177
           +SKK ++   + + E+L+ RVHTF G D   ++  +AV E EE+S  W+ +RYI+ +  R
Sbjct: 115 NSKKEEQKSQQERQELLSKRVHTFRGIDGNHKFKAVAVEEVEEYSDLWVKQRYISQDDLR 174

Query: 178 KILRETKVLRLPKLFAKVRPPTFTEPQYSNWVTIGIISAKSSVKMTTGTKPSRYFTLTLT 237
           K+L E K+LRL KLFAK++PP F EPQYSNW  IGIISAK  VK ++  KP +YF  TLT
Sbjct: 175 KVLHEVKILRLSKLFAKIKPPKFAEPQYSNWAPIGIISAKGQVKFSSSGKPMKYFKFTLT 234

Query: 238 DFKHTINIYLFGNKNVEKYYNLKVGDIIAVLNPEIWPWRPSKVEHEQSSQAVIKSFNLCI 297
           DF++ +++Y+FG K VE+YYNL+VGDI+A+LNPE+ PWRPS+          IKSFNL I
Sbjct: 235 DFQYNLDVYVFGKKGVERYYNLRVGDIVAILNPEVLPWRPSE------KGNFIKSFNLRI 288

Query: 298 KHNFNSILEIGTSRDFGFCSIYNKLQGKTCGTPINKSVEDRCYYHQEVQFRQVNAKRLEL 357
            H+F  ILEIG SRD  +C  +NK Q K CGTPINK+ E  C +H+E+QFR  +AKR+EL
Sbjct: 289 SHDFPCILEIGQSRDIDWCKSFNKSQNKACGTPINKTKEKCCDFHREIQFRSNHAKRIEL 348

Query: 358 NGNKSLRSPTKNGVKHILYGKNKSGK---YDLLPDRYAPQTQSKDSQNVLYFSNPNAARA 414
           NG+ +L +PTK      LY +  +G    + +LP+ Y            ++FSN NAA+A
Sbjct: 349 NGSFALGAPTKVDSGPALYREKSAGAHRNFKVLPNHYQKSVGKNSDLRGIHFSNGNAAKA 408

Query: 415 FFDDDYQNPDFLNNLDSXXXXXXXXXXXXXXXXXXXXXXXXSNSNLFKNETSTKQDEIRR 474
           FF+D++QNPD LNNLDS                         ++ +   + S K +EI  
Sbjct: 409 FFNDEFQNPDILNNLDSKRRKRQDDKKSLILQQQLKRINSR-HAAIEIEKGSKKYEEICE 467

Query: 475 ATKNALESGLIKKIGFDPTSGRMSSVLKNNSKGLKEQA----KNSAVXXXXXXXXXXXXX 530
            T+  L+SGLI+ +GFDPT G + +VLK  +K          K   V             
Sbjct: 468 TTEATLQSGLIQNLGFDPTHGEIGNVLKQAAKDKSNNGQLNKKQKEVSSLLKFKKEHVEL 527

Query: 531 XPSKEALRQKFKKREEVWNHHFKKEENPNPGVESSDGDSELEIV 574
            P+KE L Q+ + RE  W  +F  +++ N    SSD DS++EIV
Sbjct: 528 KPAKEVLLQRKRDRERAWQENF-GDKSVNL---SSDSDSDIEIV 567

>Skud_9.18 Chr9 complement(38082..39797) [1716 bp, 571 aa] {ON}
           YIL150C (REAL)
          Length = 571

 Score =  431 bits (1107), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 237/589 (40%), Positives = 355/589 (60%), Gaps = 33/589 (5%)

Query: 1   MEDPREPREIDIFDELSCDEDDD--LHKRLDELEREKKDLKQRLQDISQRKKKIDPNFSG 58
           M+DPRE    D ++ ++ DEDD+  + K L+ +ER+K+ L +RL+   + K+  DPNF  
Sbjct: 1   MDDPREFLVADPYNNVTSDEDDEQTIAKELEFMERKKQALVERLKRKQEFKRAEDPNFEA 60

Query: 59  VEVPRSPSKSKHVAVKETSRSKDDRESCFPAHENLNEL---QVQKKASLSSISTPYFAQN 115
           +EVP+SP+K++++   + +  +D R    PA  N+N+L   Q+Q+K  L S +T YF Q 
Sbjct: 61  IEVPQSPAKNRNIMKSQNTMKRDMR----PAASNINDLKLSQLQQKQELPSNTTGYFMQK 116

Query: 116 FSSSKKAQEVESRRKMEMLNCRVHTFDGPDFVREYSPIAVNEEEEFSGKWISKRYITAEQ 175
           F ++K+ +E +  +   M+N RVHTF G D  +EY     NE EEFS  W+ KRYI  + 
Sbjct: 117 FQNAKRNEEKQRAKYENMMNARVHTF-GTD-KKEYRATIANELEEFSNIWVKKRYIPEDD 174

Query: 176 ARKILRETKVLRLPKLFAKVRPPTFTEPQYSNWVTIGIISAKSSVKMTTGTKPSRYFTLT 235
            ++ L E K+LRL KLFAK+RPP F EP Y+NW  +G+IS KS VK T+  KP+++F  T
Sbjct: 175 LKRALHEIKILRLGKLFAKIRPPKFQEPDYANWAVVGLISHKSDVKFTSSDKPAKFFMFT 234

Query: 236 LTDFKHTINIYLFGNKNVEKYYNLKVGDIIAVLNPEIWPWRPSKVEHEQSSQAVIKSFNL 295
           +TDF+HT+++Y+FG K VE+YYNL++GD+IA+LNPE+ PWRPS           IKSFNL
Sbjct: 235 ITDFQHTLDVYIFGKKAVERYYNLRLGDVIAILNPEVLPWRPS------GQGNFIKSFNL 288

Query: 296 CIKHNFNSILEIGTSRDFGFCSIYNKLQGKTCGTPINKSVEDRCYYHQEVQFRQVNAKRL 355
            I H+F  ILEIG+SRD G+C I N+ + + CG+PIN ++   C YH+EVQFR  +AKR+
Sbjct: 289 RISHDFKCILEIGSSRDLGWCPIVNRKKNENCGSPINIALHKCCDYHREVQFRGTSAKRI 348

Query: 356 ELNGNKSLRSPTKNGVKHILYGKNKSGKYDLLPDRYAPQTQSKDSQ----NVLYFSNPNA 411
           ELNG  +L +PTK   +  LY       ++L+  R   +T S++ +    N   F N N+
Sbjct: 349 ELNGGYALGAPTKVDAQPTLYRAKGENNFNLV--RSIRKTLSEEEERMKKNSHNFRNSNS 406

Query: 412 ARAFFDDDYQNPDFLNNLDSXXXXXXXXXXXXXXXXXXXXXXXXSNSNLFKNETSTKQDE 471
           A+AFFD+ +QNPD L NLDS                          S+  +++   ++ +
Sbjct: 407 AKAFFDEKFQNPDMLANLDSKRRKIIDSKKSTALSRELGKIMRRKGSSGLEDKCDEEKQK 466

Query: 472 IRRATKNALESGLIKKIGFDPTSGRMSSVLKNNSKGLKEQ-----AKNSAVXXXXXXXXX 526
           I++ T++AL++GL++++GFDPT G++S VLK++  G + +      K + +         
Sbjct: 467 IKQTTESALQTGLLQRLGFDPTHGKISKVLKSSVPGGEPRNKVMGGKKTVIDDLLNYKKE 526

Query: 527 XXXXXPSKEALRQKFKKREEVWNHHFKKEENPNPGVESSDGD-SELEIV 574
                PSK    +K   REEVW  HF  ++      E SD   S+LEIV
Sbjct: 527 KVILAPSKNEWFKKRSHREEVWQKHFGSKDTD----EVSDASTSDLEIV 571

>ZYRO0G06578g Chr7 complement(519877..521586) [1710 bp, 569 aa] {ON}
           similar to uniprot|P32354 Saccharomyces cerevisiae
           YIL150C MCM10 Essential chromatin-associated protein
           involved in the initiation of DNA replication required
           for the association of the MCM2-7 complex with
           replication origins
          Length = 569

 Score =  426 bits (1095), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 244/588 (41%), Positives = 351/588 (59%), Gaps = 34/588 (5%)

Query: 1   MEDPREPREIDIFDELSCDEDDDLHK--RLDELEREKKDLKQRLQDISQRKKKIDPNFSG 58
           M DPRE    D++D L+ + +++     ++ E+ER+KKDL QRL       K +DPN S 
Sbjct: 1   MRDPREVLNNDLYDVLTSEGEEENEIEAQIAEIERQKKDLLQRLNVKKTNPKPLDPNLSH 60

Query: 59  VEVPRSPSKSKHVAVKETSRSKDDRESCFPAHENLNELQVQKKASLSSISTPYFAQNFSS 118
           ++V  SP K  +  +  T + ++ R      +ENLNEL+ Q +  + + +T +F + +S+
Sbjct: 61  IQVESSPKKVTNSVLPPTVQQQEPRGEV--RNENLNELKAQSQEQIPANTTSFFIEKYST 118

Query: 119 SKKAQEVESRRKMEMLNCRVHTFDGPDFVREYSPIAVNEEEEFSGKWISKRYITAEQARK 178
           SK+ Q+ E R + ++L+ RVHTF G     EY PI  NE EEFS  WISKRYI  E+ R 
Sbjct: 119 SKRKQDYEVRAQEDLLSNRVHTFQGARRQDEYKPIPTNELEEFSNLWISKRYIPKEEQRS 178

Query: 179 ILRETKVLRLPKLFAKVRPPTFTEPQYSNWVTIGIISAKSSVKMTTGTKPSRYFTLTLTD 238
           I    K+LRL KLFAKV+PP F EP YSNW  IG+IS K  VK T+   P +YF  TLT+
Sbjct: 179 IFANIKILRLSKLFAKVKPPKFNEPPYSNWAVIGLISNKGEVKFTSAASPKKYFKFTLTN 238

Query: 239 FKHTINIYLFGNKNVEKYYNLKVGDIIAVLNPEIWPWRPSKVEHEQSSQAVIKSFNLCIK 298
           F+++I+ Y+FG + VE+YYNL+VGDIIA+LNP++ PWRPS       ++A IKSFNL I 
Sbjct: 239 FQYSIDTYIFGKEGVERYYNLRVGDIIAILNPQVLPWRPS------GTKAHIKSFNLRIS 292

Query: 299 HNFNSILEIGTSRDFGFCSIYNKLQGKTCGTPINKSVEDRCYYHQEVQFRQVNAKRLELN 358
           H F  ILEIG SRD G+C ++NK + + C  PINK  ED C YH+E++FR  NAKR+EL+
Sbjct: 293 HKFECILEIGASRDLGWCPMFNKSKNEICRAPINKDKEDCCEYHRELKFRSTNAKRVELS 352

Query: 359 GNKSLRSPTKNGVKHILYGKNKSGK---YDLL---PDRYAPQTQSKDSQNVLYFSNPNAA 412
           G  +L +PT+   +  LY    S K   Y+++    D  + +  +    N  +FSN NAA
Sbjct: 353 GTYALGAPTRIDAQPALYRGGSSQKNLNYNIITNGADGGSNKEINPLDINARHFSNRNAA 412

Query: 413 RAFFDDDYQNPDFLNNLDSXXXXXXXXXXXXXXXXXXXXXXXXSNSNL-FKNETSTKQDE 471
           +AFFD+ +QNP+ L NL++                         NS L  K++++ + DE
Sbjct: 413 KAFFDERFQNPETLRNLENKRRKLRDNRKSNILNRELKK-----NSELDIKHKSAEEIDE 467

Query: 472 IRRATKNALESGLIKKIGFDPTSGRMSSVLKN-----NSKGLKEQAKNSAVXXXXXXXXX 526
           I+R T++ + SG++K +GFDPT G+++SV K+     + K L E  K+S+V         
Sbjct: 468 IKRTTESTMGSGMMKNLGFDPTQGKIASVFKHQRSDSDKKPLTE--KDSSVASLLSFKKD 525

Query: 527 XXXXXPSKEALRQKFKKREEVWNHHFKKEENPNPGVESSDGDSELEIV 574
                PSKE L ++ ++RE VW  HF      + G E  D DS+LEIV
Sbjct: 526 NVKLKPSKEILIKQKRRRERVWKEHFG-----SGGDEKDDSDSDLEIV 568

>Suva_9.38 Chr9 complement(55663..57372) [1710 bp, 569 aa] {ON}
           YIL150C (REAL)
          Length = 569

 Score =  426 bits (1095), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 234/585 (40%), Positives = 350/585 (59%), Gaps = 27/585 (4%)

Query: 1   MEDPREPREIDIFDELSCDEDDD--LHKRLDELEREKKDLKQRLQDISQRKKKIDPNFSG 58
           M+DPRE   +D ++ ++ DE+D+  + K L+ +ER+K+ L +RL+     KK  DPNF  
Sbjct: 1   MDDPREILAVDPYNNVTSDEEDEQAIAKELEFMERKKQALMERLKRKQDFKKPEDPNFEA 60

Query: 59  VEVPRSPSKSKHVAVKETSRSKDD-RESCFPAHENLNELQVQKKASLS-SISTPYFAQNF 116
           VEVP+SP+K   V      +S+D  +++  P   N+NE  + +++  S S +T YF Q F
Sbjct: 61  VEVPQSPAKKSIV-----KKSQDALKQAIRPVASNINESMLSQQSQESPSNTTTYFMQKF 115

Query: 117 SSSKKAQEVESRRKMEMLNCRVHTFDGPDFVREYSPIAVNEEEEFSGKWISKRYITAEQA 176
             +K+ ++ +  +   M+N RVHTF G D  +EY PI  NE E FS  W+ KRYI  E  
Sbjct: 116 QDAKRNEDKQIAKYEGMMNARVHTF-GTD-NKEYKPIITNELESFSNLWVKKRYIPEEDL 173

Query: 177 RKILRETKVLRLPKLFAKVRPPTFTEPQYSNWVTIGIISAKSSVKMTTGTKPSRYFTLTL 236
           ++ L E K+LRL KLFAK+RPP F EP Y+NW T+G+IS KS +K T+  KP ++F  T+
Sbjct: 174 KRALHEIKILRLNKLFAKIRPPKFQEPDYANWATVGLISHKSDIKFTSSEKPVKFFMFTI 233

Query: 237 TDFKHTINIYLFGNKNVEKYYNLKVGDIIAVLNPEIWPWRPSKVEHEQSSQAVIKSFNLC 296
           TDF+H++++Y+FG K VE+YYNL++GD+IA+LNPE+ PWRPS           IKSFNL 
Sbjct: 234 TDFQHSLDVYIFGKKGVERYYNLRLGDVIAILNPEVLPWRPS------GRGNFIKSFNLR 287

Query: 297 IKHNFNSILEIGTSRDFGFCSIYNKLQGKTCGTPINKSVEDRCYYHQEVQFRQVNAKRLE 356
           I H+F  ILEIG+SRD G+C I NK   K+CG+PIN +V   C YH+EVQFR   AKR+E
Sbjct: 288 ISHDFKCILEIGSSRDLGWCPIVNKKTHKSCGSPINTNVHMCCDYHREVQFRGTGAKRIE 347

Query: 357 LNGNKSLRSPTKNGVKHILYGKNKSGKYDLLPD--RYAPQTQSKDSQNVLYFSNPNAARA 414
           LNG  +L +PTK   +  LY      +++++    +   + + +  +N   F+N N+A+A
Sbjct: 348 LNGGYALGAPTKVDSQPSLYRAKGENQFNIVRSTRKGLSEEEERVKRNSHNFTNSNSAKA 407

Query: 415 FFDDDYQNPDFLNNLDSXXXXXXXXXXXXXXXXXXXXXXXXSNSNLFKNETSTKQDEIRR 474
           FFD+ +QNPD L NLDS                         +S+  ++++  ++ ++++
Sbjct: 408 FFDEKFQNPDMLANLDSKRRKIIDTKKSTALSRELGKIMRRKDSSGLEDKSEGEKQKMKQ 467

Query: 475 ATKNALESGLIKKIGFDPTSGRMSSVLKNNSKGLKEQ-----AKNSAVXXXXXXXXXXXX 529
            T++AL++GLI+++GFDPT G++S VLK++  G +        K + +            
Sbjct: 468 TTESALQTGLIQRLGFDPTHGKISKVLKSSVPGGESMPNRINGKKTVINDLLQYKKEKVI 527

Query: 530 XXPSKEALRQKFKKREEVWNHHFKKEENPNPGVESSDGDSELEIV 574
             PSK    +K   REEVW  HF  +E     V S    S+LEIV
Sbjct: 528 LAPSKNEWFKKRSHREEVWQRHFGSKETE---VASDASGSDLEIV 569

>AFR287W Chr6 (956955..958790) [1836 bp, 611 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL150C (MCM10)
          Length = 611

 Score =  425 bits (1093), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 232/558 (41%), Positives = 326/558 (58%), Gaps = 13/558 (2%)

Query: 27  RLDELEREKKDLKQRLQDISQRKKKIDPNFSGVEVPRSPSKSKHVAVKETSRSKDDRESC 86
           RL ++E E+ DL  RL+++  R KK       VEVPRSP+K+K V   E   +     S 
Sbjct: 56  RLKQIESERSDLLARLEELKHRSKKKAKKSPTVEVPRSPTKAKCV---EDEPAPSTSAST 112

Query: 87  FPAHENLNELQVQKKASLSSISTPYFAQNFSSSKKAQEVESRRKMEMLNCRVHTFDGPDF 146
               E       +   S ++ +T YFA+ F+ ++ +     RRK E+L  RV+TF   D 
Sbjct: 113 TYVEEPEENENERYLLSANTPTTSYFAEKFARARDSSASTMRRKQELLKRRVYTFSDRDT 172

Query: 147 VREYSPIAVNEEEEFSGKWISKRYITAEQARKILRETKVLRLPKLFAKVRPPTFTEPQYS 206
             EY+  AV+E E +S   I+KRY+  E  ++IL + KVLRLPKLFAKVRPP F+EP Y+
Sbjct: 173 AIEYTTFAVDEVETYSNMRINKRYVPEEDLKRILHDIKVLRLPKLFAKVRPPKFSEPDYA 232

Query: 207 NWVTIGIISAKSSVKMTTGTKPSRYFTLTLTDFKHTINIYLFGNKNVEKYYNLKVGDIIA 266
           NWVT+G IS KS VK T+  KP++YFT+ +TDF + + I +FG KNVEKYY L+VGD+IA
Sbjct: 233 NWVTLGAISYKSDVKSTSQEKPAKYFTIRITDFHYDVQITVFGQKNVEKYYKLRVGDVIA 292

Query: 267 VLNPEIWPWRPSKVEHEQSSQAVIKSFNLCIKHNFNSILEIGTSRDFGFCSIYNKLQGKT 326
           +LNPEI+PW+ S     ++++   +SF L IKHN N ILEIG S++ GFC   NK +G  
Sbjct: 293 ILNPEIYPWKESAKTTGETARTTGRSFGLSIKHNMNCILEIGHSKELGFCPAMNKTKGAP 352

Query: 327 CGTPINKSVEDRCYYHQEVQFRQVNAKRLELNGNKSLRSPTKNGVKHILY-GKNKSG-KY 384
           CG PINK  E  C YHQE   R VNAKR+ELNGN SLR+PT++G++   Y  +N  G K 
Sbjct: 353 CGAPINKLKEQVCSYHQETHLRSVNAKRVELNGNISLRAPTRDGIQQAGYMTRNSHGTKI 412

Query: 385 DLLPDRYAPQTQSKDSQNVLYFSNPNAARAFFDDDYQNPDFLNNLDSXXXXXXXXXXXXX 444
            LLPD YAP+    + +   +F++ NA RA+FD DY NPD L NL+S             
Sbjct: 413 GLLPDVYAPRAPGAEQKFREHFASANAHRAYFDSDYHNPDVLQNLESKRRKIQLSKKDQQ 472

Query: 445 XXXXXXXXXXXSNSNLFKNETSTKQDEIRRATKNALESGLIKKIGFDPTSGRMSSVLKNN 504
                      +++ +    +     +  +ATKN +++G+++ IGFDPT GRM++VL   
Sbjct: 473 INKQLSLVLGKNHTQVKDRVSEESLQQREKATKNVMKTGILRHIGFDPTGGRMAAVLYQG 532

Query: 505 SKGLKEQAKNSAVXXXXXXXXXXXXXXPSKEALRQKFKKREEVWNHHFKKEENPNP---- 560
             G  +  +  ++              PSKEA R++ ++R EV+N  FK+E    P    
Sbjct: 533 DHGPADTVREPSISEILANKKRNIDLKPSKEARRKRIQQRNEVYNSIFKEEAVATPQGSC 592

Query: 561 ---GVESSD-GDSELEIV 574
               + S+D  D ELEIV
Sbjct: 593 ETAQLSSADSSDEELEIV 610

>YIL150C Chr9 complement(61013..62728) [1716 bp, 571 aa] {ON}
           MCM10Essential chromatin-associated protein involved in
           the initiation of DNA replication; required for the
           association of the MCM2-7 complex with replication
           origins
          Length = 571

 Score =  420 bits (1080), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 232/590 (39%), Positives = 355/590 (60%), Gaps = 35/590 (5%)

Query: 1   MEDPREPREIDIFDELSCDEDDD--LHKRLDELEREKKDLKQRLQDISQRKKKIDPNFSG 58
           M DPRE   +D ++ ++ DE+D+  + + L+ +ER+++ L +RL+   + KK  DPNF  
Sbjct: 1   MNDPREILAVDPYNNITSDEEDEQAIARELEFMERKRQALVERLKRKQEFKKPQDPNFEA 60

Query: 59  VEVPRSPSKSKHVAVKETSRSKDDRESCFPAHENLNEL---QVQKKASLSSISTPYFAQN 115
           +EVP+SP+K++   VK  S +   + + F    N+NE+   Q+Q++    + +T YF + 
Sbjct: 61  IEVPQSPTKNR---VKVGSHNATQQGTKFEG-SNINEVRLSQLQQQPKPPASTTTYFMEK 116

Query: 116 FSSSKKAQEVESRRKMEMLNCRVHTFDGPDFVREYSPIAVNEEEEFSGKWISKRYITAEQ 175
           F ++KK ++ +  +   M+N RVHTF   +  ++Y PI  NE E FS  W+ KRYI  + 
Sbjct: 117 FQNAKKNEDKQIAKFESMMNARVHTFSTDE--KKYVPIITNELESFSNLWVKKRYIPEDD 174

Query: 176 ARKILRETKVLRLPKLFAKVRPPTFTEPQYSNWVTIGIISAKSSVKMTTGTKPSRYFTLT 235
            ++ L E K+LRL KLFAK+RPP F EP+Y+NW T+G+IS KS +K T+  KP ++F  T
Sbjct: 175 LKRALHEIKILRLGKLFAKIRPPKFQEPEYANWATVGLISHKSDIKFTSSEKPVKFFMFT 234

Query: 236 LTDFKHTINIYLFGNKNVEKYYNLKVGDIIAVLNPEIWPWRPSKVEHEQSSQAVIKSFNL 295
           +TDF+HT+++Y+FG K VE+YYNL++GD+IA+LNPE+ PWRPS           IKSFNL
Sbjct: 235 ITDFQHTLDVYIFGKKGVERYYNLRLGDVIAILNPEVLPWRPS------GRGNFIKSFNL 288

Query: 296 CIKHNFNSILEIGTSRDFGFCSIYNKLQGKTCGTPINKSVEDRCYYHQEVQFRQVNAKRL 355
            I H+F  ILEIG+SRD G+C I NK   K CG+PIN S+   C YH+EVQFR  +AKR+
Sbjct: 289 RISHDFKCILEIGSSRDLGWCPIVNKKTHKKCGSPINISLHKCCDYHREVQFRGTSAKRI 348

Query: 356 ELNGNKSLRSPTKNGVKHILYGKNKSGKYDLLPD---RYAPQTQ--SKDSQNVLYFSNPN 410
           ELNG  +L +PTK   +  LY       ++++     R + + +   K S N   F+N N
Sbjct: 349 ELNGGYALGAPTKVDSQPSLYKAKGENGFNIIKGTRKRLSEEEERLKKSSHN---FTNSN 405

Query: 411 AARAFFDDDYQNPDFLNNLDSXXXXXXXXXXXXXXXXXXXXXXXXSNSNLFKNETSTKQD 470
           +A+AFFD+ +QNPD L NLD+                          S+  ++++  ++ 
Sbjct: 406 SAKAFFDEKFQNPDMLANLDNKRRKIIETKKSTALSRELGKIMRRRESSGLEDKSVGERQ 465

Query: 471 EIRRATKNALESGLIKKIGFDPTSGRMSSVLKNNSKGLKEQ-----AKNSAVXXXXXXXX 525
           +++R T++AL++GLI+++GFDPT G++S VLK++  G + +      K + +        
Sbjct: 466 KMKRTTESALQTGLIQRLGFDPTHGKISQVLKSSVSGSEPKNNLLGKKKTVINDLLHYKK 525

Query: 526 XXXXXXPSKEALRQKFKKREEVWNHHFKKEENPNPGVESSDGD-SELEIV 574
                 PSK    +K   REEVW  HF  +E      E+SDG  S+LEI+
Sbjct: 526 EKVILAPSKNEWFKKRSHREEVWQKHFGSKETK----ETSDGSASDLEII 571

>Smik_9.19 Chr9 complement(38635..40353) [1719 bp, 572 aa] {ON}
           YIL150C (REAL)
          Length = 572

 Score =  419 bits (1077), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 233/589 (39%), Positives = 351/589 (59%), Gaps = 32/589 (5%)

Query: 1   MEDPREPREIDIFDELSCDEDDD--LHKRLDELEREKKDLKQRLQDISQRKKKIDPNFSG 58
           M+DPRE   +D ++ ++ DE+D+  + K L+ +ER+++ L +RL+     KK  DPNF  
Sbjct: 1   MDDPREILAVDPYNSVTSDEEDEQAIAKELEFMERKRQALMERLKRKQAFKKPNDPNFEA 60

Query: 59  VEVPRSPSKSK-----HVAVKETSRSKDDRESCFPAHENLNELQVQKKASLSSISTPYFA 113
           +EVP+SP+KS+       AVK+ +R     E+      NL+  Q+QK+  L   +T YF 
Sbjct: 61  IEVPQSPTKSRVKSGSQNAVKQVTR----LETSNANESNLS--QIQKQPELPINTTTYFM 114

Query: 114 QNFSSSKKAQEVESRRKMEMLNCRVHTFDGPDFVREYSPIAVNEEEEFSGKWISKRYITA 173
           Q F ++KK ++ +  +   M++ RVHTF G D  ++Y PI  NE E FS  W+ KRYI  
Sbjct: 115 QKFQNAKKDEDRQIAKFESMMDARVHTF-GTD-NKKYKPIIANELEGFSNLWVKKRYIPE 172

Query: 174 EQARKILRETKVLRLPKLFAKVRPPTFTEPQYSNWVTIGIISAKSSVKMTTGTKPSRYFT 233
           +  ++ L E K+LRL KLFAKVRPP F  P+Y+NW T+G+IS KS +K T+  KP ++F 
Sbjct: 173 DDLKRSLHEIKILRLGKLFAKVRPPKFQAPEYANWATVGLISHKSDIKFTSSEKPVKFFM 232

Query: 234 LTLTDFKHTINIYLFGNKNVEKYYNLKVGDIIAVLNPEIWPWRPSKVEHEQSSQAVIKSF 293
            T+TDF+HT+++Y+FG K VE+YYNL++GDIIA+LNPE+ PWRPS           IKSF
Sbjct: 233 FTITDFQHTLDVYIFGKKGVERYYNLRLGDIIAILNPEVLPWRPS------GRGNFIKSF 286

Query: 294 NLCIKHNFNSILEIGTSRDFGFCSIYNKLQGKTCGTPINKSVEDRCYYHQEVQFRQVNAK 353
           NL I H+F  ILEIG+SRD G+C I N    K CG+PIN S+   C YH+EVQFR  +AK
Sbjct: 287 NLRISHDFKCILEIGSSRDLGWCPIVNTKTHKKCGSPINISLHKCCDYHREVQFRGTSAK 346

Query: 354 RLELNGNKSLRSPTKNGVKHILYGKNKSGKYDLLPD--RYAPQTQSKDSQNVLYFSNPNA 411
           R+ELNG  +L +PTK   +  LY      +++++ D  +   + + +  ++   F+N N+
Sbjct: 347 RIELNGGYALGAPTKVNSQPSLYKAKGENRFNIIRDARKGLSEEEERMKKSSHNFTNSNS 406

Query: 412 ARAFFDDDYQNPDFLNNLDSXXXXXXXXXXXXXXXXXXXXXXXXSNSNLFKNETSTKQDE 471
           A+AFFD+ +QNPD L NLD+                          S+  ++++  ++ +
Sbjct: 407 AKAFFDEKFQNPDMLANLDNKRRKITDTKKSKALNRELAKIMRRKESSGLEDKSDGEKQK 466

Query: 472 IRRATKNALESGLIKKIGFDPTSGRMSSVLKNNSKGLKEQ-----AKNSAVXXXXXXXXX 526
           +++ T+NAL++GLI+++GFDPT G +S VLK++  G + +      K + +         
Sbjct: 467 MKQTTENALQTGLIQRLGFDPTHGEISKVLKSSVPGGESKNNLLNGKKTVINDLLHYKKE 526

Query: 527 XXXXXPSKEALRQKFKKREEVWNHHFKKEENPNPGVESSDGD-SELEIV 574
                PSK    +K   REEVW  HF  +       E+SD   S+LEI+
Sbjct: 527 KVILAPSKNEWFKKRNHREEVWQRHFGPK---GEAEEASDASASDLEII 572

>NCAS0G00220 Chr7 complement(31595..33373) [1779 bp, 592 aa] {ON}
           Anc_5.703 YIL150C
          Length = 592

 Score =  411 bits (1057), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 221/513 (43%), Positives = 314/513 (61%), Gaps = 20/513 (3%)

Query: 1   MEDPREPREIDIFDELSCDEDDD--LHKRLDELEREKKDLKQRLQDISQRKKKIDPNFSG 58
           M DPRE    D +D +S DE D+  + + L+ +ER+++DL  R+++  + KK +DPNF  
Sbjct: 1   MNDPREVLTTDPYDNVSSDEQDEEAILRDLENVERKRQDLLNRIKEKQESKKLLDPNFQQ 60

Query: 59  VEVPRSPSKSKHVAVKETSRSKDDRESCFPAHENLNELQVQKKAS-LSSISTPYFAQNFS 117
           ++VP SP K     V   +  K   E   P HEN NEL++++K+  L S +T YF + F 
Sbjct: 61  LQVPCSPVKKTETNV-PVAMKKSTNEMEIP-HENPNELRIREKSGQLPSNTTTYFMEKFQ 118

Query: 118 SSKKAQEVESRRKMEMLNCRVHTFDGPDFVREYSPIAVNEEEEFSGKWISKRYITAEQAR 177
            SKK +E + ++   M+N RVHTF      +E+ PI VNE EE+S  W+ KRYI   + R
Sbjct: 119 KSKKEEEGKIQKMENMMNARVHTFQDQGGKQEFKPIQVNEIEEYSNIWLKKRYIPQSELR 178

Query: 178 KILRETKVLRLPKLFAKVRPPTFTEPQYSNWVTIGIISAKSSVKMTTGTKPSRYFTLTLT 237
           K+L   K+LRL KLFAKVRPP F+EPQYSNW  +GIISAK   K TT  KP +Y   T+T
Sbjct: 179 KMLHNIKILRLSKLFAKVRPPKFSEPQYSNWAALGIISAKGDAKFTTTDKPKKYLKFTMT 238

Query: 238 DFKHTINIYLFGNKNVEKYYNLKVGDIIAVLNPEIWPWRPSKVEHEQSSQAVIKSFNLCI 297
           DF+H +++Y+FG   VE+YYNL+VGD+IA+LNPE++PWRPS           IKSFNL I
Sbjct: 239 DFQHKLDVYIFGKGGVERYYNLRVGDVIAILNPEVFPWRPS------GKGQFIKSFNLRI 292

Query: 298 KHNFNSILEIGTSRDFGFCSIYNKLQGKTCGTPINKSVEDRCYYHQEVQFRQVNAKRLEL 357
            H+F  ILEIG+S+D GFC + ++  G  C TPIN S EDRC YHQE++FR  N+KR+EL
Sbjct: 293 NHDFKCILEIGSSKDLGFCKVTSR-NGTLCNTPINMSKEDRCDYHQEIRFRDNNSKRIEL 351

Query: 358 NGNKSLRSPTKNGVKHILYGKNKSGKYDLLPDRYAPQTQS------KDSQNV--LYFSNP 409
           NG+ +L +PTK      LY K          +R      +      KD  ++   +FSN 
Sbjct: 352 NGSFALGAPTKVENNPTLYRKKNGETRHSRKNRQNFSVSASFGSINKDQFDLRNRHFSNN 411

Query: 410 NAARAFFDDDYQNPDFLNNLDSXXXXXXXXXXXXXXXXXXXXXXXXSNSNLFKNETSTKQ 469
           N+A+AFFD+ +QNPD LNNL+S                          S+     ++ + 
Sbjct: 412 NSAKAFFDEKFQNPDMLNNLNSKRRKIQDDKKWTRIDKELSKAIGNRASDDLGERSAMEV 471

Query: 470 DEIRRATKNALESGLIKKIGFDPTSGRMSSVLK 502
            +++RAT+  L+SG+I+++GFDPT G++++VL+
Sbjct: 472 KQMKRATETTLQSGVIQRLGFDPTHGKIANVLR 504

>Kpol_1043.71 s1043 (151546..153303) [1758 bp, 585 aa] {ON}
           (151546..153303) [1758 nt, 586 aa]
          Length = 585

 Score =  399 bits (1026), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 232/590 (39%), Positives = 354/590 (60%), Gaps = 33/590 (5%)

Query: 1   MEDPREPREIDIFDELSCDE--DDDLHKRLDELEREKKDLKQRLQDISQRKKKIDPNFSG 58
           M DPRE  + D++  LS DE   D++ ++L  +ER+K+DL +RL+   +RK K+DPNF  
Sbjct: 1   MNDPREHAKEDLYSNLSSDEGEQDEISEQLKAIERQKQDLLERLKKKKERKSKLDPNF-- 58

Query: 59  VEVPRSPSKSKHVAVKETSRSKDDRESCFPAHENLNELQVQKKASLSSISTPYFAQNFSS 118
           V+VP SP KS+ V +K TS+  D+ E     + N   L  +  ++  +  T YF + F +
Sbjct: 59  VQVPSSPKKSRVVELKPTSKPIDNNEEEEEENPNEVALMTKDDSNYGT--TSYFMEKFYN 116

Query: 119 SKKAQEVESRRKMEMLNCRVHTFDGPDFVREYSPIAVNEEEEFSGKWISKRYITAEQARK 178
           SKK  E +      M++ RVHTF G    +E+ P  V+E +++S  W+  RYI  ++   
Sbjct: 117 SKKDHERKVVAYSSMMSSRVHTFSGTGSKKEFKPTDVDELDQYSNLWLRSRYIPVDELNL 176

Query: 179 ILRETKVLRLPKLFAKVRPPTFTEPQYSNWVTIGIISAKSSVKMTTGTKPSRYFTLTLTD 238
           +L + K+LRLPKLFAKVRPP FTEPQYSNWV  GII++K  +K T+ +KP++YF  T++D
Sbjct: 177 MLLDIKILRLPKLFAKVRPPKFTEPQYSNWVVTGIITSKDDIKYTSSSKPTKYFKFTISD 236

Query: 239 FKHTINIYLFGNKNVEKYYNLKVGDIIAVLNPEIWPWRPSKVEHEQSSQAVIKSFNLCIK 298
           F+H +++++FG K VEKYYNL+VGD++A+LNPEI PWRPS  E+   S + IKSFNL I 
Sbjct: 237 FQHNLDVFIFGVKGVEKYYNLRVGDVVAILNPEILPWRPS--ENSGGSGSTIKSFNLRIS 294

Query: 299 HNFNSILEIGTSRDFGFCSIYNKLQGKTCGTPINKSVEDRCYYHQEVQFRQVNAKRLELN 358
           H F+ ILEIG SRD G+C I N  +   C TPINKS ED+C YH+E+QFR+  + R+EL+
Sbjct: 295 HKFDCILEIGASRDLGWCPIPNASKNTLCKTPINKSKEDKCQYHREIQFRKTTSNRVELS 354

Query: 359 GNKSLRSPTKNGVKHILY---GKNKSGK----YDLLPDRYAPQTQ--SKDSQNVLYFSNP 409
           G  +L +PTK   +  LY   G + + +    Y+++ D +  + +  +K    + +FS  
Sbjct: 355 GTYALGAPTKVDARPALYQNRGTSNNSRVQKSYNMVSDSHYQKRKDSNKLETRMHHFSTM 414

Query: 410 NAARAFFDDDYQNPDFLNNLDSXXXXXXXXXXXXXXXXXXXXXXXXSNSNLFKNETSTKQ 469
           N+A+AFFD+D+QNPD LNNLDS                         + N FKN      
Sbjct: 415 NSAKAFFDEDFQNPDILNNLDSKRRKIKDSKMERNLVKALKNTVDKESKN-FKN------ 467

Query: 470 DEIRRATKNALESGLIKKIGFDPTSGRMSSVLKNNSKGLK-----EQAKNSAVXXXXXXX 524
             ++ AT+  L++G+++++GFDPT G++SSV++N++   +     +  K  A+       
Sbjct: 468 --LKNATQATLQTGILQRLGFDPTGGKLSSVIRNSNSETEVTNKYQMEKKEALDDLMTFR 525

Query: 525 XXXXXXXPSKEALRQKFKKREEVWNHHFKKEENPNPGVESSDGDSELEIV 574
                  PSK+ L ++   R+  W   F K+++      + D  S+L+I+
Sbjct: 526 KDTVNLKPSKDDLIKRRIDRQRNWKKLFGKQQSSIDN--NDDSGSDLKIL 573

>NDAI0F00280 Chr6 complement(58035..59867) [1833 bp, 610 aa] {ON}
           Anc_5.703 YIL150C
          Length = 610

 Score =  398 bits (1022), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 240/616 (38%), Positives = 356/616 (57%), Gaps = 48/616 (7%)

Query: 1   MEDPREPREIDIFDELSCDED--DDLHKRLDELEREKKDLKQRLQDISQRKKKIDPNFSG 58
           M DPRE    D F +LS  E+  D + + L++L+R K DL  RL+++ +R+K+ DPNF  
Sbjct: 1   MNDPRECSPEDPFADLSDKEENEDAVLEELEDLDRRKSDLLGRLKELKERQKRRDPNFDE 60

Query: 59  VEVPRSPSK-------SKHVAVKETSRSKDDRESCFPAHENL---NELQVQKKAS----L 104
           V++P +P +       S+   ++   R +++ E    + E L   NEL+V+++      L
Sbjct: 61  VQIPGTPEEKNTNIFTSEQTILQNRDRKEEEVEEEEFSGERLPNPNELKVREREENLEKL 120

Query: 105 SSISTPYFAQNFSSSKKAQEVESRRKMEMLNCRVHTFDGPD-----FVREYSPIAVNEEE 159
            S +T YF + F   KK +E+E+ R  +ML  RVH F G +        EY P A NE E
Sbjct: 121 PSNTTSYFMEKFQHVKKKEEIENVRNEKMLKARVHMFQGLNKSSKIHKIEYQPEAANEVE 180

Query: 160 EFSGKWISKRYITAEQARKILRETKVLRLPKLFAKVRPPTFTEPQYSNWVTIGIISAKSS 219
           E+S   I KRYI  ++   I +  K+LRL KLFAKVRPP F EPQYSNWVT+GII+ K S
Sbjct: 181 EYSMLRIQKRYIPKKELNDIFQNIKILRLNKLFAKVRPPKFEEPQYSNWVTLGIITQKGS 240

Query: 220 VKMTTGTKPSRYFTLTLTDFKHTINIYLFGNKNVEKYYNLKVGDIIAVLNPEIWPWRPSK 279
           +K T+  KP +YF  T++DFK+ ++I++F    VE+YYNL++GDIIA+LNPE+ PWRPS 
Sbjct: 241 IKFTSSDKPKKYFKFTISDFKYNVDIFIFDKHAVERYYNLRIGDIIAILNPEVLPWRPSN 300

Query: 280 VEHEQSSQAVIKSFNLCIKHNFNSILEIGTSRDFGFCSIYNKL-QGKTCGTPINKSVEDR 338
                 +   IKSFNL I HN++ I+E+G S+D GFC I NK+ +  TC TPI+ S EDR
Sbjct: 301 ----NKNGTGIKSFNLRINHNYHCIIEVGKSKDLGFCPIPNKINESGTCHTPIDISKEDR 356

Query: 339 CYYHQEVQFRQVNAKRLELNGNKSLRSPTKNGVKHILYGKNK--------SGKYDLLPDR 390
           C YHQE++FR   +KR+ELNG+ +L +P K G +  LY  N           +++++   
Sbjct: 357 CSYHQEIRFRNNGSKRIELNGSFALGAPVKVGAQPQLYRNNNVPVRGVYHGNRFNVVKGS 416

Query: 391 YAPQTQSK--DSQNVLYFSNPNAARAFFDDDYQNPDFLNNLDSXXXXXXXXXXXXXXXXX 448
              + +SK  + +   YFS+ N+A+AFFD+ +QNPD L NLD+                 
Sbjct: 417 EIRKNESKLMEERRRRYFSSNNSAKAFFDEKFQNPDMLTNLDTKRRKIADDKRSNYLDQE 476

Query: 449 XXXXXXXSNSN-LFKNETSTKQDEIRRATKNALESGLIKKIGFDPTSGRMSSVLKNNSKG 507
                   +SN L  N+T  +  +++ AT+  L++G+I+++GFDPT G+++ VL+     
Sbjct: 477 LSKAIENKSSNRLSGNKTKKEYAKMKSATETTLQTGVIQRLGFDPTHGKIAKVLQTGKDS 536

Query: 508 LKEQAKNS----AVXXXXXXXXXXXXXXPSKEALRQKFKKREEVWNHHF----KKEENP- 558
            K+   N+     V              P+KE L ++  +REEVW  HF    +  E P 
Sbjct: 537 GKDNVHNTHKVEKVKDLLEFKKGKVVLAPAKEELIKRKNRREEVWQKHFGSGKRLAEQPL 596

Query: 559 NPGVESSDGDSELEIV 574
           N  V++S+ D  LEIV
Sbjct: 597 NDDVDTSESD--LEIV 610

>KAFR0D02210 Chr4 complement(441977..443731) [1755 bp, 584 aa] {ON}
           Anc_5.703 YIL150C
          Length = 584

 Score =  395 bits (1014), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 233/596 (39%), Positives = 335/596 (56%), Gaps = 34/596 (5%)

Query: 1   MEDPREPREIDIFDELSCDEDDD--LHKRLDELEREKKDLKQRLQDISQRKKKIDPNFSG 58
           M DPRE    D++  ++ D++D   +   L+++E  K+DL +RL       ++ DPNF+G
Sbjct: 1   MSDPREIAPNDLYQNITPDKEDARRIELELEKIENVKRDLLERLHRKKIEIERRDPNFTG 60

Query: 59  VEVPRSPSKSKHVAVKETSRSKDDRESCFP-AHENLNELQVQKK-----ASL--SSISTP 110
           V+VP SP K   + + E    K    + F  ++EN NEL +Q++     A L  S+ ST 
Sbjct: 61  VQVPASPVKKHELQLVEQKDQKLKNINRFEESNENPNELCLQQRFQKQTARLNDSNASTE 120

Query: 111 YFAQNFSSSKKAQEVESRRKMEMLNCRVHTFDGPDFVREYSPIAVNEEEEFSGKWISKRY 170
           YF + F  +K+ ++V   +   M+  RVHTF+G +   EY  + V+E E++S  WI+KRY
Sbjct: 121 YFMEKFRDAKRKEKVHIEKHESMMKSRVHTFNGIEPKNEYQHVIVDELEQYSNLWINKRY 180

Query: 171 ITAEQARKILRETKVLRLPKLFAKVRPPTFTEPQYSNWVTIGIISAKSSVKMTTGTKPSR 230
                 + +L E K+LRL KLFAKVRPP F EPQYSNWV +GI+S KS +K T   KP +
Sbjct: 181 TPVSNLKSMLHEVKILRLNKLFAKVRPPKFEEPQYSNWVVVGIVSDKSDIKFTASNKPQK 240

Query: 231 YFTLTLTDFKHTINIYLFGNKNVEKYYNLKVGDIIAVLNPEIWPWRPSKVEHEQSSQAVI 290
           Y   TLTDFKH ++ Y+FG + VE+YYNL++GDIIAVLNPEI PWRPS        Q  I
Sbjct: 241 YLKFTLTDFKHKVDTYIFGKEGVERYYNLRIGDIIAVLNPEILPWRPS------GKQNYI 294

Query: 291 KSFNLCIKHNFNSILEIGTSRDFGFCSIYNKLQGKTCGTPINKSVEDRCYYHQEVQFRQV 350
           KSFNL I H +  ILEIG SRD   C I  +   K CG PINK V+  C YH+E++ R+ 
Sbjct: 295 KSFNLRISHPYKCILEIGKSRDLARCPIVVRSTSKECGVPINKKVDRCCEYHREMEIRKG 354

Query: 351 NAKRLELNGNKSLRSPTKNGVKHILYGKN-----KSGKYDLLP--DRYAPQTQSKDSQNV 403
            +KRL+L+G  +L +PTK   +  LY  +     K   + L P   +  P    K  +  
Sbjct: 355 PSKRLDLSGQYALGAPTKLESQPALYRGHTAQNVKIQNFKLTPSYSQNNPHLIDKYGEKS 414

Query: 404 LYFSNPNAARAFFDDDYQNPDFLNNLDSXXXXXXXXXXXXXXXXXXXXXXXXSNSNLFKN 463
            +FSN NAA+AFFDD++QNPD ++NLD+                              + 
Sbjct: 415 KFFSNRNAAKAFFDDEFQNPDMISNLDNKRRKIMEQRKSNVLNRELDRLLRKDQD--LEG 472

Query: 464 ETSTKQDEIRRATKNALESGLIKKIGFDPTSGRMSSVLKNNSKGLKEQ-----AKNSAVX 518
           +T  + +++++ T+  L+SGL +K+GFDPT G++S +LKN  +    +      K+  V 
Sbjct: 473 KTREEVEKMKQTTQRTLQSGLFQKVGFDPTGGKISRILKNKERSKDGEPKFLSQKDRTVD 532

Query: 519 XXXXXXXXXXXXXPSKEALRQKFKKREEVWNHHFKKEENPNPGVESSDGDSELEIV 574
                        PSK  L  K  KRE+VW  +F +    N   ++S+ DS+LEIV
Sbjct: 533 DLMAFKKEYIILAPSKVDLLNKKNKREKVWQENFGQ----NKSNDNSESDSDLEIV 584

>TBLA0G01020 Chr7 (256107..257891) [1785 bp, 594 aa] {ON} Anc_5.703
           YIL150C
          Length = 594

 Score =  380 bits (975), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 230/606 (37%), Positives = 348/606 (57%), Gaps = 44/606 (7%)

Query: 1   MEDPREPREIDIFDELSCDEDDDL--HKRLDELEREKKDLKQRLQDISQRKKKIDPNF-- 56
           M DPRE  E D+FD +S DED++L   K+++ +ER+K+DL++RL+   +  + +DPNF  
Sbjct: 1   MNDPREVFENDLFDNISPDEDEELELQKQIELIERQKRDLQERLEYKRKVSRAVDPNFIS 60

Query: 57  ----------SGVEVPRSPSK--SKHVAVKETSRSKDDRESCFPAHENLNELQVQKK--- 101
                     S ++VP SP K   KH  +  T  +K +        +N NEL+++ +   
Sbjct: 61  TEGNVDATSESRIQVPGSPEKIKRKHTQLAATPVTKKNT----GIQDNPNELKLKNQIEP 116

Query: 102 ASLSSISTPYFAQNFSSSKKAQEVESRRKMEMLNCRVHTFDG-PDFVREYSPIAVNEEEE 160
           AS+ + ST YF  NF+SSKK +  + +    +++ RVH+F    +  +E   I V E+E+
Sbjct: 117 ASVPAGSTAYFMNNFASSKKVEAQKIQDYETLMSARVHSFGNYTNLQKESQIINVEEKEK 176

Query: 161 FSGKWISKRYITAEQARKILRETKVLRLPKLFAKVRPPTFTEPQYSNWVTIGIISAKSSV 220
           +SG WIS+RY+  E   ++L++ K+LRL KLFAK+RPP F  PQYSNWV +G+I+ KS  
Sbjct: 177 YSGLWISRRYLKEETIDQLLQDIKILRLNKLFAKIRPPKFESPQYSNWVAVGVITEKSGF 236

Query: 221 KMTTGTKPSRYFTLTLTDFKHTINIYLFGNKNVEKYYNLKVGDIIAVLNPEIWPWRPSKV 280
           K+T+   P +YF  T+ DF+  I+I++F  + + KYYNL+VGDII +LNP I PWRPS+ 
Sbjct: 237 KLTSSNTPRKYFKFTIGDFQQNISIFVFNREAIAKYYNLRVGDIICILNPVIAPWRPSE- 295

Query: 281 EHEQSSQAVIKSFNLCIKHNFNSILEIGTSRDFGFCSIYNKLQ-GKTCGTPINKSVEDRC 339
                    IKSFNL I+  ++ I+EIG SRD G+C++  K + GK CGTPINK+ +  C
Sbjct: 296 -----ENGYIKSFNLSIQTKYDCIIEIGKSRDLGWCNVPVKSKGGKPCGTPINKTKDKCC 350

Query: 340 YYHQEVQFRQVNAKRLELNGNKSLRSPTKNGVKHILYGKNKSGKY-----DLLPDRYAPQ 394
            +H+E +FR   AKR+ELNG+ +L +PTK      LY K  +  Y     +++  R A +
Sbjct: 351 EFHRETEFRNAAAKRIELNGSFALGAPTKADTNPSLYKKKTNNIYSKNQFNVVRRRNARK 410

Query: 395 TQSKDSQNVLYFSNPNAARAFFDDDYQNPDFLNNLDSXXXXXXXXXXXXXXXXXXXXXXX 454
                  N   F + N A+AFF+D++QNPD ++NLDS                       
Sbjct: 411 EGDSKLHNS-NFRSTNIAKAFFNDEFQNPDIISNLDSKRRKLKDAKRDSELIKELNKTLT 469

Query: 455 XSNSNLFKN-ETSTKQD--EIRRATKNALESGLIKKIGFDPTSGRMSSVLK--NNSKGLK 509
             + N+ KN E  +K+D  E+R  T+N ++ G++K IG+DPT G+M  ++K  N      
Sbjct: 470 KED-NVSKNLEGKSKEDVKEMRNITENIMQIGMLKNIGYDPTHGKMKYLMKKSNGKDPSY 528

Query: 510 EQAKNSAVXXXXXXXXXXXXXXPSKEALRQKFKKREEVWNHHFKKEENPNPGVESSDG-D 568
              +++AV              P K  L  K +KR+E+WN +F  +   N  +  S G D
Sbjct: 529 TSNRSNAVNDLLHFKKDKVNLKPLKSDLLMKKRKRDEIWNEYFGDQSKSNRDIILSSGDD 588

Query: 569 SELEIV 574
           S+LEIV
Sbjct: 589 SDLEIV 594

>KNAG0L02150 Chr12 (386276..388126) [1851 bp, 616 aa] {ON} Anc_5.703
           YIL150C
          Length = 616

 Score =  376 bits (966), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 231/621 (37%), Positives = 340/621 (54%), Gaps = 57/621 (9%)

Query: 3   DPREPREIDIFDELSCDEDDD--LHKRLDELEREKKDLKQRLQDISQRKKKIDPNFS-GV 59
           DPR+    D +D ++ DED++  + + L+E+ER KKDL++RL+      K  D N    V
Sbjct: 4   DPRDVITADPYDNITSDEDEESKIQRELEEMERRKKDLEKRLKLKRAHVKPTDLNLQLDV 63

Query: 60  EVPRSPSKSKHVAVKETSRSKDDRESC----------FPAHENLNELQVQK------KAS 103
           +VP SP K    A+    + +++ E+                NLNE +  +      K S
Sbjct: 64  QVPSSPQKRSVSAIDVARKRREEAEAIKKRNLSLALNTAQKVNLNEARFAQLDGDDGKQS 123

Query: 104 LSSISTPYFAQNFSSSKKAQEVESRRKMEMLNCRVHTFDGPDFVREYSPIAVNEEEEFSG 163
           +++ +T YF + F  SKK +++E   +  ML+ RVHTF G D  +E+   AVNE E+FS 
Sbjct: 124 VNA-TTSYFLEKFQQSKKTEKLEIEAQETMLSARVHTFQGVD--KEFQLEAVNELEQFSD 180

Query: 164 KWISKRYITAEQARKILRETKVLRLPKLFAKVRPPTFTEPQYSNWVTIGIISAKSSVKMT 223
            WISKRYI  +   + LR+ K+LRL KLFAKVRPP F EPQYSNW  + IIS KS VK T
Sbjct: 181 LWISKRYIPKQYLEESLRDVKLLRLNKLFAKVRPPKFQEPQYSNWAVLAIISKKSEVKFT 240

Query: 224 TGTKPSRYFTLTLTDFKHTINIYLFGNKNVEKYYNLKVGDIIAVLNPEIWPWRPSKVEHE 283
           T   P ++   TLT+F+  +++++FG+  V++YYNL+ GDI+AVLNPEI PWRPS    +
Sbjct: 241 TSKNPQKFIRFTLTNFQQQLDLFVFGDAGVKRYYNLREGDIVAVLNPEILPWRPSGGSQQ 300

Query: 284 QSSQAVIKSFNLCIKHNFNSILEIGTSRDFGFCSIYNKLQGKTCGTPINKSVEDRCYYHQ 343
            +S   IKSFNL I H F  ILEIG SRD G+C +  K   + CG+ IN + +  C YH+
Sbjct: 301 TTS---IKSFNLKIAHKFKCILEIGKSRDLGYCPVTKKFSNEKCGSAINLARDRTCEYHR 357

Query: 344 EVQFRQVNAKRLELNGNKSLRSPTKNGVKHILYGKNKSGKYDL----LP----------- 388
           E+Q RQ ++KRL+LNG  +L +PTK G +  L+ +  SG++      LP           
Sbjct: 358 ELQMRQNSSKRLDLNGGFALGAPTKVGTQPDLF-REASGRFKQSARSLPRDQGKRFYTEP 416

Query: 389 ---DRYAPQTQSKDSQNV--LYFSNPNAARAFFDDDYQNPDFLNNLDSXXXXXXXXXXXX 443
               R+     S+++  +   +F++ NAA+AFFDD++QNPD L+NLD+            
Sbjct: 417 SWNSRHGQGGSSEENYGLKGKFFTSSNAAKAFFDDEFQNPDMLHNLDAKRRKLQDSKKSR 476

Query: 444 XXXXXXXXXXXXSNSNLFKNETSTKQDEIRRATKNALESGLIKKIGFDPTSGRMSSVLK- 502
                              ++ + +   ++R T+ AL +GLI+++GFDPT GR +SV+K 
Sbjct: 477 QLDRKLKRLLSKDEDRATLDKNTAEMAALKRTTETALHTGLIQRLGFDPTHGRAASVMKK 536

Query: 503 ---NNSKGLKEQA----KNSAVXXXXXXXXXXXXXXPSKEALRQKFKKREEVWNHHFKKE 555
                  G  E      K + V              PS+  L  + + R EVW   F K+
Sbjct: 537 RDSERGSGANEDVALSQKENMVNELLRWKRDKCNLLPSETQLAHRKQHRREVWRETFGKK 596

Query: 556 ENP--NPGVESSDGDSELEIV 574
             P  +  V++ D D +LEIV
Sbjct: 597 GTPVDSQPVDNDDSD-DLEIV 616

>CAGL0H06589g Chr8 (649740..651491) [1752 bp, 583 aa] {ON} similar
           to uniprot|P32354 Saccharomyces cerevisiae YIL150c DNA43
          Length = 583

 Score =  362 bits (928), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 226/620 (36%), Positives = 328/620 (52%), Gaps = 92/620 (14%)

Query: 3   DPREPREIDIFDELSCD---EDDDLHKRLDELEREKKDLKQRLQDISQRK---KKIDPNF 56
           DPRE + +D + +LS D   ++ D+ + L+ +ER+K+DL  RL++ ++RK   K++DPN 
Sbjct: 8   DPREVKLLDPYTDLSEDDKEQESDIQRELEMIERKKQDLISRLKE-NKRKLLSKQLDPNM 66

Query: 57  SG------VEVPRSPSKSKHVAVKETSRSKDDRESCFPAHENL----------------- 93
                   VEVPRSP                 RES  PA ENL                 
Sbjct: 67  KNINSRGRVEVPRSPK----------------RES-LPAQENLQHNVPQVTHNQAANNKK 109

Query: 94  ---NELQVQKKASLSSISTPYFAQNFSSSKKAQEVESRRKMEMLNCRVHTFDGPDFVREY 150
              NE  + +K      +T YF   F +SK  +        +M++ R HTF+G   + + 
Sbjct: 110 ANPNEEDIVRKELDVVATTSYFQNKFKNSKTDENRMVTAYQQMMSARTHTFNGSTSLSDN 169

Query: 151 SPIAVNEEEEFSGKWISKRYITAEQARKILRETKVLRLPKLFAKVRPPTFTEPQYSNWVT 210
             I  +E E +S   I KRYI  ++  K+L   K+LRL KLFAKVRPP+F+EPQYSNWV 
Sbjct: 170 KTIQCDELEPYSNFHIKKRYIPKDEVDKLLHGIKILRLNKLFAKVRPPSFSEPQYSNWVA 229

Query: 211 IGIISAKSSVKMTTGTKPSRYFTLTLTDFKHTINIYLFGNKNVEKYYNLKVGDIIAVLNP 270
           IG IS+K  VK+T   KP +YF  TLTDF+H +++Y+FG K VE+YYNL+VGDIIAVLNP
Sbjct: 230 IGAISSKEDVKLTNAAKPVKYFKFTLTDFRHNLDVYVFGKKPVERYYNLRVGDIIAVLNP 289

Query: 271 EIWPWRPSKVEHEQSSQAVIKSFNLCIKHNFNSILEIGTSRDFGFCSIYNKLQGKTCGTP 330
           EI PWRPS   +       IKSFNL I H+FN ILEIG SRD G+C + N  Q K C +P
Sbjct: 290 EILPWRPSGCVNG------IKSFNLRIGHDFNCILEIGASRDLGWCQMVNHGQSKICNSP 343

Query: 331 INKSVEDRCYYHQEVQFRQVNAKRLELNGNKSLRSPTKNGVKHILYGKNKSGKYDLLPDR 390
           IN   +  C +H+E+Q R   +KR+EL+G+ +L +PTK G +  +Y  N   + +  P +
Sbjct: 344 INTKTDRCCEFHRELQMRSTASKRIELSGSYALGAPTKVGTQPSIYKDNNKSR-NTNPAK 402

Query: 391 Y-----------APQTQSKDSQNVLYFSNPNAARAFFDDDYQNPDFLNNLDSXXXXXXXX 439
           +             Q + K      +FSN  AA+AFFDD +Q+P  L NL+S        
Sbjct: 403 HKMFSITGHGSKKEQEKEKHEIEAHHFSNKRAAKAFFDDSFQDPSLLANLESKRRKIKAS 462

Query: 440 XXXXXXXXXXXXXXXXSNSNLFKNETSTKQDEIRRATKNALESGLIKKIGFDPTSGRMSS 499
                            + N         + +++  T+  L++G+I+++GFDP+ G+++ 
Sbjct: 463 KMDRNLLKALNGEDASQSKN---------KQQVKEITEKTLQTGVIQRLGFDPSGGQIAK 513

Query: 500 VLKNNSKGLKE-----QAKNSAVXXXXXXXXXXXXXXPSKEALRQKFKKREEVWNHHFKK 554
           VL + S+G K        K   +              PS+E   +K  +RE +W  HF+ 
Sbjct: 514 VL-DKSRGTKTDDPTISKKMGLINDLIHFKKDKIKLKPSREIQLEKRHRREAIWKKHFQ- 571

Query: 555 EENPNPGVESSDGDSELEIV 574
                   +++D DS+LEIV
Sbjct: 572 --------DTNDSDSDLEIV 583

>TPHA0E00210 Chr5 complement(26313..27947) [1635 bp, 544 aa] {ON}
           Anc_5.703 YIL150C
          Length = 544

 Score =  350 bits (899), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 211/559 (37%), Positives = 316/559 (56%), Gaps = 40/559 (7%)

Query: 40  QRLQDISQRKKKIDPNFSGVEVPRSPSKSKH-----VAVKETSRSKDDRESCFPAHENLN 94
           +RL+   + +KK+DPNF+ +++ RSP K K      V      R  +D         N N
Sbjct: 2   KRLKAKKEDQKKLDPNFTDIQIQRSPEKKKSNPNTTVNPIPLKRLVED--------VNPN 53

Query: 95  ELQVQKKASLSSISTPYFAQNFSSSKKAQEVESRRKMEMLNCRVHTFDGPDFVREYSPIA 154
           E +V   A+L + +T YF QNF  +KK +  + +   + ++ RVH+F G +  ++Y  I 
Sbjct: 54  EAKVVSNANLPANTTSYFMQNFLKAKKEETKQVKEYQQKMSSRVHSFAGANLSKKYQSII 113

Query: 155 VNEEEEFSGKWISKRYITAEQARKILRETKVLRLPKLFAKVRPPTFTEPQYSNWVTIGII 214
           V E EE+S   ISKRY+  E+  K L   K+LRL KLFAK+RPP F+EP Y+NW   GII
Sbjct: 114 VEELEEYSRFNISKRYLPKEEVSKCLHNIKILRLNKLFAKIRPPKFSEPDYANWAVTGII 173

Query: 215 SAKSSVKMTTGTKPSRYFTLTLTDFKHTINIYLFGNKNVEKYYNLKVGDIIAVLNPEIWP 274
            +K  +K+T+   P ++F  T+T+F+HT++I++FG   VEKYYNL+VGDII +LNPE+ P
Sbjct: 174 CSKEDIKLTSSKTPVKFFKFTITNFQHTLDIFIFGAAGVEKYYNLRVGDIIFILNPEVLP 233

Query: 275 WRPSKVEHEQSSQAVIKSFNLCIKHNFNSILEIGTSRDFGFCSIYNKLQGKTCGTPINKS 334
           WRP   E + +S   IKSFNL I H F+ ILEI  S+D  +C   N+  G  C TPINKS
Sbjct: 234 WRP---EFKGNS---IKSFNLRISHKFDCILEIARSKDIAWCQQINRKTGAKCNTPINKS 287

Query: 335 VEDRCYYHQEVQFRQVNAKRLELNGNKSLRSPTKNGVKHILY-GKNKS-----GKYDLLP 388
            +D C YH+E+QFR  NAKR+EL+G  +L +PT+   +  LY  KN S       ++++ 
Sbjct: 288 KQDVCDYHKEMQFRSANAKRVELSGTYALGAPTQIDSRPALYRSKNTSNLKPGNNFNIVA 347

Query: 389 DRYAPQTQSKDSQNV--LYFSNPNAARAFFDDDYQNPDFLNNLDSXXXXXXXXXXXXXXX 446
           DR   + +  D  N    +FS+ N+A+AFFD+D+QNPD L NL++               
Sbjct: 348 DRRYMKKKENDPINSKRHHFSSSNSAKAFFDEDFQNPDMLVNLENKRRKIKDDKRDVMLQ 407

Query: 447 XXXXXXXXXSNSNLFKNETSTKQDEIRRATKNALESGLIKKIGFDPTSGRMSSVL----- 501
                    S   L K++++ +   +R  T   L++G I+K+GFDPT G++  VL     
Sbjct: 408 RALRESVGNSKL-LLKDKSNQEIQSMRNTTDATLQNGFIQKLGFDPTGGQIKVVLEKSAD 466

Query: 502 KNNSKGLKEQAKNSAVXXXXXXXXXXXXXXPSKEALRQKFKKREEVWNHHFK---KEENP 558
           K+    L++Q K++A+              PS+E L +K   RE+ +  + K     EN 
Sbjct: 467 KSTQSKLQKQ-KSNAMENLVTFKKSSVNLKPSREVLLEKLHHREQSFAQYKKSIIAAENR 525

Query: 559 NPGVESSDGDS---ELEIV 574
           +    S+  D+   +LEI+
Sbjct: 526 DRKSASTKNDTDSDDLEII 544

>KLLA0A00572g Chr1 complement(51265..52910,52994..53081) [1734 bp,
           577 aa] {ON} similar to uniprot|P32354 Saccharomyces
           cerevisiae YIL150C MCM10 Essential chromatin-associated
           protein involved in the initiation of DNA replication
          Length = 577

 Score =  343 bits (881), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 207/588 (35%), Positives = 321/588 (54%), Gaps = 29/588 (4%)

Query: 1   MEDPREPREIDIFDELSCDEDD--DLHKRLDELEREKKDLKQRLQDISQRKKKIDPNFSG 58
           + DPRE    D ++ELS DE +   + +R+ E++ EK+DL  RL ++ +++   DPNF  
Sbjct: 5   LTDPREITAFDPYEELSDDESEIERVKRRIVEIDTEKRDLTNRLLELEKKRNLKDPNFDS 64

Query: 59  VEVPRSPSKSKHVA-----VKETSRSKDDRESCFPAHENLNELQVQKKASLSSISTPYFA 113
           ++VP SP KS +       +K  +   D  E+ F  +E+    +V+K  +     T YF 
Sbjct: 65  IDVPESPKKSDNATKGIEDIKHIAPVADIEEATFNVNEDYVREKVKKLGT-----TSYFT 119

Query: 114 QNFSSSKKAQEVESRRKMEMLNCRVHTFDGPDFVREYSPIAVNEEEEFSGKWISKRYITA 173
           +   S    +    +RK E+L  RV+TF+G D   EY PI V+E+++ SG  I +RY+  
Sbjct: 120 EKLRSINTNEHEAIKRKKELLAHRVYTFNG-DMFDEYEPITVDEKDDLSGLVIDRRYVPL 178

Query: 174 EQARKILRETKVLRLPKLFAKVRPPTFTEPQYSNWVTIGIISAKSSVKMTTGTKPSRYFT 233
              RK  +  KVLRLPKLF+KVR P F+EP Y NW+ +GIIS K+  +MT   KP ++F+
Sbjct: 179 AVLRKHTKNIKVLRLPKLFSKVRAPKFSEPDYPNWLVLGIISKKTEPRMTNSVKPVKFFS 238

Query: 234 LTLTDFKHTINIYLFGNKNVEKYYNLKVGDIIAVLNPEIWPWRPSKVEHEQSSQAVIKSF 293
           LT++DF+  +N+  FG   VEKYY L++GD+IA+LNPEI P +    + E  +     +F
Sbjct: 239 LTISDFQFELNVIFFGKSIVEKYYKLRLGDLIAILNPEIMPSK----KLEAGASPSYATF 294

Query: 294 NLCIKHNFNSILEIGTSRDFGFCSIYNKLQGKTCGTPINKSVEDRCYYHQEVQFRQVNAK 353
           +L +  + N+ILE+G S++FG C  Y K +GK CG PINK  ++ C YH+E + RQ +++
Sbjct: 295 SLKVSKDTNNILELGHSKEFGLCQFYMKNKGKLCGAPINKLHDNYCAYHKEAKMRQNSSR 354

Query: 354 RLELNGNKSLRSPTKNGVKH-ILYGKNKSGK----YDLLPDRYAPQTQSKDSQNVLYFSN 408
           R+E++ + ++R+P   G +  I+  ++ +GK    Y   PD+   +  +    N   FS+
Sbjct: 355 RVEISSSVAMRAPVVKGYQQTIVKSQHNNGKTSIRYQQNPDKPFVREPAAAETNRFLFSS 414

Query: 409 PNAARAFFDDDYQNPDFLNNLDSXXXXXXXXXXXXXXXXXXXXXXXXSNSNLFKNETSTK 468
            NA+ AFFDDDY+NPD L NLD+                        S+  L K E    
Sbjct: 415 ANASTAFFDDDYENPDILANLDN---KRRKIQELRNNRNLEKKLKGLSDKLLSKKEDRVN 471

Query: 469 QDEIRRATKNALESGLIKKIGFDPTSGRMSSVLKNNSKGLK--EQAKNSAVXXXXXXXXX 526
           Q+  + AT +  + GL  +IG+DPT G+ S  +   S   K  +  K  A+         
Sbjct: 472 QEAKKTATLSMFQHGLANQIGYDPTKGKASLEMLEYSTENKAPKNDKQLAITDICNIKKD 531

Query: 527 XXXXXPSKEALRQKFKKREEVWNHHFKKEENPNPGVESSDGDSELEIV 574
                PSK+ L++K +KR  ++N   K  +      E S  D  LEI+
Sbjct: 532 NVSLKPSKKQLKEKIEKRNAIFNEIMKGSQERLDKDEGSSDD--LEII 577

>KLLA0F03993g Chr6 complement(375915..378254) [2340 bp, 779 aa] {ON}
           similar to uniprot|P53959 Saccharomyces cerevisiae
           YNL041C COG6 Component of the conserved oligomeric Golgi
           complex (Cog1p through Cog8p) a cytosolic tethering
           complex that functions in protein trafficking to mediate
           fusion of transport vesicles to Golgi compartments
          Length = 779

 Score = 35.4 bits (80), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 45/93 (48%), Gaps = 6/93 (6%)

Query: 232 FTLTLTDFKHTINIYLFGNKNVEKYYNL--KVGDIIAVLNPEIWPWRPSKVEHEQSSQAV 289
           +TL +T  K T+N YLF +  +E Y+NL   +  II+V +   +    S VE+     AV
Sbjct: 633 YTLCVTKLKETMNSYLFESTGMELYFNLFNMIFPIISVQDELDYDMYLSAVENPIMKLAV 692

Query: 290 IKSFNLCIKHNFNSILEIGTSRDFGFCSIYNKL 322
           I      I    N+ L +  S DF    ++N +
Sbjct: 693 IHD---NIHEKLNTYLPLAVS-DFQDVKLFNLM 721

>TDEL0C06160 Chr3 complement(1114395..1117487) [3093 bp, 1030 aa]
           {ON} Anc_1.85 YNL267W
          Length = 1030

 Score = 33.9 bits (76), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 29/62 (46%)

Query: 53  DPNFSGVEVPRSPSKSKHVAVKETSRSKDDRESCFPAHENLNELQVQKKASLSSISTPYF 112
           DP   G +V R    +    +  TSRS +D +S    HEN+    V    ++SSI  P  
Sbjct: 120 DPESYGFQVARRVLNNLQSTLFSTSRSGEDAKSPTKMHENIAPALVLCSMAMSSIGLPQM 179

Query: 113 AQ 114
           AQ
Sbjct: 180 AQ 181

>Kpol_1062.20 s1062 (46681..47778) [1098 bp, 365 aa] {ON}
           (46681..47778) [1098 nt, 366 aa]
          Length = 365

 Score = 32.7 bits (73), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 30/53 (56%), Gaps = 11/53 (20%)

Query: 379 NKSGKYDLLPDR-YAPQTQSKDSQNV----------LYFSNPNAARAFFDDDY 420
           N+S K+ L+PD    P T S+D+Q +          L+ ++P AA++F D DY
Sbjct: 312 NRSLKHFLIPDNDMKPVTNSRDTQEIPFSIGNSILKLFRADPAAAQSFLDSDY 364

>NDAI0A06590 Chr1 complement(1496544..1503653) [7110 bp, 2369 aa]
           {ON} Anc_3.401 YBR136W
          Length = 2369

 Score = 32.3 bits (72), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 22/96 (22%), Positives = 41/96 (42%), Gaps = 2/96 (2%)

Query: 206 SNWVTIGIISAKSSVKMTTGTKPSRYFTLTLTDFKHTINIYLFGNKNVEKYYNLKVGDII 265
           ++W T  +  +  S  +     P R  +   +     +N YL   +   KY +  +  I+
Sbjct: 490 ADWNTCQLCDSVGSCNIFERIDPDRNISAAASPALTILNKYLLLPEYTNKYNDSVLASIL 549

Query: 266 AVLNPEIWPWRPSKVEHE--QSSQAVIKSFNLCIKH 299
             L      ++P K++HE  Q   ++ + F LC KH
Sbjct: 550 LCLQRIFMHYQPPKLDHEELQLGSSLFRFFTLCFKH 585

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.130    0.373 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 63,142,403
Number of extensions: 2814016
Number of successful extensions: 11038
Number of sequences better than 10.0: 183
Number of HSP's gapped: 11342
Number of HSP's successfully gapped: 187
Length of query: 574
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 459
Effective length of database: 40,294,809
Effective search space: 18495317331
Effective search space used: 18495317331
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 68 (30.8 bits)