Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0E14916g5.702ON1779177985100.0
Ecym_40185.702ON1769180435020.0
Kwal_55.196975.702ON1760179930560.0
KLTH0E01056g5.702ON1771174830180.0
KLLA0A00594g5.702ON1748180327620.0
ZYRO0G06600g5.702ON1820179627370.0
TDEL0B021905.702ON1810179427270.0
AFR286W5.702ON1758179026630.0
Suva_11.3315.702ON1898180925100.0
YKR095W (MLP1)5.702ON1875179824730.0
Skud_11.3345.702ON1885178624300.0
Smik_11.3585.702ON1878177824030.0
NCAS0A032005.702ON1788178523180.0
CAGL0G02497g5.702ON1780182621760.0
NDAI0E050405.702ON1973174420330.0
TBLA0E017305.702ON1820159914691e-172
Suva_9.395.702ON1682178712121e-137
Smik_9.205.702ON1682175411901e-134
Skud_9.195.702ON1680177611891e-134
NCAS0G002305.702ON1735183511881e-134
YIL149C (MLP2)5.702ON1679177411291e-126
KNAG0C065905.702ON1651167410121e-111
KAFR0D022205.702ON167416179901e-109
KNAG0L021405.702ON160817418535e-92
KAFR0H002105.702ON145410996526e-68
NDAI0F002905.702ON15547045177e-52
Kpol_1043.705.702ON13218364918e-49
TPHA0E002305.702ON12847313352e-30
TPHA0D046105.702ON11831792215e-17
Kpol_2001.755.702ON10063101232e-05
KLTH0F05720g1.216ON4108177860.42
KAFR0E004001.496ON39638830.63
NCAS0G002805.696ON711132830.71
NCAS0A024504.238ON1928124830.77
Kpol_479.38.604ON795241830.80
TDEL0B022605.696ON662135820.87
KNAG0A033608.604ON756379821.0
Skud_5.771.448ON26745801.2
KLLA0D06875g8.636ON462138801.3
TPHA0A011508.604ON818283811.4
NDAI0A070303.102ON68080801.4
TDEL0A054908.604ON781233801.5
TPHA0E007507.409ON107794801.5
KLTH0D09504g8.604ON71871801.7
KLTH0G12144g8.331ON3582198802.1
YLR309C (IMH1)4.46ON911271792.4
KNAG0F033905.296ON875112792.4
Kpol_1067.224.364ON722197773.9
TDEL0F032403.441ON161347773.9
Kthe_YGOB_Anc_5.2965.296ON395135754.7
KNAG0B012103.409ON192112735.4
KLLA0A00286g1.295ON1224126765.4
ADR028W3.425ON83258755.6
YOR326W (MYO2)7.68ON1574106765.8
ACR068W5.267ON1805145756.2
ZYRO0C10604g2.33ON19472736.3
YLR086W (SMC4)8.259ON1418242756.5
TBLA0I016605.696ON722149748.8
YDR356W (SPC110)5.414ON944117749.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0E14916g
         (1779 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0E14916g Chr5 (1236762..1242101) [5340 bp, 1779 aa] {ON} sim...  3282   0.0  
Ecym_4018 Chr4 complement(42777..48086) [5310 bp, 1769 aa] {ON} ...  1353   0.0  
Kwal_55.19697 s55 complement(82938..88220) [5283 bp, 1760 aa] {O...  1181   0.0  
KLTH0E01056g Chr5 complement(99471..104786) [5316 bp, 1771 aa] {...  1167   0.0  
KLLA0A00594g Chr1 complement(53304..58550) [5247 bp, 1748 aa] {O...  1068   0.0  
ZYRO0G06600g Chr7 complement(521893..527355) [5463 bp, 1820 aa] ...  1058   0.0  
TDEL0B02190 Chr2 complement(389562..394994) [5433 bp, 1810 aa] {...  1055   0.0  
AFR286W Chr6 (951485..956761) [5277 bp, 1758 aa] {ON} Syntenic h...  1030   0.0  
Suva_11.331 Chr11 (604552..610248) [5697 bp, 1898 aa] {ON} YKR09...   971   0.0  
YKR095W Chr11 (619805..625432) [5628 bp, 1875 aa] {ON}  MLP1Myos...   957   0.0  
Skud_11.334 Chr11 (601335..606992) [5658 bp, 1885 aa] {ON} YKR09...   940   0.0  
Smik_11.358 Chr11 (609897..615533) [5637 bp, 1878 aa] {ON} YKR09...   930   0.0  
NCAS0A03200 Chr1 complement(627997..633363) [5367 bp, 1788 aa] {...   897   0.0  
CAGL0G02497g Chr7 (223375..228717) [5343 bp, 1780 aa] {ON} simil...   842   0.0  
NDAI0E05040 Chr5 (1150358..1156279) [5922 bp, 1973 aa] {ON} Anc_...   787   0.0  
TBLA0E01730 Chr5 complement(417597..423059) [5463 bp, 1820 aa] {...   570   e-172
Suva_9.39 Chr9 complement(57700..62748) [5049 bp, 1682 aa] {ON} ...   471   e-137
Smik_9.20 Chr9 complement(40653..45701) [5049 bp, 1682 aa] {ON} ...   462   e-134
Skud_9.19 Chr9 complement(40103..45145) [5043 bp, 1680 aa] {ON} ...   462   e-134
NCAS0G00230 Chr7 complement(33629..38836) [5208 bp, 1735 aa] {ON...   462   e-134
YIL149C Chr9 complement(63028..68067) [5040 bp, 1679 aa] {ON}  M...   439   e-126
KNAG0C06590 Chr3 (1276738..1281693) [4956 bp, 1651 aa] {ON} Anc_...   394   e-111
KAFR0D02220 Chr4 complement(443928..448952) [5025 bp, 1674 aa] {...   385   e-109
KNAG0L02140 Chr12 (381286..386112) [4827 bp, 1608 aa] {ON} Anc_5...   333   5e-92
KAFR0H00210 Chr8 complement(27128..31492) [4365 bp, 1454 aa] {ON...   255   6e-68
NDAI0F00290 Chr6 complement(60327..64991) [4665 bp, 1554 aa] {ON...   203   7e-52
Kpol_1043.70 s1043 (147247..151212) [3966 bp, 1321 aa] {ON} (147...   193   8e-49
TPHA0E00230 Chr5 complement(28358..32212) [3855 bp, 1284 aa] {ON...   133   2e-30
TPHA0D04610 Chr4 (1006833..1010384) [3552 bp, 1183 aa] {ON} Anc_...    90   5e-17
Kpol_2001.75 s2001 (206286..209306) [3021 bp, 1006 aa] {ON} (206...    52   2e-05
KLTH0F05720g Chr6 (490598..502924) [12327 bp, 4108 aa] {ON} simi...    38   0.42 
KAFR0E00400 Chr5 (91314..92504) [1191 bp, 396 aa] {ON} Anc_1.496...    37   0.63 
NCAS0G00280 Chr7 (47258..49393) [2136 bp, 711 aa] {ON} Anc_5.696...    37   0.71 
NCAS0A02450 Chr1 complement(463760..469546) [5787 bp, 1928 aa] {...    37   0.77 
Kpol_479.3 s479 (2938..5325) [2388 bp, 795 aa] {ON} (2938..5325)...    37   0.80 
TDEL0B02260 Chr2 (408913..410901) [1989 bp, 662 aa] {ON} Anc_5.6...    36   0.87 
KNAG0A03360 Chr1 complement(425339..427609) [2271 bp, 756 aa] {O...    36   1.0  
Skud_5.77 Chr5 complement(119815..120618) [804 bp, 267 aa] {ON} ...    35   1.2  
KLLA0D06875g Chr4 complement(591141..592529) [1389 bp, 462 aa] {...    35   1.3  
TPHA0A01150 Chr1 complement(224257..226713) [2457 bp, 818 aa] {O...    36   1.4  
NDAI0A07030 Chr1 (1602728..1604770) [2043 bp, 680 aa] {ON} Anc_3...    35   1.4  
TDEL0A05490 Chr1 (962132..964477) [2346 bp, 781 aa] {ON} Anc_8.6...    35   1.5  
TPHA0E00750 Chr5 (146045..149278) [3234 bp, 1077 aa] {ON} Anc_7....    35   1.5  
KLTH0D09504g Chr4 (783223..785379) [2157 bp, 718 aa] {ON} weakly...    35   1.7  
KLTH0G12144g Chr7 complement(1020201..1030949) [10749 bp, 3582 a...    35   2.1  
YLR309C Chr12 complement(749034..751769) [2736 bp, 911 aa] {ON} ...    35   2.4  
KNAG0F03390 Chr6 complement(635419..638046) [2628 bp, 875 aa] {O...    35   2.4  
Kpol_1067.22 s1067 complement(46246..48414) [2169 bp, 722 aa] {O...    34   3.9  
TDEL0F03240 Chr6 complement(591617..596458) [4842 bp, 1613 aa] {...    34   3.9  
Kthe_YGOB_Anc_5.296 Chr7 (520932..522119) [1188 bp, 395 aa] {ON}...    33   4.7  
KNAG0B01210 Chr2 (225740..226318) [579 bp, 192 aa] {ON} Anc_3.40...    33   5.4  
KLLA0A00286g Chr1 complement(22024..25698) [3675 bp, 1224 aa] {O...    34   5.4  
ADR028W Chr4 (753946..756444) [2499 bp, 832 aa] {ON} Syntenic ho...    33   5.6  
YOR326W Chr15 (925721..930445) [4725 bp, 1574 aa] {ON}  MYO2One ...    34   5.8  
ACR068W Chr3 (480141..485558) [5418 bp, 1805 aa] {ON} Syntenic h...    33   6.2  
ZYRO0C10604g Chr3 complement(813540..814124) [585 bp, 194 aa] {O...    33   6.3  
YLR086W Chr12 (302243..306499) [4257 bp, 1418 aa] {ON}  SMC4Subu...    33   6.5  
TBLA0I01660 Chr9 complement(367039..369207) [2169 bp, 722 aa] {O...    33   8.8  
YDR356W Chr4 (1186107..1188941) [2835 bp, 944 aa] {ON}  SPC110In...    33   9.3  

>SAKL0E14916g Chr5 (1236762..1242101) [5340 bp, 1779 aa] {ON} similar
            to uniprot|Q02455 Saccharomyces cerevisiae YKR095W MLP1
            Myosin-like protein associated with the nuclear envelope
            connects the nuclear pore complex with the nuclear
            interior involved in the Tel1p pathway that controls
            telomere length involved in the retention of unspliced
            mRNAs in the nucleus
          Length = 1779

 Score = 3282 bits (8510), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1683/1779 (94%), Positives = 1683/1779 (94%)

Query: 1    MAEQNSPTTPSVIGEIDVTTISSFLELDASKVSTLDPAVVRQLSIKANQFGQLKAQNLKY 60
            MAEQNSPTTPSVIGEIDVTTISSFLELDASKVSTLDPAVVRQLSIKANQFGQLKAQNLKY
Sbjct: 1    MAEQNSPTTPSVIGEIDVTTISSFLELDASKVSTLDPAVVRQLSIKANQFGQLKAQNLKY 60

Query: 61   SVTLDELKSSSERRSEAFKLQLEKINENTESLRXXXXXXXXXXXXLIDEKANASKEVNLL 120
            SVTLDELKSSSERRSEAFKLQLEKINENTESLR            LIDEKANASKEVNLL
Sbjct: 61   SVTLDELKSSSERRSEAFKLQLEKINENTESLRKEKDAFEDEKFKLIDEKANASKEVNLL 120

Query: 121  KSQLTELKQQNEIFRSSKQDVVQLLNEKIGDLEASQDEAKQLLQNTKTLRKQVLELENEV 180
            KSQLTELKQQNEIFRSSKQDVVQLLNEKIGDLEASQDEAKQLLQNTKTLRKQVLELENEV
Sbjct: 121  KSQLTELKQQNEIFRSSKQDVVQLLNEKIGDLEASQDEAKQLLQNTKTLRKQVLELENEV 180

Query: 181  QTFKSNDLRGKAEMQRLTQEMNLLKSNNQWLEKELASKSEEFGSYRQRVNSELQTALSEL 240
            QTFKSNDLRGKAEMQRLTQEMNLLKSNNQWLEKELASKSEEFGSYRQRVNSELQTALSEL
Sbjct: 181  QTFKSNDLRGKAEMQRLTQEMNLLKSNNQWLEKELASKSEEFGSYRQRVNSELQTALSEL 240

Query: 241  NXXXXXXXXXXXXXQTLKSRANDLSQQLQDKMTELKSLRDSSSIEKQEFTREMTLKQRLI 300
            N             QTLKSRANDLSQQLQDKMTELKSLRDSSSIEKQEFTREMTLKQRLI
Sbjct: 241  NSIRSELEIERSSSQTLKSRANDLSQQLQDKMTELKSLRDSSSIEKQEFTREMTLKQRLI 300

Query: 301  DLLEKQIESFKTELESARNKSVSNSDHVDAERXXXXXXXXXXXXXXXXXXXXAVKLEETV 360
            DLLEKQIESFKTELESARNKSVSNSDHVDAER                    AVKLEETV
Sbjct: 301  DLLEKQIESFKTELESARNKSVSNSDHVDAEREKIIEELIETKKKLEISESKAVKLEETV 360

Query: 361  DELLSTDGERGAGNTSKVSLDSKNSIVPKLHGDIGLLKKRLIQERRQKEQLQYQVEAFVL 420
            DELLSTDGERGAGNTSKVSLDSKNSIVPKLHGDIGLLKKRLIQERRQKEQLQYQVEAFVL
Sbjct: 361  DELLSTDGERGAGNTSKVSLDSKNSIVPKLHGDIGLLKKRLIQERRQKEQLQYQVEAFVL 420

Query: 421  ELEHKVPVLNSFKERTEMLEKELSDVALMLEATSKDKEEKEHELTSVKSKIADYETQIHS 480
            ELEHKVPVLNSFKERTEMLEKELSDVALMLEATSKDKEEKEHELTSVKSKIADYETQIHS
Sbjct: 421  ELEHKVPVLNSFKERTEMLEKELSDVALMLEATSKDKEEKEHELTSVKSKIADYETQIHS 480

Query: 481  LVRQRSDLAHQVQHLLIQVSVRNDSNGPLTPEETNFIKKIINSSESPVEQDAQRIISERL 540
            LVRQRSDLAHQVQHLLIQVSVRNDSNGPLTPEETNFIKKIINSSESPVEQDAQRIISERL
Sbjct: 481  LVRQRSDLAHQVQHLLIQVSVRNDSNGPLTPEETNFIKKIINSSESPVEQDAQRIISERL 540

Query: 541  VRFESMVELQEKNMELLNSIRNLADKLXXXXXXXXXXXXXXXXXXXXXXXXXILTLQEYN 600
            VRFESMVELQEKNMELLNSIRNLADKL                         ILTLQEYN
Sbjct: 541  VRFESMVELQEKNMELLNSIRNLADKLEAEEKESKSKSKEVESETVKEAKEAILTLQEYN 600

Query: 601  KSLESQLEIIAKERDAFKILASDKGTSNGPSNVNSSENRHLVLAEEKIKELENHLSSLTE 660
            KSLESQLEIIAKERDAFKILASDKGTSNGPSNVNSSENRHLVLAEEKIKELENHLSSLTE
Sbjct: 601  KSLESQLEIIAKERDAFKILASDKGTSNGPSNVNSSENRHLVLAEEKIKELENHLSSLTE 660

Query: 661  ESAKNIKLLNEEIHSLYRAQADTSVNLEKERSSRILAEDRSKLISNTLEMTKMENDELRK 720
            ESAKNIKLLNEEIHSLYRAQADTSVNLEKERSSRILAEDRSKLISNTLEMTKMENDELRK
Sbjct: 661  ESAKNIKLLNEEIHSLYRAQADTSVNLEKERSSRILAEDRSKLISNTLEMTKMENDELRK 720

Query: 721  RFHSLQENILKQDSKTQQTIESLISCKXXXXXXXXXXXXXXXERDLLRSIQENLKKENES 780
            RFHSLQENILKQDSKTQQTIESLISCK               ERDLLRSIQENLKKENES
Sbjct: 721  RFHSLQENILKQDSKTQQTIESLISCKSQLSALQSQLNNSQSERDLLRSIQENLKKENES 780

Query: 781  LSEERNNMRILITQLQTLQTERESLLEETQKNFQGKTNKLETELSDTLEKLDAKSKEISD 840
            LSEERNNMRILITQLQTLQTERESLLEETQKNFQGKTNKLETELSDTLEKLDAKSKEISD
Sbjct: 781  LSEERNNMRILITQLQTLQTERESLLEETQKNFQGKTNKLETELSDTLEKLDAKSKEISD 840

Query: 841  YISTKDSQEKWYQEKFDRLNEELNNSREKLSSKLTDIQHLELKVESLNNKLEESEARIQA 900
            YISTKDSQEKWYQEKFDRLNEELNNSREKLSSKLTDIQHLELKVESLNNKLEESEARIQA
Sbjct: 841  YISTKDSQEKWYQEKFDRLNEELNNSREKLSSKLTDIQHLELKVESLNNKLEESEARIQA 900

Query: 901  FNALNYSESVESQTETLRQELEKTRIKLADAYSQVEQYKSMADSSEESATAIKDALEQSK 960
            FNALNYSESVESQTETLRQELEKTRIKLADAYSQVEQYKSMADSSEESATAIKDALEQSK
Sbjct: 901  FNALNYSESVESQTETLRQELEKTRIKLADAYSQVEQYKSMADSSEESATAIKDALEQSK 960

Query: 961  AEYTEKIETLTKERDMFKDQVPILKDQISNLNNELNHQKSQFESQISDYTRNLEDLKAKQ 1020
            AEYTEKIETLTKERDMFKDQVPILKDQISNLNNELNHQKSQFESQISDYTRNLEDLKAKQ
Sbjct: 961  AEYTEKIETLTKERDMFKDQVPILKDQISNLNNELNHQKSQFESQISDYTRNLEDLKAKQ 1020

Query: 1021 SELDNMKAEYEQKISKIQEDLNQQTSYANTAQKNYEQELQKHADVSKKISLLRAEAQKYK 1080
            SELDNMKAEYEQKISKIQEDLNQQTSYANTAQKNYEQELQKHADVSKKISLLRAEAQKYK
Sbjct: 1021 SELDNMKAEYEQKISKIQEDLNQQTSYANTAQKNYEQELQKHADVSKKISLLRAEAQKYK 1080

Query: 1081 SETETLRNAAENAKKALEQSELSWEKQSSDYEDELRLAHQRIEDLNAQSKILYDQIDFLS 1140
            SETETLRNAAENAKKALEQSELSWEKQSSDYEDELRLAHQRIEDLNAQSKILYDQIDFLS
Sbjct: 1081 SETETLRNAAENAKKALEQSELSWEKQSSDYEDELRLAHQRIEDLNAQSKILYDQIDFLS 1140

Query: 1141 KGKPTSSEDLMPISTETRNLLTSLRREKDILETKLEVSTREEKVLRQKLKLIESDLEGSR 1200
            KGKPTSSEDLMPISTETRNLLTSLRREKDILETKLEVSTREEKVLRQKLKLIESDLEGSR
Sbjct: 1141 KGKPTSSEDLMPISTETRNLLTSLRREKDILETKLEVSTREEKVLRQKLKLIESDLEGSR 1200

Query: 1201 IELSKLQRAASGNSATLKDQEEIMTQLNQLNLLRESNITLRNEAQKNGERSRELKAELDA 1260
            IELSKLQRAASGNSATLKDQEEIMTQLNQLNLLRESNITLRNEAQKNGERSRELKAELDA
Sbjct: 1201 IELSKLQRAASGNSATLKDQEEIMTQLNQLNLLRESNITLRNEAQKNGERSRELKAELDA 1260

Query: 1261 LYGKVQPLESKVTLLQNSVREKDLQISLKNEEAERWKQRSQDILHKYERIDPEEHQKLAD 1320
            LYGKVQPLESKVTLLQNSVREKDLQISLKNEEAERWKQRSQDILHKYERIDPEEHQKLAD
Sbjct: 1261 LYGKVQPLESKVTLLQNSVREKDLQISLKNEEAERWKQRSQDILHKYERIDPEEHQKLAD 1320

Query: 1321 KVSELQQEIKSKSDENEELDTRFKRLKQQAHEKLNAAKTAQSTLTSQLNDLKATKEKLEN 1380
            KVSELQQEIKSKSDENEELDTRFKRLKQQAHEKLNAAKTAQSTLTSQLNDLKATKEKLEN
Sbjct: 1321 KVSELQQEIKSKSDENEELDTRFKRLKQQAHEKLNAAKTAQSTLTSQLNDLKATKEKLEN 1380

Query: 1381 DLGSQKEEVKNLESKITDIEKNKSSEKNDLQEQLENSQAKLLETENKLEQVTSSSALLEK 1440
            DLGSQKEEVKNLESKITDIEKNKSSEKNDLQEQLENSQAKLLETENKLEQVTSSSALLEK
Sbjct: 1381 DLGSQKEEVKNLESKITDIEKNKSSEKNDLQEQLENSQAKLLETENKLEQVTSSSALLEK 1440

Query: 1441 ELNERIESLMNKIKLLEEDLEKAKTESPNDGSQSSELVENTSKIVENLKIEFEEEKAKMI 1500
            ELNERIESLMNKIKLLEEDLEKAKTESPNDGSQSSELVENTSKIVENLKIEFEEEKAKMI
Sbjct: 1441 ELNERIESLMNKIKLLEEDLEKAKTESPNDGSQSSELVENTSKIVENLKIEFEEEKAKMI 1500

Query: 1501 SDKESELREQFEEEKASILEAKEQELREQLATQKLDPPVNIDEIKKKWEEEYEQKTSQRI 1560
            SDKESELREQFEEEKASILEAKEQELREQLATQKLDPPVNIDEIKKKWEEEYEQKTSQRI
Sbjct: 1501 SDKESELREQFEEEKASILEAKEQELREQLATQKLDPPVNIDEIKKKWEEEYEQKTSQRI 1560

Query: 1561 RESNEQLKKRIRLPTEEKINKIVEKKRLELEAEFEANVQKKAEEIXXXXXXXXXXXTEVL 1620
            RESNEQLKKRIRLPTEEKINKIVEKKRLELEAEFEANVQKKAEEI           TEVL
Sbjct: 1561 RESNEQLKKRIRLPTEEKINKIVEKKRLELEAEFEANVQKKAEEIAKSKSASNSNSTEVL 1620

Query: 1621 EKHKQDLENLKQEMQKKFDEDIAQIKKRAFEEGKQQASMKSTFLEKKIAKLETQIKAHDS 1680
            EKHKQDLENLKQEMQKKFDEDIAQIKKRAFEEGKQQASMKSTFLEKKIAKLETQIKAHDS
Sbjct: 1621 EKHKQDLENLKQEMQKKFDEDIAQIKKRAFEEGKQQASMKSTFLEKKIAKLETQIKAHDS 1680

Query: 1681 AIPINDNSSATPAESGPTTQDVKQLTPILNNQAAILPGKPLPFNPAHFAFGMPFGQTTSN 1740
            AIPINDNSSATPAESGPTTQDVKQLTPILNNQAAILPGKPLPFNPAHFAFGMPFGQTTSN
Sbjct: 1681 AIPINDNSSATPAESGPTTQDVKQLTPILNNQAAILPGKPLPFNPAHFAFGMPFGQTTSN 1740

Query: 1741 SFQNPFNSQPPEQTPNSPKRPSEEPVGGSPEKKPKENDS 1779
            SFQNPFNSQPPEQTPNSPKRPSEEPVGGSPEKKPKENDS
Sbjct: 1741 SFQNPFNSQPPEQTPNSPKRPSEEPVGGSPEKKPKENDS 1779

>Ecym_4018 Chr4 complement(42777..48086) [5310 bp, 1769 aa] {ON}
            similar to Ashbya gossypii AFR286W
          Length = 1769

 Score = 1353 bits (3502), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 814/1804 (45%), Positives = 1166/1804 (64%), Gaps = 89/1804 (4%)

Query: 16   IDVTTISSFLELDASKVSTLDPAVVRQLSIKANQFGQLKAQNLKYSVTLDELKSSSERRS 75
            +D + +++FLE+D +KV  LD ++V    +KAN+F ++KA N++ S+++D LK + E++ 
Sbjct: 13   VDYSKVAAFLEVDEAKVQELDESMVTVFFLKANEFSKMKADNMRLSISIDGLKCNFEQKI 72

Query: 76   EAFKLQLEKINENTESLRXXXXXXXXXXXXLIDEKANASKEVNLLKSQLTELKQQNEIFR 135
              FK Q+EK+  +  S +            L++EKA  S EV  L+SQ+ E KQ  EI  
Sbjct: 73   NTFKEQVEKLLSDVASRQQEKQQTEDEKLKLMNEKAQLSMEVLKLRSQVEEAKQGMEIIA 132

Query: 136  SSKQDVVQLLNEKIGDLEASQDEAKQLLQNTKTLRKQVLELENEVQTFKSNDLRGKAEMQ 195
            S+KQDV +LL EKI DL AS++E+ +LL   K LRK  ++LE  +Q +KS +LR K+E+Q
Sbjct: 133  SAKQDVTKLLEEKISDLAASKEESDRLLAANKELRKSSIDLEFIIQGYKSQELREKSEIQ 192

Query: 196  RLTQEMNLLKSNNQWLEKELASKSEEFGSYRQRVNSELQTALSELNXXXXXXXXXXXXXQ 255
            RL QE+NL+KSN  WL KEL SK+E+  S+R++ NSELQ    ++N              
Sbjct: 193  RLHQELNLVKSNADWLSKELESKNEQLNSFREKTNSELQNGYEQVNSLKSQLEFARANNS 252

Query: 256  TLKSRANDLSQQLQDKMTELKSLRDSSSIEKQEFTREMTLKQRLIDLLEKQIESFKTELE 315
            TLK++  +LS QLQ+K+ E K L D  + EK+EFTREM+LKQRLIDLLE Q+ S K++LE
Sbjct: 253  TLKAKTAELSNQLQEKLVETKKLADVLNTEKEEFTREMSLKQRLIDLLESQVSSMKSDLE 312

Query: 316  SARNKSVSNSDHVDAERXXXXXXXXXXXXXXXXXXXXAVKLEETVDELLSTDGERGAG-- 373
            +A  +S + +     E+                     +KLE TV+ELLS +G+ G    
Sbjct: 313  NAY-QSANQNGMSTPEKDQLLDELIDTKKNLEATQAENIKLEATVNELLSVNGKNGVAVI 371

Query: 374  --NTSKVSLDSKNSIVPKLHGDIGLLKKRLIQERRQKEQLQYQVEAFVLELEHKVPVLNS 431
              N S  SLDSK S VPKL GDIG+LKK+L+QERRQKE+LQ QVE+FV+ELEHK+P+LNS
Sbjct: 372  NSNVSDTSLDSKISTVPKLCGDIGILKKQLVQERRQKEELQNQVESFVVELEHKIPILNS 431

Query: 432  FKERTEMLEKELSDVALMLEATSKDKEEKEHELTSVKSKIADYETQIHSLVRQRSDLAHQ 491
            FKERT+MLE+EL+DV L+LE+T+K +++K  EL   K+KI +YE+Q+ SL+ QRSDLAHQ
Sbjct: 432  FKERTDMLERELNDVTLLLESTAKQRDQKTIELNQYKNKINNYESQVCSLIVQRSDLAHQ 491

Query: 492  VQHLLIQVSVRNDSNGPLTPEETNFIKKIINSSESPVEQDAQRIISERLVRFESMVELQE 551
            VQ+LL+Q+SVR+D++GPLT +E  F+K+II+S +   + D Q IISERLV+F+S++ELQ 
Sbjct: 492  VQYLLMQLSVRDDAHGPLTEQEVEFVKRIISSEDEAPKSDTQGIISERLVQFKSVIELQS 551

Query: 552  KNMELLNSIRNLADKLXXXXXXXXXXXXXXXXXXXXXXXXXILTLQEYNKSLESQLEIIA 611
            KN ELLN+IR LADKL                         IL+LQE+ + LE QL+I++
Sbjct: 552  KNAELLNTIRQLADKLEDEEKKSRFRLKSVETQTVKEAKEAILSLQEHVQRLEDQLKIVS 611

Query: 612  KERDAFKIL-ASDKGTSNGPSNVNSSENRHLVLAEEKIKELENHLSSLTEESAKNIKLLN 670
            KERDAFK+  +++K   + PS+   S+       +E I ELE  L +L E+S  NIKLLN
Sbjct: 612  KERDAFKLANSANKQGDSAPSSTYQSKK-----LDEHIMELEKRLKNLAEQSQDNIKLLN 666

Query: 671  EEIHSLYRAQADTSVNLEKERSSRILAEDRSKLISNTLEMTKMENDELRKRFHSLQENIL 730
            +EI +LY+A+++ +V LE+ERSS++LAE+R KLI +TL +TK EN EL KR   LQ  +L
Sbjct: 667  DEIKALYKAKSEVTVILEQERSSKVLAEERLKLIQSTLSLTKEENLELHKRSDDLQRVLL 726

Query: 731  KQDSKTQQTIESLISCKXXXXXXXXXXXXXXXERDLLRSIQENLKKENESLSEERNNMRI 790
            KQD KTQ TI+ +I+ K               ERD LR I+  LK ENE+L++E    +I
Sbjct: 727  KQDEKTQSTIDEIIATKSQLSNLTSKLAILTSERDFLRKIEAELKNENEALTKENTTSKI 786

Query: 791  LITQLQTLQTERESLLEETQKNFQGKTNKLETELSDTLEKLDAKSKEISDYISTKDSQEK 850
            L++QLQTLQ ER+ LLEE Q N++    KLE++L +T E L  +++E  +   +  SQ K
Sbjct: 787  LVSQLQTLQRERDILLEEAQTNYRKNIEKLESDLHETREHLVRRTREYEEQRVSDTSQYK 846

Query: 851  WYQEKFDRLNEELNNSREKLSSKLTDIQHLELKVESLNNKLEESEARIQAFNALNYSESV 910
            W+Q K D LNE+L+N+R+ L  K   I+ L+L  +SL  KLEE+E R Q+++ L  ++ +
Sbjct: 847  WFQAKVDSLNEQLDNARKTLQEKTNSIETLQLHAKSLTAKLEEAELRTQSYSVLANADDI 906

Query: 911  ESQTETLRQELEKTRIKLADAYSQVEQYKSMADSSEESATAIKDALEQSKAEYTEKIETL 970
              + ETLR+ LEK  I LADAYSQ+EQYKSMA  SE+SA  I  ALE+S+A Y + I  L
Sbjct: 907  TDKIETLRKNLEKANINLADAYSQIEQYKSMAKVSEQSAVEISKALEESQANYRKNIALL 966

Query: 971  TKERDMFKDQVPILKDQISNLNNELNHQKSQFESQISDYTRNLEDLKAKQSELDNMKAEY 1030
             +ER    DQ+ +L DQI +LN+EL+HQKSQ +S+ S+  + L  L+  Q  LD +K+EY
Sbjct: 967  EQERKSLTDQIALLNDQIKDLNSELDHQKSQNQSEKSELIKKLSILQGSQRSLDELKSEY 1026

Query: 1031 EQKISKIQEDLNQQTSYANTAQKNYEQELQKHADVSKKISLLRAEAQKYKSETETLRNAA 1090
            E+KISK+QEDL QQ SYAN AQKNYEQELQKHADV+K ISLLR E+QKYKSE E  + +A
Sbjct: 1027 EEKISKLQEDLTQQASYANQAQKNYEQELQKHADVTKTISLLREESQKYKSEMEGFKRSA 1086

Query: 1091 ENAKKALEQSELSWEKQSSDYEDELRLAHQRIEDLNAQSKILYDQIDFLSKGKPTSSEDL 1150
              AK ALE++E SW +Q +D E +L LA QR E+LN Q+++LYDQ++ LSK   + SE  
Sbjct: 1087 SEAKSALERNEQSWCQQVADLESQLSLAQQRTEELNTQNRLLYDQVELLSKATSSDSEAA 1146

Query: 1151 MPISTETRNLLTSLRREKDILETKLEVSTREEKVLRQKLKLIESDLEGSRIELSKLQRAA 1210
              +S E+R L+ +LRRE+DILETKL+VS REEK+LRQ+L L +++LE  R+E SK Q  A
Sbjct: 1147 ASMSAESRELIMTLRRERDILETKLDVSIREEKILRQRLGLAKTELENVRLEFSKTQATA 1206

Query: 1211 SGNSATLKDQEEIMTQLNQLNLLRESNITLRNEAQKNGERSRELKAELDALYGKVQPLES 1270
              +    + QE+IM +LNQLNLLRESN+TLRNE++K  E+S+  + E+  L  ++QPLES
Sbjct: 1207 PDSIFARESQEQIMEKLNQLNLLRESNVTLRNESKKYLEQSQHFQNEIAKLQEQLQPLES 1266

Query: 1271 KVTLLQNSVREKDLQISLKNEEAERWKQRSQDILHKYERIDPEEHQKLADKVSELQQEIK 1330
            ++  L  ++ E+D QISL  EE+ RWKQRSQDILHKYERIDP EHQKLAD+V+EL+ E++
Sbjct: 1267 QLKSLTITISERDQQISLLKEESSRWKQRSQDILHKYERIDPVEHQKLADEVTELKNELE 1326

Query: 1331 SKSDENEELDTRFKRLKQQAHEKLNAAKTAQSTLTSQLNDLKATKEKLENDLGSQKEEVK 1390
             KS EN E   RF++L++QA+E+L+  K A++ + S+   +   K +LE +L    ++V 
Sbjct: 1327 KKSLENLESQERFRKLRKQANERLDEFKAAKAKVESEFEAVSIAKAQLEAELAQTLDKVS 1386

Query: 1391 NLESKITDIEKNKSSEKNDLQEQLENSQAKLLETENKLEQVTSSSALLEKELNERIESLM 1450
             LESK++     K+ E + L+E+LE  +A  +E    +  + + +A  EK+L  +I+ L 
Sbjct: 1387 ELESKLSSSANEKNGEADSLKEELEELRANFIEANEAVADIKAEAASSEKDLKNQIQELT 1446

Query: 1451 NKIKLLEEDLEKAKTESPNDGSQSSELVENTSKIVENLKIEFEEEKAKMISDKESELREQ 1510
             KIK LE ++E ++ E+ N          + + IVEN+K +FEEEK  +I +K+ ELR +
Sbjct: 1447 EKIKTLESEIEHSELEAKNSNDSP-----DFAPIVENMKKKFEEEKQVLIQEKDEELRMK 1501

Query: 1511 FEE---------------EKASILEAKEQELREQLATQKLDPPVNIDEIKKKWEEEYEQK 1555
             EE                KAS++E+               P ++ + +K K E EYE+K
Sbjct: 1502 LEEIQKQYEEERERELSELKASLVESTPNA-----------PLIDEETLKSKLEAEYEKK 1550

Query: 1556 TSQRIRESNEQLKKRIRLPTEEKINKIVEKKRLELEAEFEANVQKKAEEIXXXXXXXXXX 1615
            T +RIRE+ E LKKRIRLP+EE+IN+++E+++  L+ EFE  V+ +A E+          
Sbjct: 1551 TLERIREAEEALKKRIRLPSEERINQVIERRQRALDQEFELRVRARALELFKENPESFVG 1610

Query: 1616 XT-EVLEKHKQDLENLKQEMQKKFDEDIAQIKKRAFEEGKQQASMKSTFLEKKIAKLETQ 1674
             T +++++H+++++ L    + KFDE +A ++K+AFEEGKQQ  MK   LE KIAKLE Q
Sbjct: 1611 DTAKLIKEHQEEMDKL----EAKFDEQLALVRKKAFEEGKQQLVMKVKLLESKIAKLEGQ 1666

Query: 1675 ---IKAHDSA---IPINDNSSATPAESGPTTQDVKQLTPILNNQAAILPGKPLPFNPAHF 1728
               I  ++S    IPI++N++++P  + P                  +  KP PF     
Sbjct: 1667 PNKINLNNSVPSKIPIDNNNNSSPQGAQP------------------IAIKPSPF---QV 1705

Query: 1729 AFGMPFGQTTSNSFQNP------FNSQPPEQT---------PNSPKRPSEEPVGGSPEKK 1773
            AFG     T+  SF+        F +   + +          N+ KR SE+ +  SPEK+
Sbjct: 1706 AFGKAMENTSFGSFKGSLLDSKQFIANTADTSTSTLTGNVGTNTNKRQSEDELAQSPEKR 1765

Query: 1774 PKEN 1777
            PK++
Sbjct: 1766 PKDD 1769

>Kwal_55.19697 s55 complement(82938..88220) [5283 bp, 1760 aa] {ON}
            YKR095W (MLP1) - colied-coil protein (putative), similar
            to myosin and TPR [contig 159] FULL
          Length = 1760

 Score = 1181 bits (3056), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 741/1799 (41%), Positives = 1142/1799 (63%), Gaps = 64/1799 (3%)

Query: 1    MAEQNSPTTPSVIGEIDVTTISSFLELDASKVSTLDPAVVRQLSIKANQFGQLKAQNLKY 60
            MA  N  + P          ++SFLELD   +  +   V  Q++ K  +F QL+A+NLK 
Sbjct: 1    MASTNVLSQPEAAQTETEDAVASFLELDREALVNVSGTVTAQIAAKIREFQQLQAENLKC 60

Query: 61   SVTLDELKSSSERRSEAFKLQLEKINENTESLRXXXXXXXXXXXXLIDEKANASKEVNLL 120
            SVT+DEL+SSS  +  A K Q+  + +  E++R               E+  +  + + L
Sbjct: 61   SVTIDELRSSSSHKLGACKDQIHSLLQEIEAVRAENLQLEQRRAQCDAERQRSINDSDTL 120

Query: 121  KSQLTELKQQNEIFRSSKQDVVQLLNEKIGDLEASQDEAKQLLQNTKTLRKQVLELENEV 180
            +++   L+QQ ++  ++K DV QLLNEKIGD+   Q E ++LLQ  +TLR+Q LELE + 
Sbjct: 121  RARNEALEQQKQVLEANKNDVAQLLNEKIGDIATLQQETERLLQEARTLRQQNLELEGQA 180

Query: 181  QTFKSNDLRGKAEMQRLTQEMNLLKSNNQWLEKELASKSEEFGSYRQRVNSELQTALSEL 240
            + +KS +L+ KA+  +L+Q+++LL +NN+WLE +L  K+ EF +YRQR  SEL +    L
Sbjct: 181  RVYKSEELKHKADFHQLSQKVSLLNTNNEWLESQLNQKNSEFNAYRQRTQSELASVSQRL 240

Query: 241  NXXXXXXXXXXXXXQTLKSRANDLSQQLQDKMTELKSLRDSSSIEKQEFTREMTLKQRLI 300
                          +TL+ +      +L+ +   +K L D  +  KQEFTREM+LKQRL+
Sbjct: 241  ETCEGDLQAATKTIKTLREQNGQKESELEGQFQAVKKLTDELTSAKQEFTREMSLKQRLV 300

Query: 301  DLLEKQIESFKTELESARNKSVSNSDHVDAERXXXXXXXXXXXXXXXXXXXXAV-KLEET 359
            +LLE Q+ + K+ELE  +N   +++D    E                      + KLE+T
Sbjct: 301  ELLEGQVSALKSELE-FKNSPQASTDAATTESQSQIEDELVHKTQQLEESELKIQKLEQT 359

Query: 360  VDELLSTDGERGAGNTSKVSLDSKNSIVPKLHGDIGLLKKRLIQERRQKEQLQYQVEAFV 419
            V++LLS D +  +G+ S          +P L+ DIG+LKK++I ERRQKE LQ QVEAFV
Sbjct: 360  VEQLLSADEKTISGSQS----------LPDLYADIGILKKQVIHERRQKEFLQNQVEAFV 409

Query: 420  LELEHKVPVLNSFKERTEMLEKELSDVALMLEATSKDKEEKEHELTSVKSKIADYETQIH 479
            +ELE+KVP+L+SFK+R ++LEKEL++ A ML++ SKDK+E   +L   KS+I D E+QI 
Sbjct: 410  VELENKVPMLSSFKDRNDVLEKELAETAYMLDSISKDKDETAADLKRTKSQIRDLESQIS 469

Query: 480  SLVRQRSDLAHQVQHLLIQVSVRNDSNGPLTPEETNFIKKIINSSESPVEQDAQRIISER 539
            +L +QRSDLA QVQ+LLIQV+VR DS+GPL+ EET F+KK++N   +  + DAQ IISER
Sbjct: 470  ALTQQRSDLARQVQYLLIQVTVRGDSHGPLSAEETAFVKKVVNMENTQPDGDAQGIISER 529

Query: 540  LVRFESMVELQEKNMELLNSIRNLADKLXXXXXXXXXXXXXXXXXXXXXXXXXILTLQEY 599
            LV F+++VELQ KN +LL+++RNLA++L                         I+TLQ++
Sbjct: 530  LVEFKNIVELQAKNADLLHTVRNLANQLETEERKVKSKTEAIENDTITEAKEAIVTLQDH 589

Query: 600  NKSLESQLEIIAKERDAFKIL---ASDKGTSNGPSNVNS--SENRHLVLAEEKIKELENH 654
             + LE+++++I +ERDA+K +    S +G++ G  +VN+  SEN  L     KI+ELE  
Sbjct: 590  IQELETRIDVITRERDAYKAIQSQTSHEGSNGGLRDVNAKASENSDL-----KIRELEEL 644

Query: 655  LSSLTEESAKNIKLLNEEIHSLYRAQADTSVNLEKERSSRILAEDRSKLISNTLEMTKME 714
            LS+   E+  N+KLL  E   L R++++  VN+EKE+SSR+LAE+R K+  ++L +TK E
Sbjct: 645  LSAAKREAEANVKLLMTENQELARSKSELVVNVEKEKSSRLLAEERLKISKSSLLLTKQE 704

Query: 715  NDELRKRFHSLQENILKQDSKTQQTIESLISCKXXXXXXXXXXXXXXXERDLLRSIQENL 774
            N+EL KR   L+ N+ KQD++TQ+TI  LI CK               + +LL +  + L
Sbjct: 705  NEELNKRGLVLENNLAKQDTRTQETISELIDCKSQLATLSAELKNSIAKENLLNTSHQKL 764

Query: 775  KKENESLSEERNNMRILITQLQTLQTERESLLEETQKNFQGKTNKLETELSDTLEKLDAK 834
            K+ NE L++ERN + IL+TQLQTLQ ER++LL+++  NF+GK + LE E+S     L  K
Sbjct: 765  KETNEQLTKERNELTILVTQLQTLQKERDTLLKDSDDNFKGKIDSLEAEISQLRTLLSQK 824

Query: 835  SKEISDYISTKDSQEKWYQEKFDRLNEELNNSREKLSSKLTDIQHLELKVESLNNKLEES 894
            + E+SD++ST DS+ +WYQEK D LNE L ++   L+SK   IQ L+ +   L +KL ++
Sbjct: 825  ATELSDFMSTSDSRSRWYQEKIDALNECLKSTTSDLNSKTQMIQELQSQQSLLTSKLRDA 884

Query: 895  EARIQAFNALNYSESVESQTETLRQELEKTRIKLADAYSQVEQYKSMADSSEESATAIKD 954
            E + Q+++ LN ++ V +QT+ LR ELEKTRI L DA+SQV++YK +  S++E+ TA+  
Sbjct: 885  ETKSQSYSVLNQTDDVLTQTDALRSELEKTRINLKDAFSQVDEYKGLYASTKETLTAMTT 944

Query: 955  ALEQSKAEYTEKIETLTKERDMFKDQVPILKDQISNLNNELNHQKSQFESQISDYTRNLE 1014
            ALE SK ++T ++ETL KERD   +   +LKDQ++NLN+EL++QK+  E+   ++ +  E
Sbjct: 945  ALEHSKQDHTIEVETLKKERDALSNDAAVLKDQLANLNSELDYQKNLLETLKHEHNKCEE 1004

Query: 1015 DLKAKQSELDNMKAEYEQKISKIQEDLNQQTSYANTAQKNYEQELQKHADVSKKISLLRA 1074
            ++K+ ++ L +MK +Y+ ++SK+ EDLNQQ  YAN AQ+NYEQELQ+HADVSK IS LR 
Sbjct: 1005 EVKSNKTALASMKDQYQLELSKLTEDLNQQAMYANKAQENYEQELQRHADVSKTISQLRE 1064

Query: 1075 EAQKYKSETETLRNAAENAKKALEQSELSWEKQSSDYEDELRLAHQRIEDLNAQSKILYD 1134
            EAQK+K++  +L  +    KK+LE++E  W  Q  +YE +  L+ QRIEDL+ Q+++L+D
Sbjct: 1065 EAQKHKNKVHSLEASITELKKSLEENESCWAAQKQEYETQASLSSQRIEDLSTQNRLLFD 1124

Query: 1135 QIDFLSKGKPTSSEDLMPIS----TETRNLLTSLRREKDILETKLEVSTREEKVLRQKLK 1190
            QI      K T S   +PI+    +E R L+++L+RE DIL+TKLE++ R+E  L+QKL+
Sbjct: 1125 QISL----KDTDS---IPINDELKSEARELISTLKRECDILQTKLELAKRDESNLKQKLE 1177

Query: 1191 LIESDLEGSRIELSKLQRAASGNSATLKDQEEIMTQLNQLNLLRESNITLRNEAQKNGER 1250
              E +L  ++ E+ K Q  +   S  +++  +I+ QLNQ+NLLRESNITLRNE Q+  +R
Sbjct: 1178 FTEQELSVAKSEIRKSQVTSDTRSIMIEENSKILEQLNQVNLLRESNITLRNELQRKSQR 1237

Query: 1251 SRELKAELDALYGKVQPLESKVTLLQNSVREKDLQISLKNEEAERWKQRSQDILHKYERI 1310
            +++L+  ++ L   ++PLE+ +  LQ SV  KD QISL  EE  RWKQRSQDIL KYER+
Sbjct: 1238 NQDLERNVEELQEALKPLENDILTLQRSVGAKDKQISLITEEVNRWKQRSQDILLKYERV 1297

Query: 1311 DPEEHQKLADKVSELQQEIKSKSDENEELDTRFKRLKQQAHEKLNAAKTAQSTLTSQLND 1370
            DPEEH+KLA+++S+ + E  + + +  EL+ RF+RLK+QA E+L+ A+T Q+TL ++L +
Sbjct: 1298 DPEEHKKLAEELSQARAEAAANAQQRSELEDRFQRLKKQARERLDNARTTQNTLNAELTE 1357

Query: 1371 LKATKEKLENDLGSQKEEVKNLESKITDIEKNKSSEKNDLQEQLENSQAKLLETENKLEQ 1430
             + +++ LE+ L  ++E+ ++L+  I   E+N+    +  ++QL+++  KL + + ++ +
Sbjct: 1358 ARESQKALEDALDKEREKTRSLQESIKATEENEIENSSATRDQLQDALQKLEDAQARINE 1417

Query: 1431 VTSSSALLEKELNERIESLMNKIKLLEEDLEKAKTESPNDGSQSSELVENTSKIVENLKI 1490
            ++++ +  E+ L E +E     +K LEE L K + E      ++   V  T   +  +K 
Sbjct: 1418 MSTAPSQEEQTLREELERTRQHVKQLEEHLAKTQNE-VRVLEEAKNQVSGTEAEIARVKT 1476

Query: 1491 EFEEEKAKMISDKESELREQFEEEKASILEAKEQELREQLATQKLDPPVNIDEIKKKWEE 1550
            E  +   K++++KE+E++E++E+++   LE K  EL + LA+ +     +I+ +KK+WEE
Sbjct: 1477 ELIDHSNKLLAEKEAEIKEKYEKQR---LEDK-AELEKSLASSESLKSSDIENLKKEWEE 1532

Query: 1551 EYEQKTSQRIRESNEQLKKRIRLPTEEKINKIVEKKRLELEAEFEANVQKKAEEIXXXXX 1610
            EYEQ+T +RI E+NE L+KRIRLPTEEKINKI+E ++ EL+ EFEA +Q++  E+     
Sbjct: 1533 EYEQRTIKRIEEANEILRKRIRLPTEEKINKIIENRKRELDEEFEAKLQQRTSEL-AGEK 1591

Query: 1611 XXXXXXTEVLEKHKQDLENLKQEMQKKFDEDIAQIKKRAFEEGKQQASMKSTFLEKKIAK 1670
                  TEV+++HKQ++E LK +M+++ DE++AQ KK+AF+EGKQQASMKS FLEKKIAK
Sbjct: 1592 PLPATFTEVMKRHKQEVEKLKADMKREMDEEVAQAKKKAFDEGKQQASMKSMFLEKKIAK 1651

Query: 1671 LETQIKAHDSAIPINDNSSATPAESGPTTQDVKQL---TPI--LNNQ------AAILPGK 1719
            LE Q KA          ++  P ++   + D KQL   +PI  +++Q      A  L   
Sbjct: 1652 LEAQAKA----------AAEKPDDTTVNSPDRKQLDKPSPIAEISHQEDKTHIAEELAEG 1701

Query: 1720 PLPFNPAHFAFGMPFGQTTSNSFQNPFNSQPPEQTPNSPKRPSEEPVGGSPEKKPKEND 1778
            P P   +        G+   NS   P N         S KRPSE  +  SP+ K  ++D
Sbjct: 1702 PRPITTSPIPPSSS-GELIDNSSVEPSNDAND---SVSTKRPSEVSLEESPDSKKHKSD 1756

>KLTH0E01056g Chr5 complement(99471..104786) [5316 bp, 1771 aa] {ON}
            similar to uniprot|Q02455 Saccharomyces cerevisiae
            YKR095W MLP1 Myosin-like protein associated with the
            nuclear envelope, connects the nuclear pore complex with
            the nuclear interior; involved in the Tel1p pathway that
            controls telomere length; involved in the retention of
            unspliced mRNAs in the nucleus
          Length = 1771

 Score = 1167 bits (3018), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 742/1748 (42%), Positives = 1091/1748 (62%), Gaps = 54/1748 (3%)

Query: 24   FLELDASKVSTLDPAVVRQLSIKANQFGQLKAQNLKYSVTLDELKSSSERRSEAFKLQLE 83
            FL ++++++  +D  VV  ++ KA +F QL+A+NL+ SVT+DEL+SSSER+  A K Q+ 
Sbjct: 22   FLGIESNELLAVDGGVVVNIAAKAREFQQLQAENLRTSVTVDELRSSSERKLGACKDQVH 81

Query: 84   KINENTESLRXXXXXXXXXXXXLIDEKANASKEVNLLKSQLTELKQQNEIFRSSKQDVVQ 143
             + +  ESLR            L  EK  A  +   L+ +   L+QQ +   SSK DV +
Sbjct: 82   LLLQELESLRGESAQFEKMKLELTSEKQRALNDSETLRVRKEALEQQKQALESSKNDVAR 141

Query: 144  LLNEKIGDLEASQDEAKQLLQNTKTLRKQVLELENEVQTFKSNDLRGKAEMQRLTQEMNL 203
            LLNEKI +L + + EA  L+Q  + LR+Q L+LE+E +  KS DL+ KAE+ RL+QE++L
Sbjct: 142  LLNEKISELSSFKQEADDLMQENRRLRQQTLDLESESRVSKSEDLQRKAELHRLSQELSL 201

Query: 204  LKSNNQWLEKELASKSEEFGSYRQRVNSELQTALSELNXXXXXXXXXXXXXQTLKSRAND 263
             +SN++WLE +L  K+ EF +YR    S+L     +L              ++L+     
Sbjct: 202  CRSNSEWLESQLGQKNAEFNAYRHTTQSQLAALTQKLETLEQELQASTRTNKSLREHNAR 261

Query: 264  LSQQLQDKMTELKSLRDSSSIEKQEFTREMTLKQRLIDLLEKQIESFKTELESARNKSVS 323
            ++  L+ ++  +K L D+ + EKQEFTREM+LK+RL+DLLE Q++S K++LE        
Sbjct: 262  ITNDLETQLRNVKKLTDNLNSEKQEFTREMSLKERLVDLLEGQVQSLKSDLELRSTAGEG 321

Query: 324  NSDHVDAERXXXXXXXXXXXXXXXXXXXXAVKLEETVDELLSTDGERGAGNTSKVSLDSK 383
            +                              KLE+TV +L+STD E    +  K S    
Sbjct: 322  DDGSFSNPLNALSEELAQKTQQLEESEFKVQKLEQTVQDLVSTDKE----SRLKSSAHEY 377

Query: 384  NSIVPKLHGDIGLLKKRLIQERRQKEQLQYQVEAFVLELEHKVPVLNSFKERTEMLEKEL 443
             + V  L+GDI LLK+++I E+RQKE LQ QVEAFV+ELE KVP+L+SFK+R +MLE++L
Sbjct: 378  PASVTDLYGDISLLKRQVIHEKRQKEHLQNQVEAFVVELESKVPMLSSFKDRNDMLEEQL 437

Query: 444  SDVALMLEATSKDKEEKEHELTSVKSKIADYETQIHSLVRQRSDLAHQVQHLLIQVSVRN 503
            ++ A MLE+ SKDKE    +L   K++I D+E QI  L RQRSDLA QVQ+LLIQ SVR+
Sbjct: 438  AETAYMLESISKDKESVALDLRRTKAQIHDFEIQISELTRQRSDLARQVQYLLIQASVRS 497

Query: 504  DSNGPLTPEETNFIKKIINSSESPVEQDAQRIISERLVRFESMVELQEKNMELLNSIRNL 563
            DS GPLT EE  F+++I+   +  +E+D Q++ISERLV F  +VELQ KN +LL +IRNL
Sbjct: 498  DSKGPLTTEEIAFVRRILEQGDLSLERDTQKVISERLVEFRDIVELQSKNSDLLRTIRNL 557

Query: 564  ADKLXXXXXXXXXXXXXXXXXXXXXXXXXILTLQEYNKSLESQLEIIAKERDAFKILASD 623
            ADKL                         I+TLQE+ + LES++E++ KERDA+K +   
Sbjct: 558  ADKLESEEEQSKMRSKTVENDAIREAKEAIITLQEHAQELESRIEVLTKERDAYKAIQ-- 615

Query: 624  KGTSNGPSNVNSSENRHLVLAEEK------IKELENHLSSLTEESAKNIKLLNEEIHSLY 677
                  PS  N ++     LA  K      + +LE  L +  EE+ KN+K+LN EI  L 
Sbjct: 616  ------PSTNNGNKITEHALANSKGKMSARVDDLERSLVTEREEAEKNMKMLNSEIQELL 669

Query: 678  RAQADTSVNLEKERSSRILAEDRSKLISNTLEMTKMENDELRKRFHSLQENILKQDSKTQ 737
            R +   ++ +EKER+S+ LAE+R K+   +L++TK EN+EL KR+H +Q+N+LKQD+KTQ
Sbjct: 670  RQKTKLAIEIEKERTSKCLAEERLKVSQGSLKLTKQENEELNKRYHIIQDNLLKQDTKTQ 729

Query: 738  QTIESLISCKXXXXXXXXXXXXXXXERDLLRSIQENLKKENESLSEERNNMRILITQLQT 797
            +T+  LI C+               + + L S Q+   +  E L+ ERNN+ IL+TQLQT
Sbjct: 730  ETLSCLIECQSKLATLESELKSSVAKIESLSSCQKKNTESIEQLTAERNNLTILVTQLQT 789

Query: 798  LQTERESLLEETQKNFQGKTNKLETELSDTLEKLDAKSKEISDYISTKDSQEKWYQEKFD 857
            LQ ER+ LL ET+K+++ K + LE E S    +L  K +E +D+I T DS+ +WYQEK D
Sbjct: 790  LQGERDKLLAETEKSYKEKVDALEVEASQLRTQLSRKDEEFNDFIQTNDSRSQWYQEKID 849

Query: 858  RLNEELNNSREKLSSKLTDIQHLELKVESLNNKLEESEARIQAFNALNYSESVESQTETL 917
             LNE L     +L S+    + LE + + L  +L+E E + Q+++ LN ++ V +QTE L
Sbjct: 850  SLNETLKVVTSQLESQAQTTRDLESQKKLLEGRLKEVETKAQSYDVLNQTDDVLAQTEAL 909

Query: 918  RQELEKTRIKLADAYSQVEQYKSMADSSEESATAIKDALEQSKAEYTEKIETLTKERDMF 977
            R ELEK++IKL DAYSQ+E+++S   S+EE+ +AI +A E+ K E+++    + K+ D  
Sbjct: 910  RMELEKSKIKLQDAYSQIEEHRSRYKSAEEALSAITNAFERFKNEHSKDFGNMKKKEDEL 969

Query: 978  KDQVPILKDQISNLNNELNHQKSQFESQISDYTRNLEDLKAKQSELDNMKAEYEQKISKI 1037
              QV  LK QISNLNNEL HQK QF+S+ ++    L  L++ Q  +++MK  YEQ++ K+
Sbjct: 970  VGQVEALKHQISNLNNELGHQKKQFDSEKNELENQLVSLQSTQETMNSMKEHYEQQLGKL 1029

Query: 1038 QEDLNQQTSYANTAQKNYEQELQKHADVSKKISLLRAEAQKYKSETETLRNAAENAKKAL 1097
             +DLNQQ ++AN AQ+NYEQELQ+HADVSK IS LR E+QKYK++   L+++ E  +K L
Sbjct: 1030 TQDLNQQAAFANKAQENYEQELQRHADVSKTISQLREESQKYKNQASVLQSSIEQLEKTL 1089

Query: 1098 EQSELSWEKQSSDYEDELRLAHQRIEDLNAQSKILYDQIDFLSKGKPTSSEDLMPISTET 1157
            ++S+  W  Q  +YE +LR  +QRIEDL  Q+ +L DQ+D  +K  P S         + 
Sbjct: 1090 DESDGKWLNQKEEYEAQLRSLNQRIEDLTVQNGLLLDQLDLEAKD-PNSELGQSEPQEKV 1148

Query: 1158 RNLLTSLRREKDILETKLEVSTREEKVLRQKLKLIESDLEGSRIELSKLQRAASGNSATL 1217
            R L+TSLRRE+DIL+TKLEVS R E V  +KL+ IE +L  ++ ELS LQ  +S NS   
Sbjct: 1149 RELITSLRRERDILQTKLEVSKRSETVSLRKLEAIEQELSFAKEELSSLQALSSQNSIMA 1208

Query: 1218 KDQEEIMTQLNQLNLLRESNITLRNEAQKNGERSRELKAELDALYGKVQPLESKVTLLQN 1277
             +  +++ QLNQLNLLRESNITLR+E QK  +R +EL+ ++D L   +QPLES++  L+ 
Sbjct: 1209 DEHNKLLEQLNQLNLLRESNITLRSEVQKKTQRCQELEGQIDNLQQSLQPLESELASLKR 1268

Query: 1278 SVREKDLQISLKNEEAERWKQRSQDILHKYERIDPEEHQKLADKVSELQQEIKSKSDENE 1337
            SVR KD QISL +EE  RWKQRSQDIL K+ERIDPEEH+KL +++S+ + E+ +K+D+N 
Sbjct: 1269 SVRAKDSQISLISEETNRWKQRSQDILSKFERIDPEEHKKLGEELSQAKAELAAKADQNS 1328

Query: 1338 ELDTRFKRLKQQAHEKLNAAKTAQSTLTSQLNDLKATKEKLENDLGSQKEEVKNLESKIT 1397
            EL+ RF+RLK+QA E+L+AAK  Q+ L+ +L   +  +  +E  L  +++  K L+  + 
Sbjct: 1329 ELEDRFQRLKKQARERLDAAKAVQNNLSVELAQAREAQSNMELQLRKEQDVNKALQESLQ 1388

Query: 1398 DIEKNKSSEKNDLQEQLENSQAKLLETENKLEQVTSSSALLEKELNERIESLMNKIKLLE 1457
             +E    ++ +  Q +LE++  KL + E K + + S  A +EK L   +E + +  + LE
Sbjct: 1389 RVESEAKAD-STTQPELESALQKLSQAEKKAQDIESDRAQIEKALQSELEKVKSHAEELE 1447

Query: 1458 EDLEKAKTESPNDGSQSSELVENTSKIVENLKIEFEEEKAKMISDKESELREQFEE---- 1513
              L++A+ E  +          ++S++ E +K + EE    +I++KE+E+R  +EE    
Sbjct: 1448 RRLDEARREVESLEEVKQGAFTDSSEL-EKMKRDLEEHSNTLIAEKEAEIRSHYEELRLK 1506

Query: 1514 EKASILEAKEQELREQLATQKLDPPVNIDEIKKKWEEEYEQKTSQRIRESNEQLKKRIRL 1573
            EKA+     E+EL E         PV+I+ +KK+WEE+YEQKT +RI ESNE L+KRIRL
Sbjct: 1507 EKATY----EKELEENGK----HTPVDIETLKKQWEEDYEQKTIKRIEESNEILRKRIRL 1558

Query: 1574 PTEEKINKIVEKKRLELEAEFEANVQKKAEEIXXXXXXXXXXXTEVLEKHKQDLENLKQE 1633
            PTEEKINKIVE ++ ELE EFEA +QK+A E+           TEV+++HKQ++E LK +
Sbjct: 1559 PTEEKINKIVETRKSELEQEFEAKLQKRASEL-ANEKPQPASFTEVMKRHKQEMEKLKAD 1617

Query: 1634 MQKKFDEDIAQIKKRAFEEGKQQASMKSTFLEKKIAKLETQIKAHDS-AIPINDNSSATP 1692
            + ++ DE++AQ++K+AF+EGKQQASMKS FLEKKIAKLE Q+KA  + A+P     SA  
Sbjct: 1618 LTREMDEEMAQVRKKAFDEGKQQASMKSMFLEKKIAKLEAQVKASGTEAVP-----SAPT 1672

Query: 1693 AESGPTTQDVKQL--TPILNNQAAILPGK-PLPFNPAHFAFGMPFGQTTSNSFQNPFNSQ 1749
            +++ PT + V+ L  +P+ +  +   P K  LP          P           P  SQ
Sbjct: 1673 SKNSPTEKPVRILEASPLEDALSRNDPNKESLPIKKISLPSLTP----------EPQQSQ 1722

Query: 1750 PPEQTPNS 1757
             PE+ PN 
Sbjct: 1723 -PEEAPNG 1729

>KLLA0A00594g Chr1 complement(53304..58550) [5247 bp, 1748 aa] {ON}
            similar to uniprot|Q02455 Saccharomyces cerevisiae
            YKR095W MLP1 Myosin-like protein associated with the
            nuclear envelope connects the nuclear pore complex with
            the nuclear interior involved in the Tel1p pathway that
            controls telomere length involved in the retention of
            unspliced mRNAs in the nucleus
          Length = 1748

 Score = 1068 bits (2762), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 682/1803 (37%), Positives = 1099/1803 (60%), Gaps = 116/1803 (6%)

Query: 21   ISSFLELDASKVSTLDPAVVRQLSIKANQFGQLKAQNLKYSVTLDELKSSSERRSEAFKL 80
            ++ FL++D   +  ++  V+ ++  K     + K++NL+ + TLD+LKS SE + E+FK+
Sbjct: 10   VADFLQVDQQLIQDINNDVLGRIEEKLEDLRKQKSENLRITATLDQLKSQSENKLESFKI 69

Query: 81   QLEKINENTESLRXXXXXXXXXXXXLIDEKANASKEVNLLKSQLTELKQQNEIFRSSKQD 140
             + ++ +  E  +            LI+  +  +K +  L+ ++   +QQ E+  +SKQD
Sbjct: 70   HISQLAKALEDGKDERLHFEEEKRRLIEGNSQVTKRIIELEQEIEVERQQKELADASKQD 129

Query: 141  VVQLLNEKIGDLEASQDEAKQLLQNTKTLRKQVLELENEVQTFKSNDLRGKAEMQRLTQE 200
            + + LNEKI +L +++ +  +     K LR++V+  E E+QT ++ +LR K+E+ R+ QE
Sbjct: 130  IAESLNEKIEELSSTKAKLNEAQGANKELRQKVVNTETELQTQQALELRSKSEILRMEQE 189

Query: 201  MNLLKSNNQWLEKELASKSEEFGSYRQRVNSELQTALSELNXXXXXXXXXXXXXQTLKSR 260
            + LL+ NN WL  +L +K+ +   +R+   SELQ +  +++             Q LK  
Sbjct: 190  ITLLRENNDWLTNQLNTKTVQLNEFRESTISELQDSQLKVSNMESELEIARTSNQKLKQS 249

Query: 261  ANDLSQQLQDKMTELKSLRDSSSIEKQEFTREMTLKQRLIDLLEKQIESFKTELESARNK 320
             + L +QL+ K++E K ++D  +  KQE T+EM+LKQR+ID LEK +ES K E+++ +N 
Sbjct: 250  VHSLHEQLEQKLSENKEIKDEYNFSKQELTKEMSLKQRMIDALEKHMESLKKEMDATKN- 308

Query: 321  SVSNSDHVDAERXXXXXXXXXXXXXXXXXXXXAVKLEETVDELLST----DGERGAGNTS 376
            ++ +S   + ER                     +KL+ET+DEL S     D E   GNT+
Sbjct: 309  NMDSSYFTEKERDELIEELNAVKYRLDASESNCIKLKETIDELTSNIKLEDSE--VGNTT 366

Query: 377  KVSLDSKNSIVPKLHGDIGLLKKRLIQERRQKEQLQYQVEAFVLELEHKVPVLNSFKERT 436
              S +   S++PKL+GD+G+LKK+L+ E+RQK++L+ QVEAFV+ELEHK+PVLNSFKER+
Sbjct: 367  -ASSEKSVSVIPKLYGDLGMLKKQLVIEKRQKDELKMQVEAFVVELEHKIPVLNSFKERS 425

Query: 437  EMLEKELSDVALMLEATSKDKEEKEHELTSVKSKIADYETQIHSLVRQRSDLAHQVQHLL 496
            EMLE+EL++V ++LE+T KD+++K  +L  +K+ +  YETQI SL +QR DLAHQ+Q+LL
Sbjct: 426  EMLERELNEVTILLESTGKDRDQKSSQLDYLKATVKSYETQIASLSKQRVDLAHQIQYLL 485

Query: 497  IQVSVRNDSNGPLTPEETNFIKKIINSSESPVEQDAQRIISERLVRFESMVELQEKNMEL 556
            +  S++++  GPL+ EE  F+K + NS E     D Q II++RLV F S+VELQ+KN EL
Sbjct: 486  VNESIKSEDGGPLSAEELQFVKNLTNSQEITKTSDTQGIITDRLVEFRSVVELQQKNSEL 545

Query: 557  LNSIRNLADKLXXXXXXXXXXXXXXXXXXXXXXXXXILTLQEYNKSLESQLEIIAKERDA 616
            L++IRNLAD+L                         ILTL ++ ++LE+QL I++KERDA
Sbjct: 546  LSTIRNLADELERREAENKSQIQVLEDETVREAKETILTLHDHAQNLENQLVILSKERDA 605

Query: 617  FKILASDKGT-SNGPSNVN--SSENRHLVLAEEKIKELENHLSSLTEESAKNIKLLNEEI 673
            +K L+ +  + +N P  +   S +N      ++K+K+LE  L+++ +E+  N K  + E 
Sbjct: 606  YKALSVNASSGTNTPKAITYPSPDN------DDKVKDLETRLTAVIQEAENNAKEWSSEN 659

Query: 674  HSLYRAQADTSVNLEKERSSRILAEDRSKLISNTLEMTKMENDELRKRFHSLQENILKQD 733
             +L +   + S+N E E++SR LAEDR  L+ +TLE++K + +EL+KR   LQ+ + KQD
Sbjct: 660  SNLRKKLYEISLNFESEKTSRTLAEDRLNLLQSTLELSKRQCEELQKRSSDLQDILTKQD 719

Query: 734  SKTQQTIESLISCKXXXXXXXXXXXXXXXERDLLRSIQENLKKENESLSEERNNMRILIT 793
             +TQ+T++SLI  K               E+  +  +Q+ LK ENE  S+E    ++LI 
Sbjct: 720  KRTQETVDSLIKTKSTLSSIQSELSILKSEKQFMAKVQKELKAENERFSKESVEYKVLIA 779

Query: 794  QLQTLQTERESLLEETQKNFQGKTNKLETELSDTLEKLDAKSKEISDYISTKDSQEKWYQ 853
            QLQTLQ ERE LL+ETQ +++ K  KLE ELS +LE+L+   K  +   S K+ Q  W+Q
Sbjct: 780  QLQTLQREREMLLKETQNSYKEKLRKLEIELSGSLERLEEIEKNTTGIASNKEHQYNWFQ 839

Query: 854  EKFDRLNEELNNSREKLSSKLTDIQHLELKVESLNNKLEESEARIQAFNALNYSESVESQ 913
            EK D+L  E    +  L  K   +Q ++  +   + KL+E+EAR Q++  L+  +  ++ 
Sbjct: 840  EKIDKLTSEAAQQKTTLEEKEAQLQKMQSTINEQSAKLKEAEARAQSYTMLSNVDDAQNL 899

Query: 914  TETLRQELEKTRIKLADAYSQVEQYKSMADSSEESATAIKDALEQSKAEYTEKIETLTKE 973
             ETLRQELEK  ++L+D+YSQ+E +K++A+ S +S   +  A E+++ E  + I TL  E
Sbjct: 900  VETLRQELEKVNLQLSDSYSQIEHHKTLAEQSVQSVNEVSQAFEEAQKESQKTIITLENE 959

Query: 974  RDMFKDQVPILKDQISNLNNELNHQKSQFESQISDYTRNLEDLKAKQSELDNMKAEYEQK 1033
            R+  +  V IL DQ+ +LNNE+ HQKS+++++ +     +  L+  +  +D  KA+YE+K
Sbjct: 960  RNQLQSTVNILNDQVKDLNNEIFHQKSEYQTERNATMEEISKLQMVKESVDRTKADYEEK 1019

Query: 1034 ISKIQEDLNQQTSYANTAQKNYEQELQKHADVSKKISLLRAEAQKYKSETETLRNAAENA 1093
            I+ IQ+DL  QT YAN +Q++YE ELQKHADVSK I+ LR EAQ YKS+ ETL+  ++ A
Sbjct: 1020 IAMIQKDLEMQTQYANESQRSYELELQKHADVSKTITSLRTEAQSYKSDLETLKTQSQLA 1079

Query: 1094 KKALEQSELSWEKQSSDYEDELRLAHQRIEDLNAQSKILYDQIDFLSKGKPTSSEDLMPI 1153
             + L+ SE  W +Q ++YED+L +  QR+++L+ Q+K+LYDQI+ L+K +   +      
Sbjct: 1080 MENLKNSEKLWNEQKTEYEDKLSVLEQRVQELSTQNKLLYDQIELLNKTEDRDN------ 1133

Query: 1154 STETRNLLTSLRREKDILETKLEVSTREEKVLRQKLKLIESDLEGSRIELSKLQRAASGN 1213
            S ++ +LL SLRRE+D+LETKLEV+  E+ VL+Q+L + +S++E    +LS+++ ++S +
Sbjct: 1134 SHDSSDLLISLRRERDMLETKLEVALSEQTVLKQRLDIAKSEIEDLNTQLSQVKNSSSES 1193

Query: 1214 SATLKDQEEIMTQLNQLNLLRESNITLRNEAQKNGERSRELKAELDALYGKVQPLESKVT 1273
            +  L+ QE IM +L+QL+LLRESN+TLR+E     +    LK++L     ++ PL+S ++
Sbjct: 1194 AHLLEQQENIMKELDQLHLLRESNVTLRSENSSFKKECDNLKSQLQECNDRLAPLQSSIS 1253

Query: 1274 LLQNSVREKDLQISLKNEEAERWKQRSQDILHKYERIDPEEHQKLADKVSELQQEIKSKS 1333
             LQN ++ K+ ++    EEAERWK RSQDILHKYERIDPEEH KL +++++++ E+++  
Sbjct: 1254 SLQNGIKIKEQELIQSKEEAERWKSRSQDILHKYERIDPEEHGKLKEEINDVKNELQTTK 1313

Query: 1334 D-------ENEELDTRFKRLKQQAHEKLNAAKTAQSTLTSQLNDLKATKEKLENDLGSQK 1386
            D       E ++ +++F+R++ QA ++LNA+K  + +L+S++N +   K ++E DLG  K
Sbjct: 1314 DTLQSVIAEKDDWESKFQRIRLQARDRLNASKEKEQSLSSEINQINEAKSQVEADLGKCK 1373

Query: 1387 EEVKNLESKITDI-------EKNKSSEKNDLQEQLENSQAKLLETENKLEQVTSSSALLE 1439
               K LE ++  +       E+  +S+ + LQE L + Q + +E  +K EQ  + S    
Sbjct: 1374 TACKELEERLQVVTQEAETKEQTFNSQLSKLQEDLHSIQVQ-MENASKTEQNNADS---- 1428

Query: 1440 KELNERIESLMNKIKLLEEDLEKAKTESPNDGSQSSE-----LVENTSKIVENLKIEFEE 1494
               +E+I+SL   +++L   +++ + E+ N     +E     + E+T  IV+NLK EFE 
Sbjct: 1429 ---DEKIKSLTETVEMLNSKIQELEAEASNAQKIVAEHHTPVINEDTKSIVDNLKTEFEA 1485

Query: 1495 EKAKMISDKESELREQFEEEKASILEAKEQELREQL--------------ATQKLDPP-- 1538
            EK ++I DKE ELR +FE EK S   ++E+ELR+Q                 Q    P  
Sbjct: 1486 EKEQLIKDKEKELRSKFEAEKESAWNSREEELRKQFEEREKRIREECEKTTVQSPSQPTL 1545

Query: 1539 -VNIDEIKKKWEEEYEQKTSQRIRESNEQLKKRIRLPTEEKINKIVEKKRLELEAEFEAN 1597
             ++ID +K +WE+EYE++T ++I+ + E LKKRIRLPT++KI+KIVE ++  LE  FE  
Sbjct: 1546 DIDIDALKNEWEKEYEKQTLEKIKLAEEALKKRIRLPTQQKIDKIVEARKAVLEESFEEK 1605

Query: 1598 VQKKAEEIXXXXXXXXXXXTEVLEKHKQDLENLKQEMQKKFDEDIAQIKKRAFEEGKQQA 1657
            V +KA+++              LEKH+ +L  LK  M+K+F+ D+A+IK+++FEEGKQQ 
Sbjct: 1606 VNEKAQKLAGEIGNDAI----TLEKHRAELNALKDSMRKQFEADLAEIKQKSFEEGKQQV 1661

Query: 1658 SMKSTFLEKKIAKLETQIKAHDSAIPINDNSSATPAESGPTTQDVKQLTPILNNQAAILP 1717
            S+K  FLE KI  LE Q             S+  P E+  +            N +A   
Sbjct: 1662 SLKLKFLESKIRNLEQQ------------KSTIKPVENDTS------------NMSA--- 1694

Query: 1718 GKPLPFNPAHFAFGMP-FGQTTSNSFQNPFNSQPPEQTPNSPKRPSEEPVGGSPEKKPKE 1776
                       AF  P FG  + ++F +PF++   E +PN  KRP ++     PEK+ KE
Sbjct: 1695 -----------AFQAPVFG--SHSTFTSPFST--SEISPN--KRPIDDTATEQPEKRHKE 1737

Query: 1777 NDS 1779
             +S
Sbjct: 1738 PES 1740

>ZYRO0G06600g Chr7 complement(521893..527355) [5463 bp, 1820 aa] {ON}
            some similarities with uniprot|Q02455 Saccharomyces
            cerevisiae YKR095W MLP1 Myosin-like protein associated
            with the nuclear envelope, connects the nuclear pore
            complex with the nuclear interior; involved in the Tel1p
            pathway that controls telomere length; involved in the
            retention of unspliced mRNAs in the nucleus
          Length = 1820

 Score = 1058 bits (2737), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 699/1796 (38%), Positives = 1093/1796 (60%), Gaps = 70/1796 (3%)

Query: 5    NSPTTPSVIGEIDVTTISSFLELDASKVSTLDPAVVRQLSIKANQFGQLKAQNLKYSVTL 64
            N  T+     ++ +  +S+F  +   ++  +D  ++  L  K   F +LK+QNL+ +VT+
Sbjct: 10   NIVTSGDNHNDVSLGKLSAFYGVPEDQLVLIDGGILTILENKVLDFNELKSQNLRLNVTI 69

Query: 65   DELKSSSERRSEAFKLQLEKINENTESLRXXXXXXXXXXXXLIDEKANASKEVNLLKSQL 124
            DE+K+ S +R E  K ++E + ++ +S+R               +K     EV  L+ +L
Sbjct: 70   DEIKTVSSKREEGLKNEIENLMKDNDSIRLERSQAQEESTQSSRDKQKIQNEVESLQEKL 129

Query: 125  TELKQQNEIFRSSKQDVVQLLNEKIGDLEASQDEAKQLLQNTKTLRKQVLELENEVQTFK 184
            ++L Q+ E  +  K++VV +L EKI +LE+ + E+++ L ++K LR+QVLELE  VQ  K
Sbjct: 130  SDLDQERETLKQDKREVVAVLEEKIKELESFRTESRKSLDDSKRLRQQVLELETTVQNLK 189

Query: 185  SNDLRGKAEMQRLTQEMNLLKSNNQWLEKELASKSEEFGSYRQRVNSELQTALSELNXXX 244
            S +LR ++E+Q +TQ + +L+ N+QWLE+E+ SK+E+  S R++ + EL    SE     
Sbjct: 190  SKELRDQSEIQTITQRLTILQKNSQWLEEEVTSKTEQLISTRRKNDDELDRLTSESLSCK 249

Query: 245  XXXXXXXXXXQTLKSRANDLSQQLQDKMTELKSLRDSSSIEKQEFTREMTLKQRLIDLLE 304
                      Q + ++  +L++ LQ+K+ E+K L DS   EKQEF  EM++KQ+LIDLLE
Sbjct: 250  NELQLEKSRNQVITTKNEELTKSLQEKLMEMKDLSDSLYREKQEFAHEMSMKQKLIDLLE 309

Query: 305  KQIESFKTELESARNKS---VSNSDHVDAERXXXXXXXXXXXXXXXXXXXXAVKLEETVD 361
             Q++S + EL ++ +K    +  S   + E                      ++LE  V 
Sbjct: 310  NQVKSLQGELNASLDKDNVELLASGERNTENEKLIQELITLKENFEESERERLRLEALVQ 369

Query: 362  ELL-STDGERGAGNTSK-VSLDSKNSIVPKLHGDIGLLKKRLIQERRQKEQLQYQVEAFV 419
            EL+   D +    NTS  +SL +K+S +     D+G+LKK LI+ER QKE+LQ QVE+F+
Sbjct: 370  ELIPGDDSQDDINNTSSFISLRNKDSSLR----DMGILKKELIKERHQKERLQRQVESFI 425

Query: 420  LELEHKVPVLNSFKERTEMLEKELSDVALMLEATSKDKEEKEHELTSVKSKIADYETQIH 479
            +ELE+K+PV+NSFKERT MLEKEL+DVAL+L+ TS +KE++E E  ++  K+ D E+ IH
Sbjct: 426  VELEYKIPVINSFKERTSMLEKELNDVALLLDHTSNEKEKREREFEALSKKVKDSESSIH 485

Query: 480  SLVRQRSDLAHQVQHLLIQVSVRNDSNGPLTPEETNFIKKIINSSESPVEQDAQRIISER 539
            +L RQR+DLAHQVQ LL+ +SV+ DS G L+ EE +FIK+I+N+ +   E D+QR+ISER
Sbjct: 486  TLTRQRTDLAHQVQFLLMNISVQVDSGGLLSAEEVSFIKRIVNNDDPNSESDSQRVISER 545

Query: 540  LVRFESMVELQEKNMELLNSIRNLADKLXXXXXXXXXXXXXXXXXXXXXXXXXILTLQEY 599
            LV F ++  LQEKNMELL ++R LA+KL                         I++LQ+Y
Sbjct: 546  LVEFNNIATLQEKNMELLKTVRKLAEKLESEEKDVNKKIQTFENDTIKEAKEAIVSLQDY 605

Query: 600  NKSLESQLEIIAKERDAFKILASDKGTS-NGPSNVNSSE-NRHLVLAEEKIKELENHLSS 657
            N +LES++EI+ KE DAFK + S  G+  NG  + N ++ NR+    EEK++ LE  L+S
Sbjct: 606  NANLESKVEILTKECDAFKAICSRNGSDQNGSLSANGTQGNRNGSSDEEKLRTLEARLTS 665

Query: 658  LTEESAKNIKLLNEEIHSLYRAQADTSVNLEKERSSRILAEDRSKLISNTLEMTKMENDE 717
            LT ES++N K+LN EIH LYR++   S+ LEKERSS+ L E+R KLI +TLE+T+ EN +
Sbjct: 666  LTVESSQNNKMLNNEIHELYRSKTQISIELEKERSSKTLTEERLKLIQHTLELTRNENQQ 725

Query: 718  LRKRFHSLQENILKQDSKTQQTIESLISCKXXXXXXXXXXXXXXXERDLLRSIQENLKKE 777
            L KR  +LQ    +QDS+T +T+  LI+C                E++LL+S +   ++ 
Sbjct: 726  LVKRSQNLQSIFDRQDSRTAETVNELIACNSKLAVLETKVANLETEKELLQSSERTSREN 785

Query: 778  NESLSEERNNMRILITQLQTLQTERESLLEETQKNFQGKTNKLETELSDTLEKLDAKSKE 837
               LSEERN++RI+++QLQTLQ+ERE  L+E Q  ++   + LE E +D   +LDAK+KE
Sbjct: 786  YLKLSEERNSLRIMVSQLQTLQSEREKFLKEIQTTYKENLDSLEQEKADARARLDAKTKE 845

Query: 838  ISDYISTKDSQEKWYQEKFDRLNEELNNSREKLSSKLTDIQHLELKVESLNNKLEESEAR 897
              D  ++K +Q +WYQ+K D +  E  + +++L +K   +  LE +V  L  ++EESEAR
Sbjct: 846  AEDMENSKRTQIQWYQDKLDSVVAESQHLKQELQTKTFLVTDLESEVRKLEKQVEESEAR 905

Query: 898  IQAFNALNYSESVESQTETLRQELEKTRIKLADAYSQVEQYKSMADSSEESATAIKDALE 957
            IQ++  L+ SE   S   +LR+ELEKT+I L+D Y++++QYK++  ++EES + +     
Sbjct: 906  IQSYQVLSGSEVETSPESSLRKELEKTKINLSDTYAEIDQYKNLLSTTEESLSQLTQDYA 965

Query: 958  QSKAEYTEKIETLTKERDMFKDQVPILKDQISNLNNELNHQKSQFESQISDYTRNLEDLK 1017
              K E   ++ETL  E+   +D V  L + ++ L   L       E++ +   + +  L+
Sbjct: 966  SGKQELQLQVETLQNEKSQLQDVVAKLNESVTKLEESLQDANKAAENEKNTLQKKIATLE 1025

Query: 1018 AKQSELDNMKAEYEQKISKIQEDLNQQTSYANTAQKNYEQELQKHADVSKKISLLRAEAQ 1077
             +      +K EY+ +I K+Q DL QQ S+AN AQ+NYE+ELQK ++VSK IS LR ++Q
Sbjct: 1026 TESKGSHQLKEEYDAQILKLQRDLEQQASFANRAQRNYEEELQKDSNVSKTISELREQSQ 1085

Query: 1078 KYKSETETLRNAAENAKKALEQSELSWEKQSSDYEDELRLAHQRIEDLNAQSKILYDQID 1137
            K +     L+N+ E  ++ LEQ+E SW  Q  +YE +L  + Q +EDL+ Q+ +LYDQI+
Sbjct: 1086 KDRIAITRLKNSEEQVRQVLEQNEKSWSAQKEEYERQLETSRQHLEDLSTQNSLLYDQIE 1145

Query: 1138 FLSKGKPTSSEDLMPISTETRNLLTSLRREKDILETKLEVSTREEKVLRQKLKLIESDLE 1197
              SK    +S+ +   + E R +LT+LRRE+DIL TKL VS REE+ LR  L  +E++L+
Sbjct: 1146 LFSKD---NSDGVNGETAEVREILTNLRRERDILGTKLTVSQREEQTLRGSLASVENELD 1202

Query: 1198 GSRIELSKLQRAASGNSATLKDQEEIMTQLNQLNLLRESNITLRNEAQKNGERSRELKAE 1257
             ++ +LS+ Q+  + +S  +   E+I+ QLNQLNLLRESNITLRN A++  +++REL+ E
Sbjct: 1203 TTKRQLSQFQKEITTHSELIGQHEKIIEQLNQLNLLRESNITLRNAAEEENKKNRELQEE 1262

Query: 1258 LDALYGKVQPLESKVTLLQNSVREKDLQISLKNEEAERWKQRSQDILHKYERIDPEEHQK 1317
            L+ L  ++ PLES++  L  SV EKD Q++L  EEA RWK+RSQ+ILHK++RIDPE+H++
Sbjct: 1263 LNQLRERILPLESELNTLHTSVLEKDQQLNLYKEEANRWKERSQEILHKHDRIDPEDHKE 1322

Query: 1318 LADKVSELQQEIKSKSDENEELDTRFKRLKQQAHEKLNAAKTAQSTLTSQLNDLKATKEK 1377
            L +KVS L+ ++   + EN+ELD RF RLK+QAHEKLN++K AQ+TL++QLN+L+  K +
Sbjct: 1323 LKEKVSILETKLDETNKENKELDDRFNRLKKQAHEKLNSSKIAQTTLSNQLNELREAKSE 1382

Query: 1378 LENDLGSQKEEVKNLESKI----TDIEKNKSSEKNDLQEQLENSQAKLLETENKLEQVTS 1433
            LE    +++ +V  L+ ++     D E  +S +K +L + LE+S+    E E  L     
Sbjct: 1383 LEGKFEAEERKVHELQERLNAHGNDTETVESVQK-ELSDALEHSR----ELEQNLSATLQ 1437

Query: 1434 SSALLEKELNERIESLMNKIKLLEEDLEKAKTESPNDGSQSSELVENTSKIVENLKIEFE 1493
             +  + K+LN+ I+SL  ++  L+E          +  +   E+ E+ S +VE+++  FE
Sbjct: 1438 QNEEITKKLNDEIDSLKLELHSLKE---------QSAATAKGEISEDLSNVVESMRRSFE 1488

Query: 1494 EEKAKMISDKESELREQFEEEKASILEAKEQELREQLATQKLDPPVNIDEIKKKWEEEYE 1553
            EEK   + +K      +  EE+   L+    E ++Q        PVN +EIK++WE E E
Sbjct: 1489 EEKINFLKEKTE--ELKKLEEEKHTLQVNGNEPQQQ--------PVNYEEIKRQWESEQE 1538

Query: 1554 QKTSQRIRESNEQLKKRIRLPTEEKINKIVEKKRLELEAEFEANVQKKAEEIXXXXXXXX 1613
            +   +RI E+ E LKKRIRLPTEE+I ++VEKK+  L            EE+        
Sbjct: 1539 ESILKRIAEAEENLKKRIRLPTEERIKQVVEKKKAAL------------EELYKKKLEES 1586

Query: 1614 XXXTEVLEKHKQDL-ENLKQEMQKKFDEDIAQIKKRAFEEGKQQASMKSTFLEKKIAKLE 1672
                E  + +  DL + L++++Q+KF+ ++  +KK+AFEEGKQQA+MKST LE+KI+KLE
Sbjct: 1587 KSSLESSDGNNSDLKKQLEKDLQEKFEAEVQAVKKKAFEEGKQQAAMKSTLLERKISKLE 1646

Query: 1673 TQIKAH-DSAIPINDNSSATPAESGPTTQDVKQLT-------PILNNQAAIL--PGKPLP 1722
            +Q+    DS    +  +S+ P  + P+  D K +T       P+++ +  +   P KP  
Sbjct: 1647 SQLHGKVDSPDKSSSETSSVPKPNLPSKIDEKSVTTNQSVPNPLVSGEKVLKLDPSKP-T 1705

Query: 1723 FNPAHFAFGMPFGQTTSNS---FQNPFNSQPPEQTPNSPKRPSEEPV-GGSPEKKP 1774
            FN + F+ G PF  +  N+     + F  +P     N+  + S   +   S E KP
Sbjct: 1706 FNFSSFSGGNPFTSSPQNNDTMGTSAFGFKPTFTLSNNSNKSSGTKIDSSSTENKP 1761

>TDEL0B02190 Chr2 complement(389562..394994) [5433 bp, 1810 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1810

 Score = 1055 bits (2727), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 703/1794 (39%), Positives = 1083/1794 (60%), Gaps = 100/1794 (5%)

Query: 21   ISSFLEL--DASKVSTLDPAVVRQLSIKANQFGQLKAQNLKYSVTLDELKSSSERRSEAF 78
            I+ FL +  D  K    D  +   L  K  +F  L++ NL+   T+DELK+    + ++ 
Sbjct: 20   IAGFLGISDDELKPVLADHVLSDCLVNKLQEFNNLQSNNLRLHATVDELKALCTSKVDSL 79

Query: 79   KLQLEKINENTESLRXXXXXXXXXXXXLIDEKANASKEVNLLKSQLTELKQQNEIFRSSK 138
            K + E++    ++ +            L  EK  A  ++  +K +L    +Q  + +S+K
Sbjct: 80   KKETERLIRENDTEKQRRNRLEEQVSQLTKEKTLALGQMENVKFELQNTIEQKNVLKSNK 139

Query: 139  QDVVQLLNEKIGDLEASQDEAKQLLQNTKTLRKQVLELENEVQTFKSNDLRGKAEMQRLT 198
            Q+VV+LL EKI +LEAS+ E+++L+ + K LR+Q++E +NEVQT K N L  K+E++ + 
Sbjct: 140  QEVVKLLEEKISELEASKVESQELVNDNKNLRQQLMETQNEVQTLKCNGLGDKSELEIVK 199

Query: 199  QEMNLLKSNNQWLEKELASKSEEFGSYRQRVNSELQTALSELNXXXXXXXXXXXXXQTLK 258
            Q++ +L  +N+WLEKE+ SK+E+   YRQ  ++ELQ +L E+              + L 
Sbjct: 200  QQVGMLTKSNEWLEKEVTSKTEQLIKYRQENDTELQKSLQEVARLKNDYQLEKSSREFLL 259

Query: 259  SRANDLSQQLQDKMTELKSLRDSSSIEKQEFTREMTLKQRLIDLLEKQIESFKTELESAR 318
             +  ++SQ LQ+K+ E+K L D  + EKQEF+REM+LKQ+L+DL ++Q++SFK EL    
Sbjct: 260  KKNQEISQDLQNKLYEIKKLSDELNTEKQEFSREMSLKQKLLDLQDEQLQSFKEELRLTE 319

Query: 319  NKSVSNSDHVD----AERXXXXXXXXXXXXXXXXXXXXAVKLEETVDELLSTDGERGAGN 374
             K   NS   D     ++                     ++L+  V+E++        G+
Sbjct: 320  EKH--NSTEADNLQSTQQARFMDDLAQVRQQLEESNHERLRLQAVVNEVM--------GD 369

Query: 375  TSKVSLDSKNSI-VPKLHGDIGLLKKRLIQERRQKEQLQYQVEAFVLELEHKVPVLNSFK 433
            + +  LDS  ++ +PKL+GDIG+LKK+LI+ER QKE LQ Q+E+FV+ELE+KVPV+NS K
Sbjct: 370  SEEFDLDSTANVSIPKLYGDIGVLKKQLIKERHQKENLQRQIESFVVELEYKVPVINSLK 429

Query: 434  ERTEMLEKELSDVALMLEATSKDKEEKEHELTSVKSKIADYETQIHSLVRQRSDLAHQVQ 493
            ER+  LEKELSD+AL+LE TS +KE K  EL S   KI   E   H+L+RQRSDLA QVQ
Sbjct: 430  ERSYTLEKELSDIALLLEHTSHEKERKTRELESATGKIKQLEINTHTLIRQRSDLARQVQ 489

Query: 494  HLLIQVSVRNDSNGPLTPEETNFIKKIINSSESPVEQDAQRIISERLVRFESMVELQEKN 553
             LL   +++NDS GPLT +E  FIKKII +     E D+Q II+ERLV F+ +  LQE+N
Sbjct: 490  FLLFNGTLQNDSRGPLTADEVAFIKKIIENENPSNESDSQSIITERLVEFKDIATLQERN 549

Query: 554  MELLNSIRNLADKLXXXXXXXXXXXXXXXXXXXXXXXXXILTLQEYNKSLESQLEIIAKE 613
             ELL + R LAD+L                         I+TLQE N  +ES++  I KE
Sbjct: 550  TELLKTARTLADRLEEEEKNSNIRIDSLERKTIDEAKEAIITLQERNSEIESKVSTIEKE 609

Query: 614  RDAFKILASDKGTSNGPSNV-------NSSENRHLVLAEEKIKELENHLSSLTEESAKNI 666
            RDA+K + S   TS    N+       +S EN+ L      IK LE+ LS+LT E++KN 
Sbjct: 610  RDAYKAILSQ--TSQSFDNLGDADRMKDSQENQEL------IKSLEDKLSTLTTETSKNN 661

Query: 667  KLLNEEIHSLYRAQADTSVNLEKERSSRILAEDRSKLISNTLEMTKMENDELRKRFHSLQ 726
            +LLN+EI +LY+++   +++ EKERSSR LAEDR KL+ +TLEMTK EN EL +R H LQ
Sbjct: 662  ELLNQEIRNLYQSKTQLTISHEKERSSRTLAEDRLKLLQSTLEMTKNENAELIRRSHELQ 721

Query: 727  ENILKQDSKTQQTIESLISCKXXXXXXXXXXXXXXXERDLLRSIQENLKKENESLSEERN 786
              + KQ+++  +T+   ISC+               E+ LL+S  ++L++E + +S ERN
Sbjct: 722  SILSKQEARNGETVNKYISCQSKLSVLEARAANLDAEKSLLQSSSDSLRREIQKISVERN 781

Query: 787  NMRILITQLQTLQTERESLLEETQKNFQGKTNKLETELSDTLEKLDAKSKEISDYISTKD 846
            ++ +++TQLQTLQ+ERE+LL+E+Q + +    +LE + S+   ++ +K  EI      K 
Sbjct: 782  SLNLMVTQLQTLQSERENLLKESQASHKAAIAQLEVQTSELKTEISSKDNEIKASEDAKR 841

Query: 847  SQEKWYQEKFDRLNEELNNSREKLSSKLTDIQHLELKVESLNNKLEESEARIQAFNALNY 906
            +Q KW+QEK D ++ +    R++L++K   +  LEL+V  L  K+EES++RI ++  LN 
Sbjct: 842  AQTKWFQEKIDEMSSDAGKIRDELATKTATVAQLELEVNDLKKKIEESDSRIASYKTLND 901

Query: 907  SESVESQTETLRQELEKTRIKLADAYSQVEQYKSMADSSEESATAIKDALEQSKAEYTEK 966
            + + E+    LR++LEKT I+L  AYSQ E++K ++ ++EE+   + +  E+        
Sbjct: 902  AGNGETTQGQLRKDLEKTMIELKHAYSQNEEFKQISSTAEETLKNLSNEFEERTEALKSN 961

Query: 967  IETLTKERDMFKDQVPILKDQISNLNNELNHQKSQFESQISDYTRNLEDLKAKQSELDNM 1026
             E    E+   +  V  LK  I  LNNE   QK++ E + ++  + L  L++ +  L  +
Sbjct: 962  AEKYLAEKVQLEQCVSNLKKNIDFLNNEYALQKNRSEEEKNEILKKLVSLESSEHSLGQV 1021

Query: 1027 KAEYEQKISKIQEDLNQQTSYANTAQKNYEQELQKHADVSKKISLLRAEAQKYKSETETL 1086
            K EY+QK+ ++Q+DL QQT+YAN AQKNYE+ELQKHA+VSK IS LR+E Q  +SE + L
Sbjct: 1022 KKEYDQKLYQLQKDLEQQTAYANIAQKNYEEELQKHAEVSKIISQLRSEVQSGRSEIQQL 1081

Query: 1087 RNAAENAKKALEQSELSWEKQSSDYEDELRLAHQRIEDLNAQSKILYDQIDFLSKGKPTS 1146
            + + + AK+ LE  E SW  Q ++ +  +    ++++++++Q+K+L+ Q++ LSK +   
Sbjct: 1082 KASEQQAKEVLENGEKSWYNQKTELDAHIDDLKRQVDNISSQNKLLFSQVELLSKSEREF 1141

Query: 1147 SEDLMPISTETRNLLTSLRREKDILETKLEVSTREEKVLRQKLKLIESDLEGSRIELSKL 1206
               L+P S+E   LL SLRRE+DILETKL VS REEK+L QK   +E +L  +R +L KL
Sbjct: 1142 ENKLLPGSSE---LLISLRRERDILETKLTVSKREEKLLHQKQVALEDELAEARKKLFKL 1198

Query: 1207 QRAASGNSATLKDQEEIMTQLNQLNLLRESNITLRNEAQKNGERSRELKAELDALYGKVQ 1266
            Q   S +S   K  E+IM QLNQ+NLLRESN+TLRN      E++ +L++EL+ L  K+ 
Sbjct: 1199 QENDSNHSDIAKQHEDIMEQLNQMNLLRESNVTLRNAVNAAQEKNSDLQSELNHLQSKIL 1258

Query: 1267 PLESKVTLLQNSVREKDLQISLKNEEAERWKQRSQDILHKYERIDPEEHQKLADKVSELQ 1326
            PL S+++  + S+ EKD +I L  +EA+RWK+RS DIL ++E+IDPEE++KL +++S L+
Sbjct: 1259 PLNSELSECRQSIEEKDQRIILLIDEADRWKERSHDILRRHEKIDPEEYRKLEEEISNLK 1318

Query: 1327 QEIKSKSDENEELDTRFKRLKQQAHEKLNAAKTAQSTLTSQLNDLKATKEKLENDLGSQK 1386
            +E+++KS EN +L+ RF RLK+QAHEKLNA+K AQ+ L++++N+L+ TK K+E  L   +
Sbjct: 1319 KELEAKSKENTDLNDRFTRLKKQAHEKLNASKIAQANLSAEVNELQGTKTKMEEILKETQ 1378

Query: 1387 EEVKNLESKITDIEKNKSSEKNDLQEQLENSQAKLLETENKLEQVTSSSALLEKELNERI 1446
             +V NLE  +T+ + ++S+   DL+ +L+++  +  E E KL +   SS  L  +LNE I
Sbjct: 1379 TKVLNLEKLLTERD-SESANNEDLRHELDDALERCKEIEVKLGETVGSSEGLTSQLNEEI 1437

Query: 1447 ESLMNKIKLLEEDLEKAKTESPNDGSQSSELVENTSKIVENLKIEFEEEKAKMISDKESE 1506
             SL  ++++ +E     + +S  +GSQ        S +VE++K  FEEEK K I +K  E
Sbjct: 1438 NSLKEQVRIFKE----KENDSTLEGSQG------LSNVVESMKKAFEEEKIKFIQEKTEE 1487

Query: 1507 LREQFEEEKASILEAKEQELREQLATQKLDP--PV---NIDEIKKKWEEEYEQKTSQRIR 1561
              ++FEEEKA            +L+++   P  PV   +++ +KK+WEEEYE  + QRI+
Sbjct: 1488 YNKKFEEEKA------------KLSSENGSPAEPVSAPDVNSLKKQWEEEYEAISQQRIQ 1535

Query: 1562 ESNEQLKKRIRLPTEEKINKIVEKKRLELEAEFEANVQKKAEEIXXXXXXXXXXXTEVLE 1621
            E+ E LKKRIR+PTEE+I K+++K++ ELE EF    Q++ +E             E L+
Sbjct: 1536 EAEENLKKRIRMPTEERIKKVLDKRKTELEEEF----QRRLKENNLQPEGGDAKEREELK 1591

Query: 1622 KHKQDLENLKQEMQKKFDEDIAQIKKRAFEEGKQQASMKSTFLEKKIAKLETQIKAHDSA 1681
            K       L+ E + K+ E +A  KK+AFEEGKQQA+MKST LE+KI+KLE+Q+ + ++ 
Sbjct: 1592 KQ------LESEFEAKYKEILASTKKKAFEEGKQQAAMKSTLLERKISKLESQLNSSNNP 1645

Query: 1682 IPINDNSSATPAESGPT------TQDVKQLTPILNNQAAILPGKP-LPFNPAH----FAF 1730
             P  + ++AT     PT      T+++   TP    +   L  KP   F P+     F  
Sbjct: 1646 TP--EKAAATSV-GLPTKIDESRTENMATGTPAFGEKVLKLSDKPAFSFQPSSKSNPFTS 1702

Query: 1731 GMP-----FGQTTSNSFQNPFNSQPPEQTPNSPKRPSEEPVGGSPEKKPKENDS 1779
             +P     FG   + SF  P +SQP         RP+    G +   +P+ N S
Sbjct: 1703 ALPGNNNVFGMKPTFSF-TPGSSQP-------ESRPTFGSTGFNTTAEPESNRS 1748

>AFR286W Chr6 (951485..956761) [5277 bp, 1758 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YKR095W (MLP1) and
            YIL149C (MLP2)
          Length = 1758

 Score = 1030 bits (2663), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 675/1790 (37%), Positives = 1076/1790 (60%), Gaps = 75/1790 (4%)

Query: 15   EIDVTTISSFLELDASKVSTLDPAVVRQLSIKANQFGQLKAQNLKYSVTLDELKSSSERR 74
            E+D + +++ L L+  +V  L   +VR L  +   F QL+A+N +  V++   +S+ E  
Sbjct: 15   EVDYSRLAARLGLEQGQVQQLGEQLVRTLWGREQAFRQLEAENTRLKVSIGAAESACEHG 74

Query: 75   SEAFKLQLEKINENTESLRXXXXXXXXXXXXLIDEKANASKEVNLLKSQLTELKQQNEIF 134
             EA + + +++     + +                +A        ++ QL E +++    
Sbjct: 75   VEALRERQQQLAAEAGAQQRGQGEAGSAG------RAGGPSVPERVQQQLEETERRVAAG 128

Query: 135  RSSKQDVVQLLNEKIGDLEASQDEAKQLLQNTKTLRKQVLELENEVQTFKSNDLRGKAEM 194
             S+++D+ +LL EKI DL+ASQ E +++L   K LR+  +ELE  VQ+ +S  LR +AE+
Sbjct: 129  DSARRDLARLLEEKISDLDASQQELERVLGVNKELRRHEMELEFTVQSQRSQSLREQAEI 188

Query: 195  QRLTQEMNLLKSNNQWLEKELASKSEEFGSYRQRVNSELQTALSELNXXXXXXXXXXXXX 254
            QRL QE+ L++SN +W   +L  K+++  SYR++ N E+Q+   ELN             
Sbjct: 189  QRLQQELALVRSNAEWTTGQLNEKNQQLNSYREKTNGEIQSTQVELNIVKNELEVEHANV 248

Query: 255  QTLKSRANDLSQQLQDKMTELKSLRDSSSIEKQEFTREMTLKQRLIDLLEKQIESFKTEL 314
              L+S+  +LS+QLQD + E K L DS   EKQEF REM LKQRLI+LL  Q+ + K +L
Sbjct: 249  AALRSKNGELSKQLQDALCETKRLTDSLHSEKQEFAREMALKQRLIELLNGQVATMKQDL 308

Query: 315  ESARNKSVSNSDHVDAERXXXXXXXXXXXXXXXXXXXXAVKLEETVDELLSTD----GER 370
            E A +    N    D+ER                      +LE+T+ ELL TD    G R
Sbjct: 309  EKAYD-VAKNGGMSDSERERLLNDLFDTKKKLELSQANVSRLEDTIKELLETDNVQSGGR 367

Query: 371  GAGNTSKVSLDSKNSIVPKLHGDIGLLKKRLIQERRQKEQLQYQVEAFVLELEHKVPVLN 430
                 + V   S  S +  ++GD+  L+K+L+QERR KE+LQ QVE+FV+ELEHK+PVLN
Sbjct: 368  NGIEHANVGSPSGGSTISTVYGDLAALRKQLVQERRHKEELQLQVESFVVELEHKIPVLN 427

Query: 431  SFKERTEMLEKELSDVALMLEATSKDKEEKEHELTSVKSKIADYETQIHSLVRQRSDLAH 490
            SFK+R E LEK+L+ V L+LEAT+++++EK  ++   K+K+ DYETQ+  LV+QRSDLA 
Sbjct: 428  SFKKRIEELEKQLNGVTLLLEATARERDEKVVQIKQYKNKVGDYETQVGHLVQQRSDLAR 487

Query: 491  QVQHLLIQVSVRNDSNGPLTPEETNFIKKIINSSESPVEQDAQRIISERLVRFESMVELQ 550
            QVQ LLI +SVR+DS+GPLT EE  F+KK+ +  +S    D Q IIS RLV F+S+VELQ
Sbjct: 488  QVQCLLIHISVRDDSSGPLTAEEVEFVKKLQSCRDSATGSDTQAIISNRLVEFKSVVELQ 547

Query: 551  EKNMELLNSIRNLADKLXXXXXXXXXXXXXXXXXXXXXXXXXILTLQEYNKSLESQLEII 610
            +KN ELLN+IR LA KL                         IL+LQE+ + LE QLE +
Sbjct: 548  QKNAELLNAIRQLAQKLEQEEHKTQSKVKSLEQNTVNEAKEAILSLQEHVQMLEDQLETV 607

Query: 611  AKERDAFKILASDKGTSNGPSNVNSSENRHLVLAEEKIKELENHLSSLTEESAKNIKLLN 670
              ERD+FK+L S+   ++ P+ V ++  +   +A+  I  LE  L ++ EES ++ K+LN
Sbjct: 608  TTERDSFKLLVSEGKNNSLPNPVGAAALQPQEVAD-GIAHLEARLKAMAEESEQHAKMLN 666

Query: 671  EEIHSLYRAQADTSVNLEKERSSRILAEDRSKLISNTLEMTKMENDELRKRFHSLQENIL 730
            EEI +LY++ +  ++ LE+ERSSR LA+++  LI  +LE+ K EN +L+ R  SLQ  +L
Sbjct: 667  EEIKALYKSNSQLAIELERERSSRELADEKLSLIQKSLELVKGENADLQNRAGSLQALLL 726

Query: 731  KQDSKTQQTIESLISCKXXXXXXXXXXXXXXXERDLLRSIQENLKKENESLSEERNNMRI 790
            +QD++ Q TIE  +S K               ERD LR ++ +LKKENESL+++ N+ ++
Sbjct: 727  EQDTRRQSTIEEFVSAKSELFSISSQLTILQSERDFLRKVEADLKKENESLNKDNNDSQL 786

Query: 791  LITQLQTLQTERESLLEETQKNFQGKTNKLETELSDTLEKLDAKSKEISDYISTKDSQEK 850
            LI QL+T Q ER+SL+EET+K ++ +  +L+ ELS T ++L+ K +E  +  S+  +Q K
Sbjct: 787  LILQLKTAQKERDSLIEETRKRYETRIEELDGELSATKQQLERKQREYDELSSSSSTQCK 846

Query: 851  WYQEKFDRLNEELNNSREKLSSKLTDIQHLELKVESLNNKLEESEARIQAFNALNYSESV 910
            W+Q K D L EEL +S+  L +K +++  L+ ++ S  +KLE +    Q  + +  S+  
Sbjct: 847  WFQSKLDSLKEELGSSKLALKAKTSELDALKARLNSSTSKLEPASMDHQQSSLVLESDHA 906

Query: 911  ESQTETLRQELEKTRIKLADAYSQVEQYKSMADSSEE---SATAIKDALEQSKAEYTEKI 967
             S+ ++L ++L++   KL+ AYS++E+YK+ ++++E    S  A++D  + SK       
Sbjct: 907  -SRVQSLSKDLDEANRKLSSAYSEIERYKAASNATERPSLSYNAVQDNKDGSKQAAISLE 965

Query: 968  ETLTKERDMFKDQVPILKDQISNLNNELNHQKSQFESQISDYTRNLEDLKAKQSELDNMK 1027
              LTK        + +  D+I  L +ELN +++ + ++ S+    +  L   +  ++  K
Sbjct: 966  AELTK----LNSDIAMANDRIKVLEDELNRREATYSTERSELQEKINALVTDKQRIEEAK 1021

Query: 1028 AEYEQKISKIQEDLNQQTSYANTAQKNYEQELQKHADVSKKISLLRAEAQKYKSETETLR 1087
            A+Y+QKI+++Q DL +Q S  N A+  Y+  LQK A++S+ I  LR  ++ YKSE    +
Sbjct: 1022 ADYQQKITQLQTDLEKQISSTNEAETKYQTALQKQAEISENIESLRKSSESYKSEIAKFK 1081

Query: 1088 NAAENAKKALEQSELSWEKQSSDYEDELRLAHQRIEDLNAQSKILYDQIDFLSKGKPTSS 1147
            +AAE A+K LE++E +W++Q +D E  L LAHQRIE+L+ Q+++LYDQI+ LS+   +S 
Sbjct: 1082 SAAEEARKVLERNEQTWDQQKADIEANLDLAHQRIEELSTQNRLLYDQIELLSRSPSSSL 1141

Query: 1148 EDLMPISTETRNLLTSLRREKDILETKLEVSTREEKVLRQKLKLIESDLEGSRIELSKLQ 1207
            E    IS++ R L+ +LRRE+DILETK++VS REEK+LRQ+L+L +S+L+  R +LS+ +
Sbjct: 1142 EPDTKISSDARELIVTLRRERDILETKIDVSKREEKMLRQRLELTKSELDNLRAQLSESK 1201

Query: 1208 RAASGNSATLKDQEEIMTQLNQLNLLRESNITLRNEAQKNGERSRELKAELDALYGKVQP 1267
               +  + + ++QEE+  +LNQLNLLRE N++LRNE++K  E +  L+ E+ +L  KVQP
Sbjct: 1202 GLVTEGTDSSQNQEELFEKLNQLNLLREHNMSLRNESEKVSEHNEFLQNEILSLQEKVQP 1261

Query: 1268 LESKVTLLQNSVREKDLQISLKNEEAERWKQRSQDILHKYERIDPEEHQKLADKVSELQQ 1327
            +E ++  L  ++ EK+ +++L  EE++RWKQRSQDILHKYERIDPEE++KLA ++  L+ 
Sbjct: 1262 MEEQIKSLTATLTEKEQKLALLKEESDRWKQRSQDILHKYERIDPEEYRKLASEIEVLKA 1321

Query: 1328 EIKSKSDENEELDTRFKRLKQQAHEKLNAAKTAQSTLTSQLNDLKATKEKLENDLGSQKE 1387
            E++ KS E+ +   RF++L++QA+E+L+  K A++ + S+L    + K +LE  L   +E
Sbjct: 1322 ELERKSAESIDSQERFRKLRKQANERLDEFKAAKAKVESELELALSGKSQLEAKLSEARE 1381

Query: 1388 EVKNLESKITDIEKNKSSEKNDLQEQLENSQAKLLETENKLEQVTSSSALLEKELNERIE 1447
            ++ +LE+++T  E+  S + N +  +LE ++ KL + EN +  + S  ++ E+   ++++
Sbjct: 1382 KITSLETQLT--ERPASEDDNPVSHELEETKTKLQDAENTINMLKSEWSISEESFKKQLD 1439

Query: 1448 SLMNKIKLLEEDLEKAKTESPNDG-SQSSELVENTSKIVENLKIEFEEEKAKMISDKESE 1506
             L  +++ ++      K  +P+ G S  S   E  + ++E+ K + EEE+  +I   + E
Sbjct: 1440 ELNKQLETIQ------KNSAPSSGHSDPSSYHEQPTAVLEDFKKQVEEERRTLIESHQQE 1493

Query: 1507 LREQFEEEKASILEAKE---QELREQLATQKLDPPV-NIDEIKKKWEEEYEQKTSQRIRE 1562
            L  + E  + + L  KE   +ELR+ L    ++    N++ +KKKWEEEYEQ+T QRIRE
Sbjct: 1494 LTARLEASRKNFLAEKEKALEELRDSLTNVSVEAASQNLEALKKKWEEEYEQQTLQRIRE 1553

Query: 1563 SNEQLKKRIRLPTEEKINKIVEKKRLELEAEFEANVQKKA-EEIXXXXXXXXXXXTEVLE 1621
            + E LKKRIRLP+EE+IN+++E+K+  LE EF   V   A   +            ++++
Sbjct: 1554 AEEALKKRIRLPSEERINQVIERKQKALEQEFTTKVNATALALLKENPDSIASDKADLIK 1613

Query: 1622 KHKQDLENLKQEMQKKFDEDIAQIKKRAFEEGKQQASMKSTFLEKKIAKLETQIKAHDSA 1681
             H++++  LK+++  KF+  + Q+KK+AFEEG+QQ  MK   LE KI+KLE+Q KA    
Sbjct: 1614 DHQKEIVQLKKDLADKFEGQLVQVKKKAFEEGRQQGIMKVKLLESKISKLESQAKA---- 1669

Query: 1682 IPINDNSSATPAESGPTTQDVKQLTPILNNQAAILPGKPLPFNPAH--FAFG-MPF---- 1734
             P+  N         PT   ++   P+    A  +P KP PF  A+    FG +PF    
Sbjct: 1670 -PLGTNV--------PTKIPLENTQPL----AQQVPVKPSPFQLAYAQATFGNVPFLFNK 1716

Query: 1735 --------GQTTSNSFQNPFNSQPPEQTPNSPKRPSEEPVGGSPEKKPKE 1776
                     Q  S+S QN         T N  KR SE+    SP KK +E
Sbjct: 1717 NSEQKKVEHQDDSDSHQN---------TGNGNKRQSEDRAEESPGKKLRE 1757

>Suva_11.331 Chr11 (604552..610248) [5697 bp, 1898 aa] {ON} YKR095W
            (REAL)
          Length = 1898

 Score =  971 bits (2510), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 659/1809 (36%), Positives = 1060/1809 (58%), Gaps = 116/1809 (6%)

Query: 18   VTTISSFLELDASKVSTLDPAVVRQLSIKANQFGQLKAQNLKYSVTLDELKSSSERRSEA 77
            +  I+SF +    +V ++D  +V  L+ K  QF +LK++N++ +VTLDELK++S ++  +
Sbjct: 21   LNAIASFFDCSLEQVKSIDRDIVTHLNDKLLQFNELKSENIQITVTLDELKTNSAKKINS 80

Query: 78   FKLQLEKINENTESLRXXXXXXXXXXXXLIDEKANASKEVNLLKSQLTELKQQNEIFRSS 137
             K ++E +    + +R            +  EK + S E+  +K +L++L ++ +  +SS
Sbjct: 81   LKTEMEDVLRQNDEIRKERNDTSSKFESVQREKTHLSNELESIKRKLSDLSEEKKEIQSS 140

Query: 138  KQDVVQLLNEKIGDLEASQDEAKQLLQNTKTLRKQVLELENEVQTFKSNDLRGKAEMQRL 197
            +Q  +++L+E++ +LE  +  +       K LR  +LELE + QT+ SNDL  K++++R 
Sbjct: 141  QQRTLKILDERLKELEMVKAASNHSDSECKKLRSTILELETKQQTYISNDLNSKSQLERR 200

Query: 198  TQEMNLLKSNNQWLEKELASKSEEFGSYRQRVNSELQTALSELNXXXXXXXXXXXXXQTL 257
            TQE+NLL+SN  WLEKEL+SK++++ SYRQ+ N+ +    ++LN               L
Sbjct: 201  TQELNLLQSNKDWLEKELSSKNQQYLSYRQKTNTIISEIRNDLNRIRNDFQLEKTNNDVL 260

Query: 258  KSRANDLSQQLQDKMTELKSLRDSSSIEKQEFTREMTLKQRLIDLLEKQIESFKTELESA 317
            + + N+LS+ LQ+K+ ++K+L DSS+ EK++F+ E+TLKQRLIDLLE Q+ + K EL + 
Sbjct: 261  RQKNNELSKDLQEKLLQIKTLSDSSNSEKRDFSAEITLKQRLIDLLESQLNAVKEELNNT 320

Query: 318  R--NKSVSNSD---HVDAERXXXXXXXXXXXXXXXXXXXXAVKLEETVDELLSTDGERGA 372
            R  N S  NSD    + +E                      ++L    +E    DG    
Sbjct: 321  RESNYSDVNSDDSKQLISENEKLLKDLQLTKHKLVQCENECLRLSSITEEAGKEDG---- 376

Query: 373  GNTSKVSLDSKNSIVPKLHGDIGLLKKRLIQERRQKEQLQYQVEAFVLELEHKVPVLNSF 432
                         +  K +GD  LLKK+LI+E+R KE LQ Q+E+F++ELEHKVP++NSF
Sbjct: 377  ------------ILTSKSNGDFILLKKQLIKEKRAKEHLQNQIESFIVELEHKVPIINSF 424

Query: 433  KERTEMLEKELSDVALMLEATSKDKEEKEHELTSVKSKIADYETQIHSLVRQRSDLAHQV 492
            KERT+ LE EL++ AL+LE TS +K  K  EL     K+A+Y+ +IH L +QR DL  Q+
Sbjct: 425  KERTDTLENELNNAALLLEHTSNEKNAKIKELKVKNEKLAEYKDEIHILSKQRLDLCRQI 484

Query: 493  QHLLIQVSVRNDSNGPLTPEETNFIKKII-NSSESPVEQDAQRIISERLVRFESMVELQE 551
            Q+LL+  SV NDS GPL  EE  FI+ I+ N   +  E D+Q+I++ERLV F  +++LQE
Sbjct: 485  QYLLVTNSVSNDSKGPLRKEEIKFIQNILQNDDSATTESDSQKIVTERLVEFRDIIQLQE 544

Query: 552  KNMELLNSIRNLADKLXXXXXXXXXXXXXXXXXXXXXXXXXILTLQEYNKSLESQLEIIA 611
            KN ELL   RNLADKL                         ILTLQ     LES++  + 
Sbjct: 545  KNSELLRVTRNLADKLESNENKSKNYLKNIENETINEAKEAILTLQSQKVQLESKIHELE 604

Query: 612  KERDAFKILASDKGTSNGPSNVN--SSENRHLVLAEEKIKELENHLSSLTEESAKNIKLL 669
            KER+ FK    D+ TS   S +   +   R L   E + ++L+  +S +T ES +N+ LL
Sbjct: 605  KEREKFKNWTMDQETSPNNSVIQQLTETKREL---ESQTQDLQARISQVTRESTENMSLL 661

Query: 670  NEEIHSLYRAQADTSVNLEKERSSRILAEDRSKLISNTLEMTKMENDELRKRFHSLQENI 729
            N+E+  LY +++  S+ L +E+SSRILAE+R KL+SNTL++ K END+LRKR  +LQ  I
Sbjct: 662  NKELQDLYDSKSSLSIELGREKSSRILAEERFKLLSNTLDLAKAENDQLRKRSINLQNAI 721

Query: 730  LKQDSKTQQTIESLISCKXXXXXXXXXXXXXXXERDLLRSIQENLKKENESLSEERNNMR 789
             KQDSKTQ+T+   +SCK               ER L   +++NLK+E   LS E+ ++ 
Sbjct: 722  SKQDSKTQETLNDYVSCKSKLSAIETELSNLKLERTLKIELEKNLKQELSELSSEKTSLH 781

Query: 790  ILITQLQTLQTERESLLEETQKNFQGKTNKLETELSDTLEKLDAKSKEISDYISTKDSQE 849
            I++TQLQTLQ ERE+LL+ET+K+ Q K + L+   ++   +   K + I       DS+ 
Sbjct: 782  IMVTQLQTLQKERENLLDETKKSCQNKIDALQNAQNELKTEAIRKDQYIKQLEEDNDSKI 841

Query: 850  KWYQEKFDRLNEELNNSREKLSSKLTDIQHLELKVESLNNKLEESEARIQAFNALNYSES 909
            +WYQ K + L ++  +    L+ K  +++  + +++SL  ++EE++ R+  +N L+  ES
Sbjct: 842  EWYQNKIETLRKDHESVMSSLNEKQIEVERFQYEIKSLEKEIEENKIRLHTYNVLD--ES 899

Query: 910  VESQTETLRQELEKTRIKLADAYSQVEQYKSMADSSEESATAIKDALEQSKAEYTEKIET 969
            +    ++LR+ELEK++I L DAYSQ+++YK + +++++S   +   L++S   ++ +I+ 
Sbjct: 900  IND--DSLRRELEKSKINLTDAYSQIQEYKKLYETTDKSLQEMSSQLDESNKAFSNQIQN 957

Query: 970  LTKERDMFKDQVPILKDQISNLNNELNHQKSQFESQISDYTRNLEDLKAKQSELDNMKAE 1029
            LT E+   +D+V +L++Q+SNLNNEL+ Q    E + +++ + +  L+    E++ +K E
Sbjct: 958  LTDEKTSLEDKVSLLREQMSNLNNELDLQNQAMEKEKAEFKKKISILQNNNKEIEAVKTE 1017

Query: 1030 YEQKISKIQEDLNQQTSYANTAQKNYEQELQKHADVSKKISLLRAEAQKYKSETETLRNA 1089
            YE K+SKIQ+DL+QQT YANTAQ NYEQELQKHADVSK IS LR +   YK + ETL  A
Sbjct: 1018 YESKLSKIQKDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYKGQVETLNLA 1077

Query: 1090 AENAKKALEQSELSWEKQSSDYEDELRLAHQRIEDLNAQSKILYDQIDFL--SKGKPTSS 1147
                +KAL+++E +W  Q     ++L L++ RIEDL++Q+K+LYDQI+    +  KPT  
Sbjct: 1078 RGQFEKALKENETNWNSQKESLLEQLDLSNSRIEDLSSQNKLLYDQIELYTTTGNKPT-- 1135

Query: 1148 EDLMPISTETRNLLTSLRREKDILETKLEVSTREEKVLRQKLKLIESDLEGSRIELSKLQ 1207
             D    S    ++L +LRRE+DIL+TK+ V+ R+ K+LRQK+ LI+ +L+ +R +L   +
Sbjct: 1136 -DAKSGSVLNNDILITLRRERDILDTKVAVAERDAKMLRQKISLIDVELQEARTKLCNSK 1194

Query: 1208 RAASGNSATLKDQEEIMTQLNQLNLLRESNITLRNEAQKNGERSRELKAELDALYGKVQP 1267
                  S  ++  +E+M +LNQLNLLRESN TLRNE   +  +++EL++EL+ L G + P
Sbjct: 1195 VENEKRSFIIQQHDEVMEKLNQLNLLRESNTTLRNELDSSNSKNKELQSELERLRGNIAP 1254

Query: 1268 LESKVTLLQNSVREKDLQISLKNEEAERWKQRSQDILHKYERIDPEEHQKLADKVSELQQ 1327
            +ES++  L+ S++EK+ +I L  EE  RWK+RSQDI+ K++++   +++KL  ++  L+ 
Sbjct: 1255 IESELAALKFSIQEKEQEIRLTKEEVHRWKKRSQDIMEKHQQLSSTDYEKLETEIESLKA 1314

Query: 1328 EIKSKSDENEELDTRFKRLKQQAHEKLNAAKTAQSTLTSQLNDLKATKEKLENDLGSQKE 1387
            +++ K+ +  + + +F RL++QA EKL A+K +Q +   QLN+LK  K  LE  L +   
Sbjct: 1315 QLEDKTQQGADSEEKFNRLRRQAQEKLKASKLSQDSFIEQLNELKDAKLALEKSLNNANA 1374

Query: 1388 EVKNLESKITDIEKNKSSEKNDLQEQLENSQAKLLETENKLEQVTSSSALLEKELNERIE 1447
             ++ LE       +N+ S    LQE  E +  +L   E KLE+   S     K+LNE   
Sbjct: 1375 RIQELEDAKVAENRNQLSMIKKLQEDTEENSKEL---ETKLEENAISYDSTVKKLNE--- 1428

Query: 1448 SLMNKIKLLEEDLEKAKTESPNDGSQSSELVENTSKIVENLKIEFEEEKAKMISDKESEL 1507
                +I +L+E+LEK +       + +    ++ SK+VE++K  FEE+K K I +K  E+
Sbjct: 1429 ----EIGILKEELEKQRQIQQQFQAAAGTEQDDLSKVVESMKRSFEEDKIKFIEEKTREV 1484

Query: 1508 REQFEEEKASILEAKEQELREQLATQKLDPP-VNIDEIKKKWEEEYEQKTSQRIRESNEQ 1566
             ++           +E +  ++     L P  +NIDEIKK+WE E+ ++ S++IRE+ E 
Sbjct: 1485 NQKI----------REFQEAQEAEETGLKPSNINIDEIKKQWEAEHNEEVSKKIREAEEA 1534

Query: 1567 LKKRIRLPTEEKINKIVEKKRLELEAEFEANVQKKAEEIXXXXXXXXXXXTEV---LEKH 1623
            LKKRIRLPTEEKI+KI+E+K+ +LE EF+  V+++ + I            ++   +++ 
Sbjct: 1535 LKKRIRLPTEEKISKIIERKKEDLEKEFDEKVEERLKSISQSGKMEDIFQKQLESRIQEK 1594

Query: 1624 KQDLEN------------------------------LKQEMQKKFDEDIAQIKKRAFEEG 1653
            +++LEN                              ++ +++++F+ ++  IKK++FEEG
Sbjct: 1595 QKELENEYNKKLQEKLRELPSSDIISSDDKDKLRADIEAQLREEFNHELQTIKKKSFEEG 1654

Query: 1654 KQQASMKSTFLEKKIAKLETQIKAHDSAIPINDNSSATPAESGPTTQDVKQLTPILNNQA 1713
            KQQA MK+T LE+K+AK+E+Q+            S    +   P     K   P+L    
Sbjct: 1655 KQQAMMKTTLLERKLAKMESQL------------SETKQSVDSPPKHLSKMPNPLLGLPR 1702

Query: 1714 AILPGKPLPFNP---AHFAFGMPFGQTTSNSFQNPFNSQPPEQTPNSPKRPSEEPVGGSP 1770
             I      P+NP         +    ++S  F NPF S P   +PN P +      G   
Sbjct: 1703 KIEENSNPPYNPLLSGEKLLKLNSKSSSSGGF-NPFTS-P---SPNKPLQ------GDEA 1751

Query: 1771 EKKPKENDS 1779
            E++P  N++
Sbjct: 1752 EREPSSNET 1760

>YKR095W Chr11 (619805..625432) [5628 bp, 1875 aa] {ON}
            MLP1Myosin-like protein associated with the nuclear
            envelope, connects the nuclear pore complex with the
            nuclear interior; involved with Tel1p in telomere length
            control; involved with Pml1p and Pml39p in nuclear
            retention of unspliced mRNAs
          Length = 1875

 Score =  957 bits (2473), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 673/1798 (37%), Positives = 1058/1798 (58%), Gaps = 111/1798 (6%)

Query: 1    MAEQNSPTTPSVIGEID---VTTISSFLELDASKVSTLDPAVVRQLSIKANQFGQLKAQN 57
            M++ ++P      GE     +  I+SF      +V + D  VV+ L+ K  QF +LK++N
Sbjct: 1    MSDHDTPMESIQNGENSDERLNAIASFFGCSLEQVKSFDGDVVKHLNDKLLQFNELKSEN 60

Query: 58   LKYSVTLDELKSSSERRSEAFKLQLEKINENTESLRXXXXXXXXXXXXLIDEKANASKEV 117
            LK +V+ DELK+SS ++ +  K ++E +    + +R            + +EK   S E+
Sbjct: 61   LKVTVSFDELKASSLKKIDGLKTEMENVIRENDKIRKERNDTFVKFESVENEKMKLSSEL 120

Query: 118  NLLKSQLTELKQQNEIFRSSKQDVVQLLNEKIGDLEASQDEAKQLLQNTKTLRKQVLELE 177
              +K +L +L ++ +  +S++Q  +++L+E++ ++E  + E  +     K LR  +++LE
Sbjct: 121  EFVKRKLDDLTEEKKETQSNQQRTLKILDERLKEIELVRVENNRSNSECKKLRSTIMDLE 180

Query: 178  NEVQTFKSNDLRGKAEMQRLTQEMNLLKSNNQWLEKELASKSEEFGSYRQRVNSELQTAL 237
             + Q + +NDL  + E++R TQE+ LL+SNN WLEKEL SK+E++ SYRQ+ +  +    
Sbjct: 181  TKQQGYITNDLNSRTELERKTQELTLLQSNNDWLEKELRSKNEQYLSYRQKTDKVILDIR 240

Query: 238  SELNXXXXXXXXXXXXXQTLKSRANDLSQQLQDKMTELKSLRDSSSIEKQEFTREMTLKQ 297
            +ELN               LK + N+LS+ LQ+K+ E+K L DS + EKQEF+ EM+LKQ
Sbjct: 241  NELNRLRNDFQMERTNNDVLKQKNNELSKSLQEKLLEIKGLSDSLNSEKQEFSAEMSLKQ 300

Query: 298  RLIDLLEKQIESFKTELESARNKSVSNSDHVDAERXXXXXXXXXXXXXXXXXXXXAVKLE 357
            RL+DLLE Q+ + K EL S R  + +     D+++                      +L+
Sbjct: 301  RLVDLLESQLNAVKEELNSIRELNTAKVIADDSKKQTPENEDLLK------------ELQ 348

Query: 358  ETVDELLSTDGE--RGAGNTSKVSLDSKNSIVPKLHGDIGLLKKRLIQERRQKEQLQYQV 415
             T ++L   + E  R +  T +   D++N +  K   D   LKK+LI+ERR KE LQ Q+
Sbjct: 349  LTKEKLAQCEKECLRLSSITDEADEDNEN-LSAKSSSDFIFLKKQLIKERRTKEHLQNQI 407

Query: 416  EAFVLELEHKVPVLNSFKERTEMLEKELSDVALMLEATSKDKEEKEHELTSVKSKIADYE 475
            E F++ELEHKVP++NSFKERT+MLE EL++ AL+LE TS +K  K  EL +   K+ + E
Sbjct: 408  ETFIVELEHKVPIINSFKERTDMLENELNNAALLLEHTSNEKNAKVKELNAKNQKLVECE 467

Query: 476  TQIHSLVRQRSDLAHQVQHLLIQVSVRNDSNGPLTPEETNFIKKIINSSESPV-EQDAQR 534
              + +L +QR DL  Q+Q+LLI  SV NDS GPL  EE  FI+ I+   +S + E D+Q+
Sbjct: 468  NDLQTLTKQRLDLCRQIQYLLITNSVSNDSKGPLRKEEIQFIQNIMQEDDSTITESDSQK 527

Query: 535  IISERLVRFESMVELQEKNMELLNSIRNLADKLXXXXXXXXXXXXXXXXXXXXXXXXXIL 594
            +++ERLV F+++++LQEKN ELL  +RNLADKL                         I+
Sbjct: 528  VVTERLVEFKNIIQLQEKNAELLKVVRNLADKLESKEKKSKQSLQKIESETVNEAKEAII 587

Query: 595  TLQEYNKSLESQLEIIAKERDAFK--ILASDKGTSNGPSNVNSSENRHLVLAEEKIKELE 652
            TL+     LES++E + KE +  K  +   D   SN      +   R L   E ++++L+
Sbjct: 588  TLKSEKMDLESRIEELQKELEELKTSVPNEDASYSNVTIKQLTETKRDL---ESQVQDLQ 644

Query: 653  NHLSSLTEESAKNIKLLNEEIHSLYRAQADTSVNLEKERSSRILAEDRSKLISNTLEMTK 712
              +S +T ES +N+ LLN+EI  LY +++D S+ L KE+SSRILAE+R KL+SNTL++TK
Sbjct: 645  TRISQITRESTENMSLLNKEIQDLYDSKSDISIKLGKEKSSRILAEERFKLLSNTLDLTK 704

Query: 713  MENDELRKRFHSLQENILKQDSKTQQTIESLISCKXXXXXXXXXXXXXXXERDLLRSIQE 772
             END+LRKRF  LQ  ILKQDSKT +T+   +SCK               E+ L   +++
Sbjct: 705  AENDQLRKRFDYLQNTILKQDSKTHETLNEYVSCKSKLSIVETELLNLKEEQKLRVHLEK 764

Query: 773  NLKKENESLSEERNNMRILITQLQTLQTERESLLEETQKNFQGKTNKLETELSDTLEKLD 832
            NLK+E   LS E++++RI++TQLQTLQ ERE LLEET+K+ Q K ++LE  LS+  ++  
Sbjct: 765  NLKQELNKLSPEKDSLRIMVTQLQTLQKEREDLLEETRKSCQKKIDELEDALSELKKETS 824

Query: 833  AKSKEISDYISTKDSQEKWYQEKFDRLNEELNNSREKLSSKLTDIQHLELKVESLNNKLE 892
             K   I       +S  +WYQ K + L ++  +    + SK TDI+ L+ KV+SL  ++E
Sbjct: 825  QKDHHIKQLEEDNNSNIEWYQNKIEALKKDYESVITSVDSKQTDIEKLQYKVKSLEKEIE 884

Query: 893  ESEARIQAFNALNYSESVESQTETLRQELEKTRIKLADAYSQVEQYKSMADSSEESATAI 952
            E + R+  +N ++  E++    ++LR+ELEK++I L DAYSQ+++YK + +++ +S    
Sbjct: 885  EDKIRLHTYNVMD--ETIND--DSLRKELEKSKINLTDAYSQIKEYKDLYETTSQSLQQT 940

Query: 953  KDALEQSKAEYTEKIETLTKERDMFKDQVPILKDQISNLNNELNHQKSQFESQISDYTRN 1012
               L++S  ++T +I+ LT E+   +D++ +LK+Q+ NLNNEL+ QK   E + +D+ + 
Sbjct: 941  NSKLDESFKDFTNQIKNLTDEKTSLEDKISLLKEQMFNLNNELDLQKKGMEKEKADFKKR 1000

Query: 1013 LEDLKAKQSELDNMKAEYEQKISKIQEDLNQQTSYANTAQKNYEQELQKHADVSKKISLL 1072
            +  L+    E++ +K+EYE K+SKIQ DL+QQT YANTAQ NYEQELQKHADVSK IS L
Sbjct: 1001 ISILQNNNKEVEAVKSEYESKLSKIQNDLDQQTIYANTAQNNYEQELQKHADVSKTISEL 1060

Query: 1073 RAEAQKYKSETETLRNAAENAKKALEQSELSWEKQSSDYEDELRLAHQRIEDLNAQSKIL 1132
            R +   YK + +TL  + +  + AL+++E SW  Q     ++L L++ RIEDL++Q+K+L
Sbjct: 1061 REQLHTYKGQVKTLNLSRDQLENALKENEKSWSSQKESLLEQLDLSNSRIEDLSSQNKLL 1120

Query: 1133 YDQID-FLSKGKPTSSEDLMPISTETRNLLTSLRREKDILETKLEVSTREEKVLRQKLKL 1191
            YDQI  + +  K  ++    P      N+L +LRRE+DIL+TK+ V+ R+ K+LRQK+ L
Sbjct: 1121 YDQIQIYTAADKEVNNSTNGP---GLNNILITLRRERDILDTKVTVAERDAKMLRQKISL 1177

Query: 1192 IESDLEGSRIELSKLQRAASGNSATLKDQEEIMTQLNQLNLLRESNITLRNEAQKNGERS 1251
            ++ +L+ +R +L   +     +S+ ++  ++IM +LNQLNLLRESNITLRNE + N  + 
Sbjct: 1178 MDVELQDARTKLDNSRVEKENHSSIIQQHDDIMEKLNQLNLLRESNITLRNELENNNNKK 1237

Query: 1252 RELKAELDALYGKVQPLESKVTLLQNSVREKDLQISLKNEEAERWKQRSQDILHKYERID 1311
            +EL++ELD L   V P+ES++T L+ S++EK+ ++ L  EE  RWK+RSQDIL K+E++ 
Sbjct: 1238 KELQSELDKLKQNVAPIESELTALKYSMQEKEQELKLAKEEVHRWKKRSQDILEKHEQLS 1297

Query: 1312 PEEHQKLADKVSELQQEIKSKSDENEELDTRFKRLKQQAHEKLNAAKTAQSTLTSQLNDL 1371
              +++KL  ++  L++E+++K  +  E + +F RL++QA E+L  +K +Q +LT Q+N L
Sbjct: 1298 SSDYEKLESEIENLKEELENKERQGAEAEEKFNRLRRQAQERLKTSKLSQDSLTEQVNSL 1357

Query: 1372 KATKEKLENDLGSQKEEVKNLESKITDIEKNKSSEKNDLQEQLENSQAKLLETENKLEQV 1431
            +  K  LEN L      ++ L++       N+      LQE  E +  +L   + KLE+ 
Sbjct: 1358 RDAKNVLENSLSEANARIEELQNAKVAQGNNQLEAIRKLQEDAEKASREL---QAKLEES 1414

Query: 1432 TSSSALLEKELNERIESLMNKIKLLEEDLEKAKTESPNDGSQSSELVENTSKIVENLKIE 1491
            T+S       LNE I +       L+E++EK +       + S+    + S IVE++K  
Sbjct: 1415 TTSYESTINGLNEEITT-------LKEEIEKQRQIQQQLQATSANEQNDLSNIVESMKKS 1467

Query: 1492 FEEEKAKMISDKESELREQFEEEKASILEAKEQELREQLATQKLDPP--VNIDEIKKKWE 1549
            FEE+K K I +K  E+ E+       ILEA+E          +L+ P  +N++EIKKKWE
Sbjct: 1468 FEEDKIKFIKEKTQEVNEK-------ILEAQE----------RLNQPSNINMEEIKKKWE 1510

Query: 1550 EEYEQKTSQRIRESNEQLKKRIRLPTEEKINKIVEK-----------------KRLE--- 1589
             E+EQ+ SQ+IRE+ E LKKRIRLPTEEKINKI+E+                 K +E   
Sbjct: 1511 SEHEQEVSQKIREAEEALKKRIRLPTEEKINKIIERKKEELEKEFEEKVEERIKSMEQSG 1570

Query: 1590 -----LEAEFEANVQKKAEEIXXXXXXXXXXXTEVL--EKHKQDLEN------LKQEMQK 1636
                 L  + EA VQ+K +E+            + +    H  D E       ++  +++
Sbjct: 1571 EIDVVLRKQLEAKVQEKQKELENEYNKKLQEELKDVPHSSHISDDERDKLRAEIESRLRE 1630

Query: 1637 KFDEDIAQIKKRAFEEGKQQASMKSTFLEKKIAKLETQIKAHDSAIPINDNSSATPAESG 1696
            +F+ ++  IKK++F+EGKQQA MK+T LE+K+AK+E+Q+           + +   AES 
Sbjct: 1631 EFNNELQAIKKKSFDEGKQQAMMKTTLLERKLAKMESQL-----------SETKQSAESP 1679

Query: 1697 PTTQDVKQLTPILNNQAAILPGKPLPFNPAHFAFG---MPFGQTTSNSFQNPFNSQPP 1751
            P + +  Q  P+L     I      PFNP     G   +     +S+   NPF S  P
Sbjct: 1680 PKSVNNVQ-NPLLGLPRKIEENSNSPFNP--LLSGEKLLKLNSKSSSGGFNPFTSPSP 1734

>Skud_11.334 Chr11 (601335..606992) [5658 bp, 1885 aa] {ON} YKR095W
            (REAL)
          Length = 1885

 Score =  940 bits (2430), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 664/1786 (37%), Positives = 1051/1786 (58%), Gaps = 122/1786 (6%)

Query: 18   VTTISSFLELDASKVSTLDPAVVRQLSIKANQFGQLKAQNLKYSVTLDELKSSSERRSEA 77
            +  I+SF +    +V ++D  ++ +L+ K  QF +LK++NL+ +V+ DELK++S ++ + 
Sbjct: 21   LNVIASFFDCSLEQVKSIDTDIITRLNEKLIQFNELKSENLQITVSFDELKTNSLKKIDG 80

Query: 78   FKLQLEKINENTESLRXXXXXXXXXXXXLIDEKANASKEVNLLKSQLTELKQQNEIFRSS 137
             K ++E +    + +R            L +EK   S E+  +K +L +L ++ +  +S+
Sbjct: 81   LKTEMENVLRQNDEIRKERNDTSAKFEFLQNEKIQLSNELESVKRKLNDLTEEKKEIQSN 140

Query: 138  KQDVVQLLNEKIGDLEASQDEAKQLLQNTKTLRKQVLELENEVQTFKSNDLRGKAEMQRL 197
            +Q  +++L+E++ ++E ++ E  +     + LR  V+ELE + QT+ +NDL  ++E++R 
Sbjct: 141  QQRTLKILDERLKEVEMAKVENNRTNNECRNLRSTVVELETKQQTYITNDLNSRSELERK 200

Query: 198  TQEMNLLKSNNQWLEKELASKSEEFGSYRQRVNSELQTALSELNXXXXXXXXXXXXXQTL 257
            TQE+NLL+SN  WLEKEL+SKSE++ SYRQR ++ +    SELN               L
Sbjct: 201  TQELNLLQSNKDWLEKELSSKSEQYLSYRQRTDATISEIRSELNRLKNDFQLEKTNNDVL 260

Query: 258  KSRANDLSQQLQDKMTELKSLRDSSSIEKQEFTREMTLKQRLIDLLEKQIESFKTELESA 317
            K + N+LS  LQ+K+ +LK+L DS + EKQEF+ E+ LKQRLIDLLE Q+ + K EL+S 
Sbjct: 261  KQKNNELSNSLQEKVLDLKNLSDSLNTEKQEFSTEIALKQRLIDLLETQLNAVKEELKSI 320

Query: 318  RNKSVSNSDHVD-----AERXXXXXXXXXXXXXXXXXXXXAVKLEETVDELLSTDGERGA 372
            R    SN    D     +E                      ++L    +E     GE   
Sbjct: 321  RKSDSSNVTSDDSRKLISENESLLKDLRLTKEKLAQCESECLRLSSITEET----GEESG 376

Query: 373  GNTSKVSLDSKNSIVPKLHGDIGLLKKRLIQERRQKEQLQYQVEAFVLELEHKVPVLNSF 432
              TS+ S             D  LLKK+ I+E+R KEQLQ Q+E+F++ELEHKVPV+NSF
Sbjct: 377  TLTSRSS------------TDFILLKKQYIKEKRAKEQLQNQIESFIVELEHKVPVINSF 424

Query: 433  KERTEMLEKELSDVALMLEATSKDKEEKEHELTSVKSKIADYETQIHSLVRQRSDLAHQV 492
            KERT+MLE EL++ AL+LE TS +K  K  EL     KIA  E  IH L RQR DL  QV
Sbjct: 425  KERTDMLENELNNSALLLEHTSNEKNAKIRELNIKNEKIAKCENDIHILTRQRLDLCRQV 484

Query: 493  QHLLIQVSVRNDSNGPLTPEETNFIKKII-NSSESPVEQDAQRIISERLVRFESMVELQE 551
            Q+LLI  SV NDS GPL  EE  FI+ I+ N +    E D+Q+I++ RLV F +++ELQE
Sbjct: 485  QYLLITNSVSNDSKGPLRKEEIKFIQNILQNDNSGTTESDSQKILTGRLVEFRNVIELQE 544

Query: 552  KNMELLNSIRNLADKLXXXXXXXXXXXXXXXXXXXXXXXXXILTLQEYNKSLESQLEIIA 611
            KN ELL   RNLADKL                         IL+LQ    SLES++E + 
Sbjct: 545  KNTELLRITRNLADKLESNEIKSKQNLLKIENKTINEAKEAILSLQSEKMSLESKVEELE 604

Query: 612  KERDAFKILASDKGTSNGPSNVN--SSENRHLVLAEEKIKELENHLSSLTEESAKNIKLL 669
            +ER+  K   S + +S   S +   +   R L   E ++++L+  +S +T ES +N+ LL
Sbjct: 605  RERETLKSSISKQASSFNNSVIQQLTKTKREL---ESQVQDLQARISQITRESTQNMSLL 661

Query: 670  NEEIHSLYRAQADTSVNLEKERSSRILAEDRSKLISNTLEMTKMENDELRKRFHSLQENI 729
            N+EI  +Y +++D S+ L KE+SSRILAE+R KL+SNTL++TK END+LRKR  SLQ +I
Sbjct: 662  NKEIQDIYDSKSDISIELGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKRSDSLQSSI 721

Query: 730  LKQDSKTQQTIESLISCKXXXXXXXXXXXXXXXERDLLRSIQENLKKENESLSEERNNMR 789
             KQDSKT +T+   ISCK               E+ L    +++LK+E + LS E+ ++R
Sbjct: 722  SKQDSKTHETLNEYISCKSKLSVTETALSNLKLEQKLKIDSEKSLKQELDKLSSEKTSLR 781

Query: 790  ILITQLQTLQTERESLLEETQKNFQGKTNKLETELSDTLEKLDAKSKEISDYISTKDSQE 849
            I++TQLQTLQ ERE LL+E +K+ Q K N++E   ++   +   K + I        S+ 
Sbjct: 782  IMVTQLQTLQKEREDLLDEARKSCQNKINEVEEAYNELKVETSHKDQHIMQLEEDNTSKI 841

Query: 850  KWYQEKFDRLNEELNNSREKLSSKLTDIQHLELKVESLNNKLEESEARIQAFNALNYSES 909
            +WYQ K + L ++ ++    ++ K T+I+ L+ KV+SL  ++EE++ R+  +N ++  E+
Sbjct: 842  EWYQNKIETLKKDNDSVMNLVNEKQTEIEKLQYKVKSLEKEIEENKIRLHTYNVMD--ET 899

Query: 910  VESQTETLRQELEKTRIKLADAYSQVEQYKSMADSSEESATAIKDALEQSKAEYTEKIET 969
            +    ++LR+ELE ++I L +AYSQ+++YK + +S+ +S   +   L++S   ++ +I++
Sbjct: 900  IND--DSLRKELEMSKINLTEAYSQIQEYKKLYESTAQSLREMNSKLDESNEAFSNQIQS 957

Query: 970  LTKERDMFKDQVPILKDQISNLNNELNHQKSQFESQISDYTRNLEDLKAKQSELDNMKAE 1029
            LT E+   +D+V +LK+Q  NLNNEL+ QK++ E +  ++ + +  L+    E++ +K+E
Sbjct: 958  LTDEKINLEDKVSLLKEQSFNLNNELDLQKNEMEKKKVEFKKIIAILQNNNKEIETVKSE 1017

Query: 1030 YEQKISKIQEDLNQQTSYANTAQKNYEQELQKHADVSKKISLLRAEAQKYKSETETLRNA 1089
            YE K+SKIQ+DL+QQT YANTAQ NYEQELQKHADVSK IS LR +   Y+ + +TL  +
Sbjct: 1018 YESKLSKIQDDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYRGQVKTLTLS 1077

Query: 1090 AENAKKALEQSELSWEKQSSDYEDELRLAHQRIEDLNAQSKILYDQID-FLSKGKPTSSE 1148
                +  L+++E SW  Q     ++L L++ RIEDL++Q+K+LY+QI+ + + G      
Sbjct: 1078 RSELENILKENEKSWTSQKQSLLEQLDLSNSRIEDLSSQNKLLYNQIELYTAAGNGVGDA 1137

Query: 1149 DLMPISTETRNLLTSLRREKDILETKLEVSTREEKVLRQKLKLIESDLEGSRIELSKLQR 1208
               P  T   ++L +LRRE+DIL+TK+ V+ R+ K+LRQK+ L++ +L+ +R +L+  + 
Sbjct: 1138 RNGP--TLNNDILVTLRRERDILDTKVTVAERDAKMLRQKITLMDVELQDARTKLNNSRV 1195

Query: 1209 AASGNSATLKDQEEIMTQLNQLNLLRESNITLRNEAQKNGERSRELKAELDALYGKVQPL 1268
                 S+ ++  + IM +LNQLNLLRESNITLRNE +   ++++EL++EL  L   + P+
Sbjct: 1196 ENDERSSIVQQHDVIMEKLNQLNLLRESNITLRNELENCSKKNKELQSELVKLKEIIAPI 1255

Query: 1269 ESKVTLLQNSVREKDLQISLKNEEAERWKQRSQDILHKYERIDPEEHQKLADKVSELQQE 1328
            ES+++ L+ S++EK+ +I L  EE  RWK+RSQDIL K++++   +++KL  +V  L+ +
Sbjct: 1256 ESELSALKYSMQEKEQEIRLAKEEVHRWKKRSQDILEKHQQLSSNDYEKLESEVESLKAQ 1315

Query: 1329 IKSKSDENEELDTRFKRLKQQAHEKLNAAKTAQSTLTSQLNDLKATKEKLENDLGSQKEE 1388
            ++ K  +  E + RF RL++QA EKL  +K  Q TLT QLN+LK  K  LE  L      
Sbjct: 1316 LEDKMQQGTEAEERFNRLRRQAQEKLKTSKLTQETLTEQLNELKDAKVALERSLN----- 1370

Query: 1389 VKNLESKITDIEKNKSSEKNDLQEQLENSQAKL----LETENKLEQVTSSSALLEKELNE 1444
              +  ++I ++E  K +E N+  E ++ SQ        E E KLE+   S +   ++LNE
Sbjct: 1371 --DANTRIQELEGEKVAEDNNRSEMIKRSQEDAEKSSRELEEKLEENAISYSSTVRKLNE 1428

Query: 1445 RIESLMNKIKLLEEDLEKAKTESPNDGSQSSELVENTSKIVENLKIEFEEEKAKMISDKE 1504
             I +       L+E++EK         + +    E+ S IVE++K  FEE+K K I +K 
Sbjct: 1429 EIAT-------LKEEIEKQGQIQKQLQTAAGHRDEDLSNIVESMKKSFEEDKIKFIEEKT 1481

Query: 1505 SELREQFEEEKASILEAKEQELREQLATQKLDPP--VNIDEIKKKWEEEYEQKTSQRIRE 1562
             E+ ++ +E                 A ++L+ P  VNIDE+KK+WE E+E++ ++R+RE
Sbjct: 1482 REVNKKIQE-----------------AQERLNQPSSVNIDEMKKQWEAEHEEEVAERVRE 1524

Query: 1563 SNEQLKKRIRLPTEEKINKIVEKKRLELEAEFEANVQKKAEEIXXXXXXXXXXXTEV--- 1619
            + E LKKRIRLPTEEKI+KI+E+K+ +LE EF   +++K + I            ++   
Sbjct: 1525 AEEALKKRIRLPTEEKISKIIERKKEDLEKEFNEKLEEKVKSISGSEQMEAMLQKQLEIR 1584

Query: 1620 LEKHKQDLEN--------------------------LKQEMQKK----FDEDIAQIKKRA 1649
            +++ +++LE+                          L+ E++ K     ++++  +KK++
Sbjct: 1585 VQEKQKELEDEYNEKLQEKLKEVSHSSSISVNEKDELRAEIEAKLREELNDELQNVKKKS 1644

Query: 1650 FEEGKQQASMKSTFLEKKIAKLETQ---IKAHDSAIPINDNSSATPAESGPTTQDVKQLT 1706
            FEEGKQQA+MK+T LE+K+AK+E+Q   IK    + P + N+   P    P   +    +
Sbjct: 1645 FEEGKQQATMKTTLLERKLAKMESQLSEIKQSAESPPKHANNVPNPLLGLPRKIEENSNS 1704

Query: 1707 PILNNQAAILPG-KPLPFNPAHFAFGMPFGQTTSNSFQNPFNSQPP 1751
            P       +L G K L FN    + G         +F NPF S  P
Sbjct: 1705 PF----NTLLSGEKLLKFNSKSSSSG---------AF-NPFTSPSP 1736

>Smik_11.358 Chr11 (609897..615533) [5637 bp, 1878 aa] {ON} YKR095W
            (REAL)
          Length = 1878

 Score =  930 bits (2403), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 653/1778 (36%), Positives = 1041/1778 (58%), Gaps = 121/1778 (6%)

Query: 21   ISSFLELDASKVSTLDPAVVRQLSIKANQFGQLKAQNLKYSVTLDELKSSSERRSEAFKL 80
            I+SF      +V +++  +++ L+ K  QF +LK++NL+ +V+ DELK++S ++ +  K 
Sbjct: 24   IASFFGFSFEQVESINSDLIKHLNDKLLQFNELKSENLQITVSFDELKTNSSKKIDNLKK 83

Query: 81   QLEKINENTESLRXXXXXXXXXXXXLIDEKANASKEVNLLKSQLTELKQQNEIFRSSKQD 140
            ++E + +  + +R              +EK   S E+  +K +  +L ++ +  + ++Q 
Sbjct: 84   EMENLIKQNDGIRKERDDTCDKLESEKNEKTKISNELESIKRRADDLIEEKKELQCNQQR 143

Query: 141  VVQLLNEKIGDLEASQDEAKQLLQNTKTLRKQVLELENEVQTFKSNDLRGKAEMQRLTQE 200
             +++L+E++ +LE ++ +  +     K LR  +++LE + Q   ++DL  +AE++R  QE
Sbjct: 144  TLKILDERLKELEIARSDNNRSDNECKRLRSTIIDLETKQQDLITSDLNSRAELERKAQE 203

Query: 201  MNLLKSNNQWLEKELASKSEEFGSYRQRVNSELQTALSELNXXXXXXXXXXXXXQTLKSR 260
            +N+L+S N WLEKEL SK+E++ SYR++ +  +    +ELN               L  +
Sbjct: 204  LNILQSTNDWLEKELCSKNEQYLSYRKKTDKIILEIRNELNHLRSDFQVEKTKNDVLTQK 263

Query: 261  ANDLSQQLQDKMTELKSLRDSSSIEKQEFTREMTLKQRLIDLLEKQIESFKTELESARNK 320
             ++LS+ LQ+K+ E+KSL D  S EKQEF+ E+ LKQRL+DLLE Q+ + K EL+S R  
Sbjct: 264  NDELSKSLQEKLLEIKSLSDCLSSEKQEFSTEINLKQRLVDLLESQLNAVKEELDSTRGL 323

Query: 321  SVSNSD--HVDAERXXXXXXXXXXXXXXXXXXXXAVKLEETVDELLSTDGERGAGNTSKV 378
              SN    H+ +E+                     ++L   + E   TD E G+  +   
Sbjct: 324  ETSNDSKKHM-SEKEDLVKELQLTKEELAQCKSECIRLSSIIGE---TDEESGSSTSRSS 379

Query: 379  SLDSKNSIVPKLHGDIGLLKKRLIQERRQKEQLQYQVEAFVLELEHKVPVLNSFKERTEM 438
            S             D  LLKK+LI+E+R KE LQ Q+E+F+LELEHKVP++NSFKERT+ 
Sbjct: 380  S-------------DFILLKKQLIKEKRAKEHLQNQIESFILELEHKVPIINSFKERTDT 426

Query: 439  LEKELSDVALMLEATSKDKEEKEHELTSVKSKIADYETQIHSLVRQRSDLAHQVQHLLIQ 498
            LE EL++ AL+LE TS +K  K  EL++   K+   E  I +L++QR DL  QVQ+LLI 
Sbjct: 427  LENELNNAALLLEHTSNEKNAKIRELSAKSEKLKQCENDIQTLIKQRLDLCRQVQYLLIT 486

Query: 499  VSVRNDSNGPLTPEETNFIKKII-NSSESPVEQDAQRIISERLVRFESMVELQEKNMELL 557
             SV  DS GPL  EE  FI+ I+ N S++  E D+Q+I++ERLV F S++ELQEKN ELL
Sbjct: 487  NSVSKDSKGPLRKEEIMFIQNILQNDSDTATETDSQKIVTERLVEFRSIIELQEKNTELL 546

Query: 558  NSIRNLADKLXXXXXXXXXXXXXXXXXXXXXXXXXILTLQEYNKSLESQLEIIAKERDAF 617
              +RNLAD+L                         ILTL+   + LES++E + KE +  
Sbjct: 547  KIVRNLADRLESNENESKQSLQKIESETINEAKEAILTLKAEKEQLESKVEELEKECENS 606

Query: 618  KILASDKGTSNGPSNVN--SSENRHLVLAEEKIKELENHLSSLTEESAKNIKLLNEEIHS 675
            K L S++ TS+  S +   +   R+L   E +I++L++++S +T ES +N+ LLN+EI  
Sbjct: 607  KALLSNEETSHLNSTIQQLNETKRNL---ECQIQDLQSNISQITRESTENMSLLNKEIQD 663

Query: 676  LYRAQADTSVNLEKERSSRILAEDRSKLISNTLEMTKMENDELRKRFHSLQENILKQDSK 735
            LY +++D S+ L KE+SSRILAE+R KL+SNTL++TK END+LRKRF  LQ  ILKQDSK
Sbjct: 664  LYDSKSDISIKLGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKRFDCLQSTILKQDSK 723

Query: 736  TQQTIESLISCKXXXXXXXXXXXXXXXERDLLRSIQENLKKENESLSEERNNMRILITQL 795
            TQ+T+   ISCK               E+ L    ++NLK+E + LS E+  +RI++TQL
Sbjct: 724  TQETLNEYISCKSKLNICETELYNLKEEQKLKIDSEQNLKQEMQKLSSEKTGLRIMVTQL 783

Query: 796  QTLQTERESLLEETQKNFQGKTNKLETELSDTLEKLDAKSKEISDYISTKDSQEKWYQEK 855
            QTLQ ERE+LL+ET+K++Q K ++LE   ++   +   K + I       +S  +WYQ K
Sbjct: 784  QTLQKERENLLDETRKSYQNKIDELEHAHNELKGEASHKDQRIKQLEEDNNSSIEWYQNK 843

Query: 856  FDRLNEELNNSREKLSSKLTDIQHLELKVESLNNKLEESEARIQAFNALNYSESVESQTE 915
             + L ++  +    ++ K  +I+ L+ KV+SL  +++E++ R+  +N ++ + + +S   
Sbjct: 844  IEVLKKDNESIICSMNDKQAEIEKLQHKVKSLEKEIDENKIRLHTYNVIDGTINDDS--- 900

Query: 916  TLRQELEKTRIKLADAYSQVEQYKSMADSSEESATAIKDALEQSKAEYTEKIETLTKERD 975
             LR+ELEK++I L DAYSQ+++YK + +++ +S   +    E+S  +++ +I+ LT E+ 
Sbjct: 901  -LRKELEKSKISLTDAYSQIQEYKELYETNAKSLKQMHSKFEESSKDFSNRIKNLTNEKS 959

Query: 976  MFKDQVPILKDQISNLNNELNHQKSQFESQISDYTRNLEDLKAKQSELDNMKAEYEQKIS 1035
              ++++ +LK+QI NLNNEL+ Q    + + +++ + +  L+    E++ +K+EYE K+S
Sbjct: 960  SLEEKISLLKEQIFNLNNELDLQNKGMKEEKAEFRKKISILQNNNKEVEAVKSEYESKLS 1019

Query: 1036 KIQEDLNQQTSYANTAQKNYEQELQKHADVSKKISLLRAEAQKYKSETETLRNAAENAKK 1095
            KIQ+DL+QQT YANTAQ NYEQELQKHADVSK IS LR +   Y+ +  TL  +    + 
Sbjct: 1020 KIQKDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYRVQVNTLTLSRNQLES 1079

Query: 1096 ALEQSELSWEKQSSDYEDELRLAHQRIEDLNAQSKILYDQIDFLS---KGKPTSSEDLMP 1152
             L+++E SW  Q     ++L  ++ RIEDL +Q+K+LYDQI+  +   KG  T + D   
Sbjct: 1080 TLKENERSWTSQRKALIEQLESSNSRIEDLTSQNKLLYDQIELYTTADKG-VTDTNDKPA 1138

Query: 1153 ISTETRNLLTSLRREKDILETKLEVSTREEKVLRQKLKLIESDLEGSRIELSKLQRAASG 1212
            +++    +L SLRRE+DIL+TK+ V+ R+ K+LRQK+ L++ +L+ +R +L   +     
Sbjct: 1139 LNS----ILLSLRRERDILDTKVTVAERDAKMLRQKISLMDIELQEARTKLDNSRLEEEK 1194

Query: 1213 NSATLKDQEEIMTQLNQLNLLRESNITLRNEAQKNGERSRELKAELDALYGKVQPLESKV 1272
                ++  E+IM +LNQLNLLRESNITLRNE + N E  R L++ELD L   + P+ES++
Sbjct: 1195 RPTIIQQHEDIMEKLNQLNLLRESNITLRNELENNNEEKRVLQSELDKLKQDIAPIESEL 1254

Query: 1273 TLLQNSVREKDLQISLKNEEAERWKQRSQDILHKYERIDPEEHQKLADKVSELQQEIKSK 1332
              L+ S++EK+ ++ L  EE  RWK+RSQDIL K+ ++   +++KL  ++  L+ ++  K
Sbjct: 1255 AALKYSMQEKEQELRLTKEEVHRWKKRSQDILEKHRQMSSSDYEKLEHEIDSLKVKLDEK 1314

Query: 1333 SDENEELDTRFKRLKQQAHEKLNAAKTAQSTLTSQLNDLKATKEKLENDLGSQKEEVKNL 1392
            + +  E + RF RL++QA E+L  +K +  TLT Q+NDLK  K KLE  L     +++ L
Sbjct: 1315 TRQGAEAEERFNRLRRQAQERLKTSKLSLDTLTEQVNDLKNAKIKLEKSLDDANTKIEEL 1374

Query: 1393 ESKITDIEKNKSSEKNDLQEQLENSQAKLLETENKLEQVTSSSALLEKELNERIESLMNK 1452
            E+   + + N+      LQ+  ENS     E + KLE+  +      K+LNE I +L  +
Sbjct: 1375 ENAKAEQDNNQLDAIKRLQQDAENSSK---EFKTKLEEKATFYDSTIKKLNEEIITLREE 1431

Query: 1453 IKLLEEDLEKAKTESPNDGSQSSELVENTSKIVENLKIEFEEEKAKMISDKESELREQFE 1512
            I+      ++ ++E  N+ +       + SKIVE++K  FEE+K   I +K  E+ E+  
Sbjct: 1432 IEKQRRIQQQLQSEPANEQN-------DLSKIVESMKKTFEEDKINFIREKTKEVNEK-- 1482

Query: 1513 EEKASILEAKEQELREQLATQKLDPP--VNIDEIKKKWEEEYEQKTSQRIRESNEQLKKR 1570
                 ILEA+E          +L+ P  +NIDE+K KW+ E+E++   RIRE+ E LKKR
Sbjct: 1483 -----ILEAQE----------RLNQPSNINIDELKIKWKAEHEEEVVNRIREAEEALKKR 1527

Query: 1571 IRLPTEEKINKIVEKKRLELEAEFEANVQKKAEEIXXXXXXXXX-----------XXTEV 1619
            IRLPTEEKI+KI+E+KR +LE EF+  V+++ + +                       E+
Sbjct: 1528 IRLPTEEKISKIIERKREDLEKEFDEKVEERIKLLSQSGQMDVTFQKQFEIRIQEKQKEL 1587

Query: 1620 LEKHKQDLENLKQ------------------EMQKKFDEDIAQIKKRAFEEGKQQASMKS 1661
             +K+ + L+ L                    +M+K+ D ++  IKK++FEEGKQQA MK+
Sbjct: 1588 EDKYNEKLKELSHSNSISIDERDQLRAEIETKMRKELDNELQHIKKKSFEEGKQQAMMKT 1647

Query: 1662 TFLEKKIAKLETQIKAHDSAIPINDNSSATPAESGPTTQDVKQLTPILNNQAAILPGK-- 1719
            T LE+K+AK+E+Q+             + +P++    TQ          NQ   LP K  
Sbjct: 1648 TLLERKLAKMESQLSETKKI-------TESPSKHVNHTQ----------NQLLGLPRKIE 1690

Query: 1720 ---PLPFNP---AHFAFGMPFGQTTSNSFQNPFNSQPP 1751
                  FNP         +    ++S  F NPF S  P
Sbjct: 1691 ENSSSSFNPLLSGEKLLKLNSKSSSSGGF-NPFTSPSP 1727

>NCAS0A03200 Chr1 complement(627997..633363) [5367 bp, 1788 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1788

 Score =  897 bits (2318), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 620/1785 (34%), Positives = 1032/1785 (57%), Gaps = 104/1785 (5%)

Query: 8    TTPSVIGEIDVTTISSFLELDASKVSTLDPAVVRQLSIKANQFGQLKAQNLKYSVTLDEL 67
            T    + + ++T I SFL +   +++ ++ +++  L  K  QF +L++Q+LK  V+L+EL
Sbjct: 3    TAADTLTKEELTLIGSFLSVPVEQLNAIETSILSNLKTKVEQFTELQSQSLKNEVSLEEL 62

Query: 68   KSSSERRSEAFKLQLEKINENTESLRXXXXXXXXXXXXLIDEKANA---SKEVNLLKSQL 124
            + +S+ R    + QLE + E   S              L DEK  +   S   + L+++L
Sbjct: 63   QKTSQGRINDLRTQLEDLIEQNAS---ASEEKKKIEKELSDEKKESFQLSSTRDNLRAEL 119

Query: 125  TELKQQNEIFRSSKQDVVQLLNEKIGDLEASQDEAKQLLQNTKTLRKQVLELENEVQTFK 184
             E++++ +  +   QD ++LL+ KI   E  ++   +L    +    +  +LE+E+Q+ K
Sbjct: 120  KEIQEKFDNLQKQNQDTIKLLDRKISQNEVEKELTLKLTNQYRESTAKCHDLEDEIQSLK 179

Query: 185  SNDLRGKAEMQRLTQEMNLLKSNNQWLEKELASKSEEFGSYRQRVNSELQTALSELNXXX 244
             ND   +  M +L+Q++  +    + LE EL +K ++   Y     +E+QT   +++   
Sbjct: 180  YNDSLTETTMNKLSQDLKSISEIKERLETELENKDKKMSEYYSNCQAEIQTLRKKISTLE 239

Query: 245  XXXXXXXXXXQTLKSRANDLSQQLQDKMTELKSLRDSSSIEKQEFTREMTLKQRLIDLLE 304
                        LK     +S  L +K ++++ L +  + EK+E  +E++LKQ +ID+L+
Sbjct: 240  NNCSIIKSENDALKKENRIVSSNLHEKSSKVQELTNLYNTEKEESQKELSLKQEMIDVLQ 299

Query: 305  KQIESFK---TELESARNKSVSNSDHVDAERXXXXXXXXXXXXXXXXXXXXAVKLEETVD 361
             Q++  +   T + + +   V N    D ER                     +++EE   
Sbjct: 300  TQVQKLQDDYTRILNTKQPIVQN----DEERN--------------------LEVEELKQ 335

Query: 362  ELLSTDGE--RGAGNTSKVSLDSKNSIVP-KLHGDIGLLKKRLIQERRQKEQLQYQVEAF 418
            +L+ T+ +  +       +++ +++S +  +   D+  +KK LIQER QKE+LQ QVE F
Sbjct: 336  KLIETETQLNKELEERRNITMQTESSTLSNQQQEDLDTIKKELIQERYQKEKLQNQVEIF 395

Query: 419  VLELEHKVPVLNSFKERTEMLEKELSDVALMLEATSKDKEEKEHELTSVKSKIADYETQI 478
            ++ELE KVP +NSFK+RT+MLEKEL+D  L+LE   ++K +  +EL +++      + + 
Sbjct: 396  IVELEKKVPTINSFKQRTDMLEKELTDATLLLENLRREKNQVTNELDALRQNFKSVKWET 455

Query: 479  HSLVRQRSDLAHQVQHLLIQVSVRNDSNGPLTPEETNFIKKIINSSESPVEQDAQRIISE 538
             SL +QR+DLAHQ+Q++LI  SV+NDSNGPL+ EE  FI+ I+++  +    D+Q++ISE
Sbjct: 456  KSLTKQRNDLAHQLQYILIHTSVQNDSNGPLSAEEVRFIQDILDNESNEESSDSQQVISE 515

Query: 539  RLVRFESMVELQEKNMELLNSIRNLADKLXXXXXXXXXXXXXXXXXXXXXXXXXILTLQE 598
            RLV F+++VELQ+KN++LL S+R LA KL                         I++LQ 
Sbjct: 516  RLVTFQNIVELQQKNIDLLKSVRELARKLELQEEHQQSTSQVVEQQAIDEAKEAIISLQS 575

Query: 599  YNKSLESQLEIIAKERDAFKILASDKGTSNGPSNVNSSENRHLVLAEEK---IKELENHL 655
            YN  LE +++ +  E D +K L         P      E  HL L EE    IKELE  L
Sbjct: 576  YNTKLEDKIKTLNDELDCYKSL---------PKPDTKVETEHLRLNEENTDLIKELETRL 626

Query: 656  SSLTEESAKNIKLLNEEIHSLYRAQADTSVNLEKERSSRILAEDRSKLISNTLEMTKMEN 715
            ++  EES K    LN EI  + R  + T    + ER+SR LAE R KLI N+L ++K+EN
Sbjct: 627  ATSREESNKTFASLNNEIDDIRRNHSQTVKECQNERASRELAEQRLKLIQNSLSLSKVEN 686

Query: 716  DELRKRFHSLQENILKQDSKTQQTIESLISCKXXXXXXXXXXXXXXXERDLLRSIQENLK 775
            ++L+KR   LQ+  LKQD +TQ+T++  +SCK               + ++ ++ +++LK
Sbjct: 687  EQLQKRLEILQDITLKQDQRTQETLKEYVSCKVALSNSQNELNYIQSQLNISKTNEKSLK 746

Query: 776  KENESLSEERNNMRILITQLQTLQTERESLLEETQKNFQGKTNKLETELSDTLEKLDAKS 835
             +   +S+ERN ++ L++QLQ+LQTERE +   T+ + Q + + +E EL D  EKL  K 
Sbjct: 747  DDITIVSKERNELKELVSQLQSLQTEREQIFNSTKLDSQTRLDTVERELYDISEKLKNKD 806

Query: 836  KEISDYISTKDSQEKWYQEKFDRLNEELNNSREKLSSKLTDIQHLELKVESLNNKLEESE 895
            +EI +  S + S+ +WYQ K D + E+ +  +++L  K  +I  L  +++ L   L+ SE
Sbjct: 807  REIKELESNRLSEIEWYQNKIDAIKEKRDAYQDELLEKTNEIGELNYEIKKLQKDLQASE 866

Query: 896  ARIQAFNALNYSESVESQTETLRQELEKTRIKLADAYSQVEQYKSMADSSEESATAIKDA 955
            +R+ A+  LN S++V ++ ETL+ ELEK++I L++AY++++QYK  A   EE     ++ 
Sbjct: 867  SRVTAYKVLNNSDNVGTKMETLQNELEKSKINLSEAYAELDQYKQSASEKEEFLENYQNT 926

Query: 956  LEQSKAEYTEKIETLTKERDMFKDQVPILKDQISNLNNELNHQKSQFESQISDYTRNLED 1015
            +E++K E+  KIETL K+RD   D   IL +QI++LNNEL+HQ      + S+ ++ L +
Sbjct: 927  VEETKKEFIRKIETLQKDRDELLDTKSILSEQITDLNNELDHQNKAHLEEKSEISKKLNE 986

Query: 1016 LKAKQSELDNMKAEYEQKISKIQEDLNQQTSYANTAQKNYEQELQKHADVSKKISLLRAE 1075
            L A+   ++ +  +YE K+S +Q DL QQ SYAN AQ NYEQELQKHA+++K IS LR +
Sbjct: 987  LLAQNHNIEEVSNQYELKLSTLQNDLEQQASYANIAQNNYEQELQKHAELAKTISQLRED 1046

Query: 1076 AQKYKSETETLRNAAENAKKALEQSELSWEKQSSDYEDELRLAHQRIEDLNAQSKILYDQ 1135
            A  Y+ + ++++  A   ++ L ++E  WE+Q   YED++    +RIEDL++Q+K+L+DQ
Sbjct: 1047 AHTYRKKMDSMQANATTNEELLRKNEKLWEEQRKSYEDQIHALKKRIEDLSSQNKLLFDQ 1106

Query: 1136 IDFLSKGKPTSSEDLMPISTETRNLLTSLRREKDILETKLEVSTREEKVLRQKLKLIESD 1195
            +D LSK +  +S +    +T   +L+ SLR ++DIL+T+L V+  E K LR KL  + ++
Sbjct: 1107 VDLLSKSE--NSYNQQSSATPNEDLVLSLRSDRDILQTRLSVTEEEGKALRLKLSSVNTE 1164

Query: 1196 LEGSRIELSKLQRAASGNSATLKDQEEIMTQLNQLNLLRESNITLRNEAQKNGERSRELK 1255
            L  +R +L+++++       ++++ + IM QLNQLNLLRESNITLRNEA  + E++++L+
Sbjct: 1165 LTNTRAKLTEIRQQYENTKISVEEHDNIMNQLNQLNLLRESNITLRNEANDSREKAKQLQ 1224

Query: 1256 AELDALYGKVQPLESKVTLLQNSVREKDLQISLKNEEAERWKQRSQDILHKYERIDPEEH 1315
             +L+ L  KV PLE++   L+  ++E + Q++   EE  RWKQRSQDIL K+++IDP EH
Sbjct: 1225 EDLETLREKVLPLEAEQNRLKEVIKENEQQLNAYKEECNRWKQRSQDILTKHKKIDPVEH 1284

Query: 1316 QKLADKVSELQQEIKSKSDENEELDTRFKRLKQQAHEKLNAAKTAQSTLTSQLNDLKATK 1375
            +KL  +++ L+Q +  K  ENEEL+ RF R+K+QAHE+LN++K  Q TL  Q+  L+   
Sbjct: 1285 EKLEAEIATLKQNLADKKKENEELNDRFNRIKKQAHERLNSSKATQQTLIDQIKQLEDEN 1344

Query: 1376 EKLENDLGSQKEEVKNLESKITDIEKNKSSEKNDLQEQLENSQAKLLETENKLEQVTSSS 1435
              +++ L +++  ++N E K   + K +S +   L+ QLE +     E ENK      SS
Sbjct: 1345 AHIQSLLETERGNIQNTEEKFRQMNK-QSEDVTALRSQLEEALLSSKEFENKFNASVKSS 1403

Query: 1436 ALLEKELNERIESLMNKIKLLEE--DLEKAKTESPNDGSQSSELVENTSKIVENLKIEFE 1493
              +   LN+ I+SL N++  L+E  + E   T  P           + S +VE +K  FE
Sbjct: 1404 DEISSHLNDVIDSLNNELTHLKESKNNEATVTGQP-----------DLSNVVEEMKKSFE 1452

Query: 1494 EEKAKMISDKESELREQFEEEKASILEAKEQELREQLATQKLDPPVNIDEIKKKWEEEYE 1553
            EEK K + D+ +E +E+  EE   I EA+  + + +  T    P  +I   +++WE+EYE
Sbjct: 1453 EEKIKFVQDQTTEFKEKLAEEVKRI-EAQATDTQNKNVT----PLQDISAQREQWEKEYE 1507

Query: 1554 QKTSQRIRESNEQLKKRIRLPTEEKINKIVEKKRLELEAEFEANVQKKAEEIXXXXXXXX 1613
            +   +RI ++ E LK+RIRLPTEEKIN +++KK+ ELE E++  V ++A+E+        
Sbjct: 1508 EIVLKRIEQAEENLKRRIRLPTEEKINSVIQKKKNELEKEYDEKVNQRAKEL-------- 1559

Query: 1614 XXXTEVLEKHKQDLEN-LKQEMQKKFDEDIAQIKKRAFEEGKQQASMKSTFLEKKIAKLE 1672
               +E  +   +DL+N +K+E+++  D+++   K +AFEEGKQQA MK+TFLEKKI+KLE
Sbjct: 1560 -LSSEENKTFIEDLKNDIKKELERNIDQELKNAKAKAFEEGKQQAMMKTTFLEKKISKLE 1618

Query: 1673 TQIKAHDSA------------IPINDNSSATPAE---SGPTTQDVKQLTPILNNQAAILP 1717
            +Q++  ++A             P ++N+  +  E   S P    ++   P+L+       
Sbjct: 1619 SQLQGSNAANENKNDVEVLLKTPSDENNVPSKQEETLSKPQLSKIQIANPLLST-----G 1673

Query: 1718 GKPLPFNPAHFAFGMPFGQTTSNSFQNPFNSQPPEQTPNSPKRPS 1762
            G  L  N +     +  G  +SN F +PF     +QT N    P+
Sbjct: 1674 GTTLALNQSRAPSSLQNGSDSSNPFTSPF-----QQTKNDANIPA 1713

>CAGL0G02497g Chr7 (223375..228717) [5343 bp, 1780 aa] {ON} similar to
            uniprot|Q02455 Saccharomyces cerevisiae YKR095w MLP1
          Length = 1780

 Score =  842 bits (2176), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 620/1826 (33%), Positives = 1052/1826 (57%), Gaps = 134/1826 (7%)

Query: 21   ISSFLELDASKVSTLDPAVVRQLSIKANQFGQLKAQNLKYSVTLDELKSSSERRSEAFKL 80
            I++FL ++ S V +L   +   +  KA +F QL++ NL+ +V L+E K++   + E  K 
Sbjct: 9    IATFLNVERSNVESLAQELKDAILSKAEEFAQLQSDNLRTNVLLEETKANLSSKYEKLKE 68

Query: 81   QLEKINENTESLRXXXXXXXXXXXXLIDEKANASK--EVNLLKSQLTELKQQNEIFRSSK 138
            +L+ + E+   +R            L  E ++ SK  E+N LK+    L  QN I R+++
Sbjct: 69   ELDYVVEDNTKVRAENKTLSEKVWSL--ETSDNSKLAEINQLKTSNEGL--QNNIDRANE 124

Query: 139  Q--DVVQLLNEKIGDLEASQDEAKQLLQNTKTLRKQVLELENEVQTFKSNDLRGKAEMQR 196
            +  ++    +EK+ +LE  +DE K+L    KTL  ++LELE + Q ++S++L  K+E++R
Sbjct: 125  RYKELNGSYDEKVTELEHIRDEKKELQTQIKTLNDKILELELKCQEYQSSELNRKSELER 184

Query: 197  LTQEMNLLKSNNQWLEKELASKSEEFGSYRQRVNSELQTALSELNXXXXXXXXXXXXXQT 256
              QE+ LL+ N +WLE+EL +K++ F  YR++ +  +  A++ +              + 
Sbjct: 185  NAQEILLLRKNQEWLEQELTNKNQHFMFYRKKTDLMVHDAVTNVEKLKSDLKIEKSSKEI 244

Query: 257  LKSRANDLSQQLQDKMTELKSLRDSSSIEKQEFTREMTLKQRLIDLLEKQIESFKTELES 316
            L  + ++ ++QLQ+ + E K L+D  ++EKQEF +E+++K +LI L E QI+S ++ L+ 
Sbjct: 245  LSKKLDETTEQLQNNLIENKDLKDVLAVEKQEFDKELSIKDKLIKLYENQIKSLESTLQQ 304

Query: 317  ARNKSVSNSDHVDAERXXXXXXXXXXXXXXXXXXXXAVKLEETVDE-----LLSTDG--- 368
                + +N ++                          V+LE  +D       L T G   
Sbjct: 305  KFKTAEANEENSSEVVKSLKEELSLAERKLQDMEEKCVRLESILDHDSNDVSLQTKGRKR 364

Query: 369  ------------ERGAGNTSKVSLDSKNSIVPKLHGDIGLLKKRLIQERRQKEQLQYQVE 416
                        E G+ + S +SL        ++ GDI +LK++L+QE+RQKE+LQ QVE
Sbjct: 365  TYSNDSNSNSSDELGSFDDSSISL-------SRMQGDIKILKRQLVQEKRQKEKLQNQVE 417

Query: 417  AFVLELEHKVPVLNSFKERTEMLEKELSDVALMLEATSKDKEEKEHELTSVKSKIADYET 476
            +FV+ELEHK+PV+NSF+ERT +LEKEL+D AL+LE  +K+ E K +EL S+K KI+D  +
Sbjct: 418  SFVIELEHKIPVINSFQERTSVLEKELTDTALLLEHATKENELKTNELQSLKKKISDDNS 477

Query: 477  QIHSLVRQRSDLAHQVQHLLIQVSVRNDSNGPLTPEETNFIKKIINSSESPVEQDAQRII 536
            Q+  L+RQR+DLAHQ+Q+LLI +S+ ND++  L  +E  FIK ++++       D+Q++I
Sbjct: 478  QLEILLRQRTDLAHQLQYLLINISIINDNDHLLNEDEIKFIKNLVSNDNMASTNDSQKVI 537

Query: 537  SERLVRFESMVELQEKNMELLNSIRNLADKLXXXXXXXXXXXXXXXXXXX---XXXXXXI 593
            SE L++F+ + +LQEKNMEL+ ++R LA +L                            I
Sbjct: 538  SEHLIKFKDIQQLQEKNMELVKTVRTLAQQLEENEEKKKSTSNNTVDEDNEIFAEAKEAI 597

Query: 594  LTLQEYNKSLESQLEIIAKERDAFKILASDKGTSNGPSNVNSSENRHLV--LAEEKIKEL 651
            LTL++ N++LE  L+I+ KERDAFK+L S+    N  S+ NS    H +    E  +K+L
Sbjct: 598  LTLEKVNENLEKNLQIVTKERDAFKLLVSEDRERNFKSS-NSVHKYHELKSYNETVVKDL 656

Query: 652  ENHLSSLTEESAKNIKLLNEEIHSLYRAQADTSVNLEKERSSRILAEDRSKLISNTLEMT 711
            EN L+ LT +S  + K L EE++ L++  +  +V +EK RS++ LAE+R K+  N++E+ 
Sbjct: 657  ENRLTQLTNDSNAHSKALTEELNLLHKEISQLNVQIEKYRSAKSLAEERLKITQNSMELL 716

Query: 712  KMENDELRKRFHSLQENILKQDSKTQQTIESLISCKXXXXXXXXXXXXXXXERDLLRSIQ 771
              EN++LR R   L++++L+QD +TQ+T  S +                  E  LL+  +
Sbjct: 717  SKENEQLRIRSSRLEDSLLQQDKETQKTFSSYVEAISKNSSLETSVRNLETEVTLLKDRE 776

Query: 772  ENLKKENESLSEERNNMRILITQLQTLQTERESLLEETQKNFQGKTN-------KLETEL 824
             +LK E  + +EE+  +RI++TQLQ+LQ+ERE+LLE  Q +F+ + +       KL+ +L
Sbjct: 777  ISLKSELSNTTEEKTKLRIMVTQLQSLQSERETLLERVQSDFKKRISEVNYINEKLDKQL 836

Query: 825  SDTLEKLDAKSKEISDYISTKDSQEKWYQEKFDRLNEELNNSREKLSSKLTDIQHLELKV 884
            S+ + ++D   KE       +++Q +WYQ+K D  +++    + +L +K  +++ L L+ 
Sbjct: 837  SERVHEIDKIEKE-------RNAQYEWYQKKIDEASQQQQQIQGQLQTKNDELERLHLQN 889

Query: 885  ESLNNKLEESEARIQAFNALNYSESVESQTETLRQELEKTRIKLADAYSQVEQYKSMADS 944
            ++L  +LE ++ RI  +  +N + S   +   + +ELEKT+I+LADAYSQ+E++K+++ +
Sbjct: 890  KTLEKELEGAQIRIHTYETINQNNSENQEENDVIKELEKTKIELADAYSQLEEFKNLSQN 949

Query: 945  SEESATAIKDALEQSKAEYTEKIETLTKERDMFKDQVPILKDQISNLNNELNHQKSQFES 1004
            SE++   +  +      +Y + I+TLT+E+   + +  ILK Q+ N+ NEL  Q  + ES
Sbjct: 950  SEDALKELNASFNAKDRDYRDAIKTLTEEKTEIEGRFEILKQQLENIKNELTVQSEEAES 1009

Query: 1005 QISDYTRNLEDLKAKQSELDNMKAEYEQKISKIQEDLNQQTSYANTAQKNYEQELQKHAD 1064
            +    T+ + +L+     ++ +K  +E+K+ K++ DL +QT YAN AQKNYEQELQ+HAD
Sbjct: 1010 ERKRLTQTIAELQGAAQPIEEVKKMFEEKLQKLENDLEEQTVYANNAQKNYEQELQRHAD 1069

Query: 1065 VSKKISLLRAEAQKYKSETETLRNAAENAKKALEQSELSWEKQSSDYEDELRLAHQRIED 1124
            VSK IS LR + Q+ K++T++L    ++ +  + Q+E   + +  +Y  ++ LA QRI+D
Sbjct: 1070 VSKTISELREQNQRLKNDTKSLTAELQSLQDQMSQNEKHLKSERDEYRIQIDLAQQRIDD 1129

Query: 1125 LNAQSKILYDQIDFLSKGKPT---SSEDLMPISTETRNLLTSLRREKDILETKLEVSTRE 1181
            +  Q+++LY+QID L++ +     SS+D    ST    L+ SLRRE+DIL+TK+ V   E
Sbjct: 1130 ITKQNQLLYNQIDLLNRAESVNENSSDDEANGSTA---LVLSLRRERDILDTKINVIETE 1186

Query: 1182 EKVLRQKLKLIESDLEGSRIELSKLQRAASGNSATLKDQEEIMTQLNQLNLLRESNITLR 1241
            +  L+QKL  I+++LE ++   + L+   S +S  + + + I   L QLNLLRESN+TLR
Sbjct: 1187 KNSLQQKLDDIQNELENTKRSAALLESEYSEHSDLINNYQTIRGDLEQLNLLRESNVTLR 1246

Query: 1242 NEAQKNGERSRELKAELDALYGKVQPLESKVTLLQNSVREKDLQISLKNEEAERWKQRSQ 1301
            NE ++  +   ++  +L     ++ PL+S +    N ++EKDL+I+  N+E++RWK R +
Sbjct: 1247 NELKQALDEKDKIAKDLQICRNELLPLQSNLESANNLIKEKDLKIASANDESQRWKTRLE 1306

Query: 1302 DILHKYERIDPEEHQKLADKVSELQQEIKSKSDENEELDTRFKRLKQQAHEKLNAAKTAQ 1361
            +++ K+++++ +++ KL + ++E +Q + +K  E  EL+ RF RLK+QAHEKLN +K  Q
Sbjct: 1307 EMIEKHQKVNVDDYTKLEETLNETKQLLDNKVQETNELNDRFNRLKKQAHEKLNTSKELQ 1366

Query: 1362 STLTSQLNDLKATKEKLENDLGSQKEEVKNLESKITDIEKNKSSEKNDLQEQLENSQAKL 1421
            S+L  Q+++L + K+ +   L  + EE   L S++ +  + K ++   L+E+L    +K 
Sbjct: 1367 SSLQEQISNLISEKDDIRKQLDVKTEENSELLSELNNF-REKQNDLETLREELNKEISKS 1425

Query: 1422 LETENKLEQVTSSSALLEKELNERIESLMNKIKLLEEDLEKAKTESPNDGSQSSELVENT 1481
             E E KL+    SS+L  +  N+ IE L   I  L+  L           + S++  E T
Sbjct: 1426 EELEVKLQNEIESSSLASRNTNKEIEELQKVIDDLKTQL----------AANSTDADEQT 1475

Query: 1482 SKIVENLKIEFEEEKAKMISDKESELREQFEEEKASILEAKEQELREQLATQKLDPPVNI 1541
            ++ VE +K EFE +K K I++K  E  ++  EE   I      E +E    +K D  +N+
Sbjct: 1476 NRNVEAIKREFENQKTKFIAEKTEEFNKRLIEETEKI----RNEFQE---NEKPDTELNV 1528

Query: 1542 D--EIKKKWEEEYEQKTSQRIRESNEQLKKRIRLPTEEKINKIVEKKRLELEAEFEANVQ 1599
            D   ++K+WEE+ E+   +RI E+ + LKKRIRLP+EEKINKI+EK+R ELE+EF+  ++
Sbjct: 1529 DVEALRKQWEEDSEELIQKRIAEAEDNLKKRIRLPSEEKINKIIEKRRSELESEFDQKIR 1588

Query: 1600 KKAEEIXXXXXXXXXXXTEVLEKHKQDLEN-----LKQEMQKKFDEDIAQIKKRAFEEGK 1654
             KA ++             ++  H  +  N     L++E++++F++++   +K+AFEEGK
Sbjct: 1589 DKARDL-------------LMNDHSNEFNNELKEALEKELKERFEDELQAARKKAFEEGK 1635

Query: 1655 QQASMKSTFLEKKIAKLETQI--KAHDSAIPINDNSSATPAESGPTTQDVKQLTPILN-- 1710
            QQA+MK+T LE+KI KLE+QI  K  DS     +     P E+  +T  VK++   LN  
Sbjct: 1636 QQATMKTTLLERKIQKLESQIQEKEKDSE----ETQDVKPEEN--STPSVKKIPETLNSS 1689

Query: 1711 -------NQAAIL-PGKPLPFNPAHF------------AFGMPFGQTTSNSFQNPFNSQP 1750
                   N   +L P  P     A              AF   F  T    F++  + Q 
Sbjct: 1690 DTSFGNSNNVKVLKPSSPFGATSAFNNPFTFNNNGNPPAFASAFAPT----FKDLMSGQG 1745

Query: 1751 PEQTPNSP-KRPSEEPVGGSPEKKPK 1775
             +Q+  S  KR  ++ +  +  KK K
Sbjct: 1746 GQQSELSQNKRVGDDDIETNELKKSK 1771

>NDAI0E05040 Chr5 (1150358..1156279) [5922 bp, 1973 aa] {ON} Anc_5.702
            YIL149C
          Length = 1973

 Score =  787 bits (2033), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 593/1744 (34%), Positives = 996/1744 (57%), Gaps = 50/1744 (2%)

Query: 7    PTTPS---VIGEIDVTTISSFLELDASKVSTLDPAVVRQLSIKANQFGQLKAQNLKYSVT 63
            PTT S    +    +  ++SFL+     V TLD  +++ L+ + ++F  ++ + +K S  
Sbjct: 7    PTTDSNKNPLSSATIAKVASFLDTSPDVVQTLDETILKSLNNRFDEFNHIENEQIKISTE 66

Query: 64   LDELKSSSERRSEAFKLQLEKINENTESLRXXXXXXXXXXXXLIDEKANASKEVNLLKSQ 123
            L+  K ++    +  K +L ++ ++ ES+               ++K +   E+     Q
Sbjct: 67   LEVTKKTNNTTIKKLKNELTELIDSYESVCKEKEDAYKKIAEEEEKKIDNRDELESKLIQ 126

Query: 124  LTELKQQNEIFRSSKQDVVQLLNEKIGDLEASQDEAKQLLQNTKT-LRKQVLELENEVQT 182
            +  L++     +S KQ++++ L+++I +L   +    +LL N K+  R ++L+LENE Q 
Sbjct: 127  IHSLEENVSELQSKKQELIKSLDDRITELNEYRHNI-ELLNNEKSKTRNKILQLENENQD 185

Query: 183  FKSNDLRGKAEMQRLTQEMNLLKSNNQWLEKELASKSEEFGSYRQRVNSELQTALSELNX 242
             K NDL  + +++RL+QE+  +     WLE+ L  K E+F SYR++  +E Q    +LN 
Sbjct: 186  LKINDLSQRTQLERLSQELETINKEKLWLEERLGEKGEQFDSYREKSINENQDLKLQLNT 245

Query: 243  XXXXXXXXXXXXQTLKSRANDLSQQLQDKMTELKSLRDSSSIEKQEFTREMTLKQRLIDL 302
                          L+ R ++LS +L+D  T LK+++ S + +K    +E+TLKQ+LI +
Sbjct: 246  VKNELDQMKSTNCVLQERTDELSNKLRDTSTNLKNIQQSRNNDKATHEKELTLKQQLIVV 305

Query: 303  LEKQIESFKTELESARNKSVSNSDHVDAERXXXXXXXXXXXXXXXXXXXXAVKLEETVDE 362
            L+ Q+   + E  +    S++ SD   + R                       +E  ++ 
Sbjct: 306  LQSQLNELQRE--NGNELSLTVSDTASSSRKDSDFTREINDLKNQLNHVQERNVE--LEF 361

Query: 363  LLSTDGERGAGNTSKVSLDSKNSIVPKLHGDIGLLKKRLIQERRQKEQLQYQVEAFVLEL 422
             L    +  A + S  S D +NS+  K + DI +LKK+L  E+ Q+E  +  +E F+ +L
Sbjct: 362  KLRKSEDYTAVSNSTSSDDLRNSL-AKAYDDIDVLKKKLNDEQSQRENFEKNLEEFMDDL 420

Query: 423  EHKVPVLNSFKERTEMLEKELSDVALMLEATSKDKEEKEHELTSVKSKIADYETQIHSLV 482
            E ++P L +++ R    E+EL +  L+LE  +K+K     EL   +S+I   E +I  + 
Sbjct: 421  ETELPTLEAYRHRAAAREEELKEATLLLEKANKEKSLVSSELNQAQSRIQSIEQEIKLVA 480

Query: 483  RQRSDLAHQVQHLLIQVSVRNDSNGPLTPEETNFIKKIINSSE--SPVEQDAQRIISERL 540
            +QRSDLA+Q+Q  L+  SV NDS GPLT EE  FI+ II   +     E D Q++ISERL
Sbjct: 481  KQRSDLANQLQFFLVHNSVANDSAGPLTDEEVKFIRNIIQEDDEMHDKETDTQKVISERL 540

Query: 541  VRFESMVELQEKNMELLNSIRNLADKLXXXXXXXXXXXXXXXXXXXXXXXXXILTLQEYN 600
             +F+ ++ELQ+KNMELL + R LA KL                         ILTLQ YN
Sbjct: 541  TKFKDIIELQQKNMELLKTTRELATKLEEEDKIKQAEKSRIEEETIAEAKEAILTLQNYN 600

Query: 601  KSLESQLEIIAKERDAFKILASDKGTSNGPSNVNSSENRHLVLAEEKIKELENHLSSLTE 660
             SL +++  + KE + +K+L++ + +S  P++ +    +  +   + +KELE  ++S+ +
Sbjct: 601  SSLTAKIAALTKELETYKVLSNTEDSS-TPADFDKQREQREIEHTQLVKELETRIASIIQ 659

Query: 661  ESAKNIKLLNEEIHSLYRAQADTSVNLEKERSSRILAEDRSKLISNTLEMTKMENDELRK 720
            ES +N  +LN++I +L       S+ L +E+S++ LAE+R KL+  +++MT  EN+ L+K
Sbjct: 660  ESKENANILNDKIFALDEKNNHISIELAREKSAKQLAEERLKLLQKSMDMTITENERLQK 719

Query: 721  RFHSLQENILKQDSKTQQTIESLISCKXXXXXXXXXXXXXXXERDLLRSIQENLKKENES 780
            R +SL+  +++QD +T +TI SLI  +               E  LL S +E LK E   
Sbjct: 720  RLNSLRNVVVEQDKRTHETINSLIKTRSELATVENKWNVSQNEIKLLHSSEEMLKNELTR 779

Query: 781  LSEERNNMRILITQLQTLQTERESLLEETQKNFQGKTNKLETELSDTLEKLDAKSKEISD 840
            L+EE+N+M++L+T+LQTLQ+ERE LL  TQ  F  + N LE   +D  +KL    +    
Sbjct: 780  LNEEKNSMKLLVTRLQTLQSEREHLLSTTQDKFNKELNDLEGTCNDLRKKLKEAEENYGS 839

Query: 841  YISTKDSQEKWYQEKFDRLNEELNNSREKLSSKLTDIQHLELKVESLNNKLEESEARIQA 900
             +      +  +++K   L EE++N  ++ S  +   +  + +   L  +L+E    I+ 
Sbjct: 840  LMEETTELKDDFRQKKKSLKEEMSNVEKRYSEIVEKERETKWENTRLTKQLKEKTELIEK 899

Query: 901  FNALNYSESVESQTETLRQELEKTRIKLADAYSQVEQYKSMADSSEESATAIKDALEQSK 960
            + A +  E    +  +L++EL+  + +L ++YSQ E Y+   +   +S   I   +   +
Sbjct: 900  YKAASDDEGKLEEISSLQKELQVLKNELTESYSQTESYRKDIELLNQSIADINKQVLNKE 959

Query: 961  AEYTEKIETLTKERDMFKDQVPILKDQISNLNNELNHQKSQFESQISDYTRNLEDLKAKQ 1020
            A + E+I  +   ++   D   +LK QI +LNNEL  QK  +E +  ++TRN  +L+   
Sbjct: 960  AAFKERITEVELAKNNIADSNTVLKTQIDDLNNELEVQKKLYEDEKINFTRNANELERVT 1019

Query: 1021 SELDNMKAEYEQKISKIQEDLNQQTSYANTAQKNYEQELQKHADVSKKISLLRAEAQKYK 1080
              L+  K +YE K+  + +DL +Q  YAN AQ NYEQELQ HA+VSK IS LR + Q Y+
Sbjct: 1020 KGLEQSKRDYEDKLKSLMKDLEEQVKYANKAQNNYEQELQNHANVSKTISQLREQTQHYR 1079

Query: 1081 SETETLRNAAENAKKALEQSELSWEKQSSDYEDELRLAHQRIEDLNAQSKILYDQIDFLS 1140
            +E   L  +A +AK+ L ++++SW+KQ  +YE ++    +RIE+ + Q+K+L++Q    +
Sbjct: 1080 TEIAELTISATDAKRLLNENQISWQKQRDEYEKQIEFFKKRIEEESEQNKMLFEQSKLTT 1139

Query: 1141 KGKPTSSEDLMPI-STETRN-LLTSLRREKDILETKLEVSTREEKVLRQKLKLIESDLEG 1198
            +     + +   + S E  N L+ SLR E+D+L+ +L V+  EEK+LR++L  IE D   
Sbjct: 1140 QANDEDNAESSGVNSIEGDNKLVLSLRSERDLLQERLNVTEAEEKLLRERLTSIEKDFRA 1199

Query: 1199 SRIELSKLQRAASGNSATLKDQEEIMTQLNQLNLLRESNITLRNEAQKNGERSRELKAEL 1258
            + +EL K++         L+  + +M+QL QL+LLRESNITLRNE  +   +++ L+ E+
Sbjct: 1200 TDLELQKIKEETHNYPDLLEQHKTVMSQLTQLDLLRESNITLRNETIELQSKNQHLQTEV 1259

Query: 1259 DALYGKVQPLESKVTLLQNSVREKDLQISLKNEEAERWKQRSQDILHKYERIDPEEHQKL 1318
            + L+ K+ PLE+++  L N + EKD Q+S+ +EE+ERWKQRSQDIL KY+RIDP EH+ L
Sbjct: 1260 ENLHDKLLPLETELQTLTNLIEEKDKQLSICHEESERWKQRSQDILSKYQRIDPVEHENL 1319

Query: 1319 ADKVSELQQEIKSKSDENEELDTRFKRLKQQAHEKLNAAKTAQSTLTSQLNDLKATKEKL 1378
            A++ + LQ +++ KS ENEEL  RF++LK+QAHEKLNA+K +Q++LT Q+NDL+A K++L
Sbjct: 1320 AEERNRLQAQLEEKSKENEELGNRFEKLKKQAHEKLNASKISQNSLTIQINDLEAKKKEL 1379

Query: 1379 ENDLGSQKEEVKNLESKITDIEKNKSSEKNDLQEQLENSQAKLLETENKLEQVTSSSALL 1438
             + L ++KE   +LE ++    KN S +   +Q QLE +  K  + E K      SS  +
Sbjct: 1380 LSQLETEKEGKLSLEKRLEVTMKN-SHDIVSIQSQLEEALMKSKDFETKFINSVESSKQI 1438

Query: 1439 EKELNERIESLMNKIKLLEEDL--EKAKTESPNDGSQSSELVEN--TSKIVENLKIEFEE 1494
            E+ LN  I+ L  +   L+E+L  EK  T +   G+   + V+   ++ IVE++K  FEE
Sbjct: 1439 EENLNSEIKKLQEESSKLQEELAHEKLTTSTTEIGNVDQDTVDGGVSNDIVESMKQSFEE 1498

Query: 1495 EKAKMISDKESELREQFEEEKASILEAKEQELREQLATQKLDPPVNIDE--IKKKWEEEY 1552
            EK K I ++ +E +++        L+A+  +L+ +  T++++ PV+IDE  I+K+ EEEY
Sbjct: 1499 EKIKFIEEQTTEFKKK--------LQAEINKLKAEYETKQIE-PVSIDENAIRKQIEEEY 1549

Query: 1553 EQKTSQRIRESNEQLKKRIRLPTEEKINKIVEKKRLELEAEFEANVQKKAEEIXXXXXXX 1612
            EQ TSQRI+E+ E LK+RIRLPTEEKINK+++K+R +LE EF+  V+ +A+E+       
Sbjct: 1550 EQATSQRIKEAEENLKRRIRLPTEEKINKVIDKRRTQLENEFQNKVEARAKEL-----LT 1604

Query: 1613 XXXXTEVLEKHKQDLENLKQEMQKKFDEDIAQIKKRAFEEGKQQASMKSTFLEKKIAKLE 1672
                 E  ++ K++++   +E+ +K++E++  +KK+AF+EG+QQ  MK++FLEKKI KLE
Sbjct: 1605 GDEKNEFFDRMKKEIQ---EELARKYEEELQVVKKKAFDEGRQQVLMKTSFLEKKITKLE 1661

Query: 1673 TQIK-------AHDSAIPINDNSSAT-PAESGPTTQDVKQLTPILNNQAAILPGKPLP-- 1722
            + ++       A D+ I   DN +    ++  P T +   ++ +  N A   P    P  
Sbjct: 1662 SDLQNAKSNTGATDNTIVSTDNETKYEGSDKKPVTINTNVVSDVGENNAERTPMNKFPRA 1721

Query: 1723 -FNP 1725
              NP
Sbjct: 1722 IMNP 1725

>TBLA0E01730 Chr5 complement(417597..423059) [5463 bp, 1820 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1820

 Score =  570 bits (1469), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 512/1599 (32%), Positives = 885/1599 (55%), Gaps = 89/1599 (5%)

Query: 192  AEMQRLTQEMNLLKSNNQWLEKELASKSEEFGSYRQRVNSELQTALSELNXXXXXXXXXX 251
            +E+QRL QE+  L  N   L ++   + EEF   +  +   L  +  +L           
Sbjct: 168  SEIQRLKQEVTFLNENKSSLSEQWLKEKEEFNKAKLLLEKNLNNSTIKLEEATTTLKSME 227

Query: 252  XXXQTLKSRANDLSQQLQDKMTELKSLRDSSSIEKQEFTREMTLKQRLIDLLEKQIESFK 311
                 L  + NDL+++ ++ + E+K+L+D+  + K +  +E+ +K +LIDLL+ Q+ S +
Sbjct: 228  AKVSVLSDKNNDLTKKYENSIWEIKNLKDNLLVTKDDMNKEIAMKSKLIDLLQGQLSSTQ 287

Query: 312  TELESARNKSVSNSDHVDAERXXXXXXXXXXXXXXXXXXXXAVKLEETVDE---LLSTDG 368
             EL      +   +   D E                      +K+EE  +E   L S   
Sbjct: 288  EELRQNVELNSKFTKFPDLE--------SQNETLKSDIQDLTLKIEELQNENFNLNSMIN 339

Query: 369  ERGAGNTSKVSLDSKNSIVPKLHGDIGLLKKRLIQERRQKEQLQYQVEAFVLELEHKVPV 428
            +      +  +  S +S +P L+  I LLKK++ QE+ +K+ LQ Q+E+F++ELE+K+P+
Sbjct: 340  QMSNEQNNSNNSSSIDSNLPTLYSKINLLKKQVTQEKLEKKHLQTQIESFIIELENKIPI 399

Query: 429  LNSFKERTEMLEKELSDVALMLEATSKDKEEKEHELTSVKSKIADYETQIHSLVRQRSDL 488
            ++SF+E+ + LE EL+++ L+L  TS +K   +++L +  SK+  Y++ I  L+RQR DL
Sbjct: 400  ISSFQEKNQALENELTNLTLLLNKTSNEKNTIQNKLNNYDSKLLTYQSNIKELIRQRLDL 459

Query: 489  AHQVQHLLIQVSVRNDSNGPLTPEETNFIKKIINSSE--SPVEQDAQRIISERLVRFESM 546
            A+QV+HLL+ V+V+NDS GPLT EE  FI KI N+SE  +  E  +Q +ISERLV F ++
Sbjct: 460  ANQVKHLLLFVAVKNDSGGPLTREEIEFINKISNNSEDLNGSELTSQHVISERLVTFSNI 519

Query: 547  VELQEKNMELLNSIRNLADKLXXXXXXXXXXXXXXXXXXXXXXXXXILTLQEYNKSLESQ 606
             ELQ KNMELLNSIR+L++ L                         ILTLQ +N  LES+
Sbjct: 520  EELQAKNMELLNSIRSLSENLENIENANSHKEFQNKTIADAKEA--ILTLQYHNDILESK 577

Query: 607  LEIIAKERDAFKILASDK-GTSNGPSNVNSSENRHLVLAEEKIKELENHLSSLTEESAKN 665
            ++++  ERD+FK+L ++     +   N + S +      E+ I++L+  +  L  E  KN
Sbjct: 578  VKVLEAERDSFKLLLNNNVSIDSSIKNDDLSSSTSPETNEKSIEKLQTLIEELKAELKKN 637

Query: 666  IKLLNEEIHSLYRAQADTSVNLEKERSSRILAEDRSKLISNTLEMTKMENDELRKRFHSL 725
               L  +I S    +++ +++LEKE+SS  L  ++  L  +  +M K EN EL KRF +L
Sbjct: 638  KDALESQIASFTADKSNLTISLEKEKSSNTLMAEKISLTESAFDMLKTENKELNKRFENL 697

Query: 726  QENILKQDSKTQQTIESLISCKXXXXXXXXXXXXXXXERDLLRSIQENLKKENESLSEER 785
            Q  I+KQ+SK    I   I+ +               E+D L   Q++L  E    SEE+
Sbjct: 698  QNIIIKQESKLGDIINKYITGETEISNLKTQLSIAKSEKDFLVKSQDSLNSELIKTSEEK 757

Query: 786  NNMRILITQLQTLQTERESLLEETQKNFQGKTNKLETELSDTLEKLDAKSKEISDYISTK 845
            N +RI+++QLQ+LQ ER +LL++TQK F  K ++LE    D ++ L +K  EI     + 
Sbjct: 758  NKLRIMLSQLQSLQNERMTLLDDTQKKFMSKIHELENNNLDLIKNLGSKMTEIQKLSISN 817

Query: 846  DSQEKWYQEKFDRLNEELNNSREKLSSKLTDIQHLELKVESLNNKLEESEARIQAFNALN 905
            +SQ  WYQ   D L +++N++   + ++LT    L   +  LN K+E  E++    +   
Sbjct: 818  ESQCTWYQNTIDDL-KKINSA---IKTELTSKNSL---ISDLNTKIELLESQSYTIDTNT 870

Query: 906  YSESVESQTETLRQELEKTRIKLADAYSQVEQYKSMADSSEESATAIKDALEQSKAEYTE 965
               S  +    + ++L+ T++ L++AY+QVE+YK +  S+EES   ++   E  K    +
Sbjct: 871  RCSSSGNDFSQISKDLDITKLHLSEAYTQVEEYKQLYTSTEESLKTLESNFESVKNLMDD 930

Query: 966  KIETLTKERDMFKDQVPILKDQISNLNNELNHQKSQFESQISDYTRNLEDLKAKQSELDN 1025
            KI  L  E +  K        +IS L+ +L ++K+++  +I+     +  L   + +  +
Sbjct: 931  KISKLLSENETLKASTGEYDKRISELSTDLKNEKNKYSEEIAQLNVQITRLNKFKKDSAD 990

Query: 1026 MKAEYEQKISKIQEDLNQQTSYANTAQKNYEQELQKHADVSKKISLLRAEAQKYKSETET 1085
              +EYE+KISK+Q  L  +  +A+ AQ+ YE  L K     + I   + + +K       
Sbjct: 991  TASEYEEKISKLQSQLELKAKFADNAQEKYESLLTKDNANLQSIEEFKEQIEKLNQRIVI 1050

Query: 1086 LRNAAENAKKALEQSELSWEKQSSDYEDELRLAHQRIEDLNAQSKILYDQIDFLSKGKPT 1145
            + +  E     L ++E  W+K+   +  +L  + ++I++L  Q+K+  DQ++ L+K   +
Sbjct: 1051 IESDLEKKTSLLSENESLWKKKQDAFISDLEESKKKIDNLTNQNKLYVDQLELLNKDFSS 1110

Query: 1146 SSEDLMPISTETRNLLTSLRREKDILETKLEVSTREEKVLRQKLKLIESDLEGSRIELSK 1205
                   +S+ET+++   LR ++D+LETKL ++ R+ K    KL+ +  +L   +++L  
Sbjct: 1111 MDS--SQLSSETKHMFNRLRADRDVLETKLSIAERDSKNNASKLESLRDELANVQMKLIS 1168

Query: 1206 LQRAASGNSATLKDQEEIMTQLNQLNLLRESNITLRNEAQKNGERSRELKAELDALYGKV 1265
             +     +S  +++ E+I+++LNQ+ L +ESN TLRN+  +  E+++ L+ +L+    K+
Sbjct: 1169 SENKLLRHSDLIENHEKIVSELNQITLFKESNETLRNQVSELNEKNKTLQTKLNEENSKL 1228

Query: 1266 QPLESKVTLLQNSVREKDLQISLKNEEAERWKQRSQDILHKYERIDPEEHQKLADKVSEL 1325
              L  ++  ++ S+ +K+  I L  EE+ +W+ R++++  + +++D +   KL+ ++  L
Sbjct: 1229 SNLSMELKSVKESLGDKETDIMLIKEESNKWRLRAEELSVQIDKVDLDSVSKLSTELDAL 1288

Query: 1326 QQEIKSKSDENEELDTRFKRLKQQAHEKLNAAKTAQSTLTSQLNDLKATKEKLENDLGSQ 1385
            + + ++K  +N EL+ RF  LK+QAHE+LNA+K  QS+L  Q+N+LKA+   +E  L S+
Sbjct: 1289 KDDAETKRKQNAELEERFNLLKKQAHERLNASKEIQSSLNKQINELKASNTNIELALSSE 1348

Query: 1386 KEEVKNLESKITDIEKNKSSEKNDLQEQLENSQAKLLETENKLEQVTSSSALLEKELNER 1445
            +++  +L++ ++D E   + + ++++ +L     K L+TEN   +++S     EKE  E 
Sbjct: 1349 QKKSMDLQNTLSDNEVKYTQKLSNIESEL-----KALKTENNSFKLSS-----EKEKME- 1397

Query: 1446 IESLMNKIKLLEEDLEKAKTESPNDGSQSSELVENTSKIVENLKIEFEEEKAKMISDKES 1505
               L +++  L++ L +A+++    GS S++   N   ++E++K EFEEEK K++ DK +
Sbjct: 1398 ---LTDEVDSLKKSLVEAQSKLSAIGSDSTDSTMNA--MIESMKKEFEEEKLKLLEDKTN 1452

Query: 1506 ELREQFEEEKASILEAKEQELREQLATQKLDPPVNIDE---IKKKWEEEYEQKTSQRIRE 1562
            EL  Q++ EK  +L+  E+++ E L + + D  + I+E   +KK+WEEEYE+ T +RI E
Sbjct: 1453 ELEAQWKLEKDKLLKEYEEKI-EDLQSARTDQSIKIEEFQSLKKEWEEEYEKATLERIEE 1511

Query: 1563 SNEQLKKRIRLPTEEKINKIVEKKRLELEAEFEANVQKKAEEIXXXXXXXXXXXTEVLEK 1622
            + E LKKRIRLP+E KIN+++EK++ ELE E+E  +Q+K  EI              L +
Sbjct: 1512 AKETLKKRIRLPSETKINRVIEKRKHELENEYEVKLQEKLNEIEANRNSIETIDPGKLRE 1571

Query: 1623 HKQDLENLKQEMQKKFDEDIAQIKKRAFEEGKQQASMKSTFLEKKIAKLETQIKAHDSAI 1682
              +  E +K++M  KF+ D+ + KK++FEEGKQQ+SMK+T LE+KI+KLE+Q+     AI
Sbjct: 1572 EIK--EEVKRDMLIKFENDLNEAKKKSFEEGKQQSSMKTTLLERKISKLESQL---SEAI 1626

Query: 1683 PINDNSSATPAESGPTTQDVKQLTPILNNQAAILPGKPLPFNPAHFAFGMPFGQTTSNSF 1742
              ND  S    +  P   D+ Q + +    A+I P  P    PA F+FG   G  T+NS 
Sbjct: 1627 E-NDKQS----DKNPIISDLAQTSTL----ASIQP--PSAKKPA-FSFG---GFNTTNSL 1671

Query: 1743 -----------------------QNPFNSQPPEQTPNSP 1758
                                   QNPF S    QT +SP
Sbjct: 1672 NANKGFSSSSNNTSQSSKDTEIVQNPF-SLGVSQTSSSP 1709

>Suva_9.39 Chr9 complement(57700..62748) [5049 bp, 1682 aa] {ON}
            YIL149C (REAL)
          Length = 1682

 Score =  471 bits (1212), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 496/1787 (27%), Positives = 878/1787 (49%), Gaps = 224/1787 (12%)

Query: 21   ISSFLELDASKVSTLDPAVVRQLSIKANQFGQLKAQNLKYSVTLDELKSSSERRSEAFKL 80
            IS +L + +  +  ++ +++R L  + ++F + + +  + +V +DE+KS    R      
Sbjct: 5    ISEYLHVPSKSLQGVNYSILRALCKRIDKFERSEEEVTRLNVLIDEIKSQYYTRISKLN- 63

Query: 81   QLEKINENTESLRXXXXXXXXXXXXLIDEKANASKEVNLLKSQLTE-------------L 127
              E + E++E               L +E++  +++++ L  QL               +
Sbjct: 64   --ELLGESSEEKNVSKKELSRLHNLLKNERSKCARKIDALNKQLNASKNTITKLNDERGV 121

Query: 128  KQQNEIFRSSKQDVVQLLNEKIGDLEASQDEAKQLLQNTKTLRKQVLELENEVQTFKSND 187
            K++ E+ ++  Q+          DLE S      L    K LR+++LE+EN +QT KSN 
Sbjct: 122  KEEAEVLKAEHQN---------NDLERSA-----LGHENKLLRRKLLEMENILQTCKSNT 167

Query: 188  LRGKAEMQRLTQEMNLLKSNNQWLEKELASKSEEFGSYRQRVNSELQTALSELNXXXXXX 247
            L  K +   + QE  L+  N +W+E++L+ + E+         S +Q    +LN      
Sbjct: 168  LSLKLKYDTVVQEKELILENKKWMEEQLSFRDEKTLVDDVTRTSHVQNLEEQLNRTQNDY 227

Query: 248  XXXXXXXQTLKSRANDLSQQLQDKMTELKSLRDSSSIEKQEFTREMTLKQRLIDLLEKQI 307
                   Q L ++   LS  ++ K+ E+K+L+D+ +IEK +F++EMTL++ + DLL  Q+
Sbjct: 228  ESVSTNNQFLLAQNKQLSHSMEQKILEIKNLKDTVNIEKADFSKEMTLQKNMNDLLRSQL 287

Query: 308  ESFKTELE-SARNKS----VSNSDHVDAERXXXXXXXXXXXXXXXXXXXXAVKLEETVDE 362
             SF+     SAR K       NS H +                         +L+  V +
Sbjct: 288  TSFEKNYSLSAREKDNDDPCKNSQHANV-----VDKLIDTKLQLEKSKDECQRLQNIVAD 342

Query: 363  LLSTDGERGAGNTSKVSLDSKNSIVPKLHGDIGLLKKRLIQERRQKEQLQYQVEAFVLEL 422
             +  D E    NT  V     +  V K+  DI  LK++LI+ER QK QLQ Q+E+F+ EL
Sbjct: 343  CIEED-EAAFDNTHNV-----DPSVNKVFSDIKALKRQLIKERNQKFQLQNQMESFIKEL 396

Query: 423  EHKVPVLNSFKERTEMLEKELSDVALMLEATSKDKEEKEHELTSVKSKIADYETQIHSLV 482
            E K P L SFKERTE LE+EL +   +LE  S  K + E ELTS++ KI + E  IHSLV
Sbjct: 397  ERKTPELISFKERTESLEQELKNSTDLLETISLAKRKDEKELTSLRQKINNCEANIHSLV 456

Query: 483  RQRSDLAHQVQHLLIQVSVRNDSNGPLTPEETNFIKKIINSSESPVEQDAQRIISERLVR 542
            +QR DLA QV+ LL+ +S       PL+ +E   +KK++ S + P E+D+Q II+ERLV 
Sbjct: 457  KQRLDLARQVKLLLLNISAVQKKASPLSNDELISLKKLLESGDVPNEKDSQIIITERLVE 516

Query: 543  FESMVELQEKNMELLNSIRNLADKLXXXXXXXXXXXXXXXXXXXXXXXXXILTLQEYNKS 602
            F +  ELQEKNMELLN +R LADKL                         I+ L+  N +
Sbjct: 517  FNNTNELQEKNMELLNCVRVLADKLENHEGKQDKSLAKLENQTIKEAKDAIIELEHVNST 576

Query: 603  LESQLEIIAKERDAFKILASDKGTSNGPSNVNSSENRHLVLAEEKIKELENHLSSLTEES 662
            LES+++I+++ERD++K+LAS  G        N +E  +L    +KIKELE+ LS    E+
Sbjct: 577  LESRIDILSRERDSYKLLASANGNKIYADAANKTEAANL----KKIKELESELSLTKVEN 632

Query: 663  AKNIKLLNEEIHSLYRAQADTSVNLEKERSSRILAEDRSKLISNTLEMTKMENDELRKRF 722
            +  ++ LN+E+ +  ++Q++  + L++  + ++LA ++  L              L+ R 
Sbjct: 633  SAVVQRLNKELLTCKKSQSNGQIALQEFSNFKVLAIEKENL--------------LQTRI 678

Query: 723  HSLQENILKQDSKTQQTIESLISC--------KXXXXXXXXXXXXXXXERDLLRSIQENL 774
              L+  + KQ S    +I   I          K               +   LR ++E+L
Sbjct: 679  DDLKTKLEKQRSSAPSSIHGSIGSEETELSQYKNKTKSLMCEISNLSKKNTDLRCMKESL 738

Query: 775  KKENESLSEERNNMRILITQLQTLQTERESLLEETQKNFQGKTNKLETELSDTLEKLDAK 834
             ++ E   +E+  +++ +T+ +T   E++   +  Q  +  K   LE    +   +L +K
Sbjct: 739  TRDLERCCKEKMQLQMKLTESETSHNEQKLKSDSKQVQYNTKIKNLEKNCEELNNRLHSK 798

Query: 835  SKEISDYISTKDSQEKWYQEKFDRLNEELNNSREKLSSKLTDIQHLELKVESLNNKLEES 894
             +EI    ++K+SQ KW Q   D   + + +    LS K T I+ L L+++ L  ++E  
Sbjct: 799  VQEIETLQTSKNSQLKWAQNTIDDTEKNMKSLSTDLSEKKTTIRKLSLEMKDL--EIELQ 856

Query: 895  EARIQAFNALNYSESVESQTETLRQELEKTRIKLADAYSQVEQYKSMADSSEESATAIKD 954
            + ++Q +  LN S    +    L++ELE+++I L DA+SQ+E Y+ +  + E +   + D
Sbjct: 857  KTKLQ-YKLLNNSSDANTLETALKKELERSQIDLKDAHSQIEAYEEIISTDENTLKELND 915

Query: 955  ALEQSKAEYTEKIETLTKERDMFKDQVPILK---DQISNLNNELNHQKSQFESQISDYTR 1011
             L ++K E   K ++L +E +  ++++  L+   D+I  L  +L     +   Q      
Sbjct: 916  QLTKTKEELKVKSQSLDEENNAKEEEISFLRRELDEIRGLQPKLKEGALRLVQQSEKLGN 975

Query: 1012 NLEDLKAKQSELDNMKAEYEQKISKIQEDLNQQTSYANTAQKNYEQELQKHADVSKKISL 1071
              + ++A   ++D M    E         L+Q+     T+Q  Y+ +L+ + D+S  +  
Sbjct: 976  QTQRIQAMNEKIDKMTTIVE---------LHQEVE---TSQ--YQAKLKANKDLSALVLR 1021

Query: 1072 LRAEAQKYKSETETLRNAAENAKKALEQSELSWEKQSSDYEDELRLAHQRIEDLNAQSKI 1131
            L  E   Y++E +  +++  + ++ L++ E  W ++ +DYE EL    ++ E L  ++  
Sbjct: 1022 LENEVLDYQTELKKTKSSLHSTQELLDKHERKWMEEKADYERELISNIEQTESLRVENSA 1081

Query: 1132 LYDQIDFLSKGKPTSSEDLMPISTETRNLLTSLRREKDILETKLEVSTREEKVLRQKLKL 1191
            L ++ID  +       E L  +S     L +SLR E++ LETKL    R+  + +QK   
Sbjct: 1082 LVEKIDDGTGENNGDKEYLKLVS-----LFSSLRHERNTLETKLTTCKRDLALAKQK--- 1133

Query: 1192 IESDLEGSRIELSK---LQRAASGNSATLKDQ-EEIMTQLNQLNLLRESNITLRNEAQKN 1247
              ++LE S  ++ +   + R     S  + D+ E+IM ++ Q+N+L+E+N  L+   +K 
Sbjct: 1134 -NANLEKSVNDMQQTHLVSRKDVQCSTDIIDEFEDIMKEIAQVNILKENNTILQKSLKKV 1192

Query: 1248 GERSRELKAELDALYGKVQPLESKVTLLQNSVREKDLQISLK-------NEEAERWKQRS 1300
             E++       +A+Y +   L+ +++ LQ  + +   Q+S+          E E+WKQR 
Sbjct: 1193 TEKN-------EAIYKEHTSLQYEISQLQGDLAQTKEQVSVNANKVLVYESEIEQWKQRY 1245

Query: 1301 QDILHKYERIDPEEHQKLADKVSELQQEIKSKSDENEELDTRFKRLKQQAHEKLNAAKTA 1360
             ++  + +    +E +KL +++S+L+ ++ +  + N +L+ +F RLK+QAHEKL+A+K  
Sbjct: 1246 DNLSQQQKETHKDETEKLFNEISDLKAKLLNAQNANADLNDKFNRLKKQAHEKLDASKKQ 1305

Query: 1361 QSTLTSQLNDLKATKEKLENDLGSQKEEVKNLESKITDIEKNKSSEKNDLQEQLENSQAK 1420
            Q+ LT+++++LK        D+                        KN+L+E L + ++K
Sbjct: 1306 QTALTNEVDELK--------DM------------------------KNELEESLHSEESK 1333

Query: 1421 LLETENKLEQVTSSSALLEKELNERI-ESLMNKIKLLEEDLEKAKTESPNDGSQSSELVE 1479
            +LE E KL++    +  + K+  E   + LM +I+LL+ +L+  K     + S SS+ +E
Sbjct: 1334 VLELEAKLKKHLVQAEGVSKDQEEDTSKPLMEEIELLKRELQVFK-----ETSDSSDTIE 1388

Query: 1480 NTSKIVENLKIEFEEEKAKMISDKESELREQFEEEKASILEAKEQELREQLATQKLDPPV 1539
               +I+E        EK K+I +K +E   + EE       A             ++   
Sbjct: 1389 KMKEIME-------AEKNKIIEEKTTEFERKLEEATGKNTGAT------------IENGE 1429

Query: 1540 NIDEIKKKWEEEYEQKTSQRIRESNEQLKKRIRLPTEEKINKIVEKKRLELEAEFEANVQ 1599
            N++E+KK+W ++YE++T +RI+E+ E LKKRIRLP+EE+I KI+ K++ ELE EF+  ++
Sbjct: 1430 NMEELKKQWLKQYEEETMRRIKEAEENLKKRIRLPSEERIQKIISKRKEELEQEFQRKLK 1489

Query: 1600 KKAEEIXXXXXXXXXXXTEVLEKHKQDLENLKQEMQKKFDEDIAQIKKRAFEEGKQQASM 1659
              +                        L + K+E +   ++D+     +      ++ S+
Sbjct: 1490 ANSGSFT--------------------LSSDKKENEVNAEDDLWNSPSKG---NSEKPSV 1526

Query: 1660 KSTFLEKKIAKLETQIKAHDSAIPINDNSSATPAESGPTTQDVKQLTPILNNQAAILPGK 1719
             +  + +K   L+ Q+K     I  ND        S PT+          +N+   +PG 
Sbjct: 1527 VTNLIRQKNLILQEQLKNPKKGIISND--------SRPTS----------SNKENDIPGS 1568

Query: 1720 PLPFN--PAHFAFGMP-FGQTTSN--SFQNPFNSQPPEQTPNSPKRP 1761
                N  P  F FG P F   TS+  SFQNPF   P   + N+   P
Sbjct: 1569 TTAENKAPLAFNFGKPLFPSNTSSFQSFQNPFT--PAATSFNTGVSP 1613

>Smik_9.20 Chr9 complement(40653..45701) [5049 bp, 1682 aa] {ON}
            YIL149C (REAL)
          Length = 1682

 Score =  462 bits (1190), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 489/1754 (27%), Positives = 861/1754 (49%), Gaps = 186/1754 (10%)

Query: 21   ISSFLELDASKVSTLDPAVVRQLSIKANQFGQLKAQNLKYSVTLDELKSSSERR-SEAFK 79
            IS FL +    +  ++ +V+R+L  K + F   + +  + +V +DE+KS    R S+  K
Sbjct: 5    ISEFLHVPFESLQGINYSVLRKLFKKIDNFEYFEEEVTRLNVLVDEIKSQYYSRISKLSK 64

Query: 80   LQLEKINENTESLRXXXXXXXXXXXXLIDEKANASKEVNLLKSQLTELKQQNEIFRSSKQ 139
            L    +NE++E               L+ ++    ++++ L  QL            S +
Sbjct: 65   L----LNESSEQKNIASKELSHLQDQLMQDRERCRRKIDALNKQL-----------DSSR 109

Query: 140  DVVQLLN-EKIGDLEASQDEAKQ----LLQNT-----KTLRKQVLELENEVQTFKSNDLR 189
            D ++ LN EK    E+   ++K      +QN      K LR++++E+EN +Q  KSN + 
Sbjct: 110  DAIKRLNDEKDAKEESMIRQSKHQNVNSVQNVLDKENKLLRRKLMEMENILQICKSNSVS 169

Query: 190  GKAEMQRLTQEMNLLKSNNQWLEKELASKSEEFGSYRQRVNSELQTALSELNXXXXXXXX 249
             + +   + QE  L+  N +W E++L+S + +  +      S ++    +L         
Sbjct: 170  LQLKYDTIVQEKELMLQNKKWTEEKLSSYNNKTLADESTKASRIRNLEEKLYQAQADRES 229

Query: 250  XXXXXQTLKSRANDLSQQLQDKMTELKSLRDSSSIEKQEFTREMTLKQRLIDLLEKQIES 309
                 Q L  +   LS  +++K+ E+K+L+D++ IEK EF++EMTL++ + DLL  Q+ S
Sbjct: 230  ALSYSQLLLDQNKQLSHSVEEKILEIKNLKDTACIEKTEFSKEMTLQKSMNDLLSSQLAS 289

Query: 310  FKTELESARNKSVSNSDHVDAERXXXXXXXXXXXXXXXXXXXXAVKLEETVDELLSTDGE 369
            F+ +  S       ++   D +                       +L+  + + +  D  
Sbjct: 290  FERDHSSGEIGKDDDNLCKDPDHNNVTDELMNTKVQFQKSQDECQRLQNIISDFVQEDK- 348

Query: 370  RGAGNTSKVSLDSKNSIVPKLHGDIGLLKKRLIQERRQKEQLQYQVEAFVLELEHKVPVL 429
                  + V  +  +  V KL  DI +L+K+LI+ER QK QLQ Q+E F+LELEHK P L
Sbjct: 349  ------ATVDTNGASHTVGKLFSDIKVLRKQLIKERSQKFQLQNQMEDFILELEHKTPEL 402

Query: 430  NSFKERTEMLEKELSDVALMLEATSKDKEEKEHELTSVKSKIADYETQIHSLVRQRSDLA 489
             SFKERT+ LE EL     +LE  S  K + E ELTS++ KI   E  IH LV+QR DLA
Sbjct: 403  VSFKERTKSLEHELKRSTELLETISMAKRKDERELTSLRQKINSCEANIHLLVKQRLDLA 462

Query: 490  HQVQHLLIQVSVRNDSNGPLTPEETNFIKKIINSSESPVEQDAQRIISERLVRFESMVEL 549
             QV+ LL+  S    +  PL+ ++   ++KI+ S     E DAQ IISERLV F ++ EL
Sbjct: 463  RQVKVLLLNTSAIQKTTLPLSKDDLISLRKILESGSDVNENDAQAIISERLVEFNNINEL 522

Query: 550  QEKNMELLNSIRNLADKLXXXXXXXXXXXXXXXXXXXXXXXXXILTLQEYNKSLESQLEI 609
            QEKN+ELL  IR LADKL                         I+ L+  N  +ES++ I
Sbjct: 523  QEKNVELLYCIRTLADKLEFHEGKKDTTLAEVEKQTIKEAKDAIIELENTNMKMESRINI 582

Query: 610  IAKERDAFKILASDKGTSNGPSNVNSSENRHLVLAEEKIKELENHLSSLTEESAKNIKLL 669
            + +ERD++K+LAS K  +   +  N +E  H    E+KIKELE  LSS   ES+  I+ L
Sbjct: 583  LLRERDSYKLLASSKENNVNVNAKNFTEISH----EKKIKELEAELSSTKVESSAVIQNL 638

Query: 670  NEEIHSLYRAQADTSVNLEKERSSRILAEDRSKLISNTLEMTKMENDELRKRFHSLQENI 729
             +E+ +  +   D  +  +   + ++LA+++  ++   +   K    +L K+  S+   +
Sbjct: 639  RKELTTYKKLLCDKKIASQDFENFKMLAKEKESILETRVNNLKT---DLEKQKLSVPSFV 695

Query: 730  LKQDSKTQQTIESLISCKXXXXXXXXXXXXXXXERDLLRSIQENLKKENESLSEERNNMR 789
              QD+K + + E L+  +               E      ++E+L ++ E   +E+    
Sbjct: 696  --QDNKVRDSTE-LLQSRTKTEILMHEISSLKKETANSMVLKESLTRDLERCCKEK---- 748

Query: 790  ILITQLQTLQTERESLLEETQKNFQGKTNKLET---ELSDTLEK----LDAKSKEISDYI 842
                QLQ    E E  L E + NF  K  K +    +L ++LE+    L +K++EI    
Sbjct: 749  ---IQLQMKLKESEISLNEQKVNFDSKGIKYDARIKQLEESLERLRIELKSKAQEIKSLQ 805

Query: 843  STKDSQEKWYQEKFDRLNEELNNSREKLSSKLTDIQHLELKVESLNNKLEESEARIQAFN 902
            S+KDSQ KW Q   D   E+L +   +LS K   +  L  K+E+L+N+L E++ +   + 
Sbjct: 806  SSKDSQLKWAQNTIDDTEEKLKSVLTELSRKEKTVVTLSSKIENLDNELRENKLK---YE 862

Query: 903  ALNYSESVESQTETLRQELEKTRIKLADAYSQVEQYKSMADSSEESATAIKDALEQSKAE 962
             LN +    +    LR+ELE+T+++L DA+SQV  Y+ +  ++E++   +   L   K +
Sbjct: 863  FLNNTSDASTLQPALRKELEQTQLELKDAHSQVRTYEEIISTNEKALKELNSQLASMKED 922

Query: 963  YTEKIETLTKERDMFKDQVPILKDQISNLNNELNHQKSQFESQISDYTRNLEDLKAKQSE 1022
            Y  +IE   KE+   ++++ +L+ ++    +E+   + + +       +  E L+ +  +
Sbjct: 923  YDARIELECKEKLANEEELSLLRREL----DEIRSLQPKLKEGTVCLVKQSEKLRNQAEK 978

Query: 1023 LDNMKAEYEQKISKIQEDLNQQTSYANTAQKNYEQELQKHADVSKKISLLRAEAQKYKSE 1082
            +  MKA    KI K+  + N Q  Y       ++  ++ + ++S+ ++ L  EA   + E
Sbjct: 979  IQEMKA----KIDKM--NWNVQV-YKKEKTSQFQSIMKANKELSELVTRLEKEATDSQME 1031

Query: 1083 TETLRNAAENAKKALEQSELSWEKQSSDYEDELRLAHQRIEDLNAQSKILYDQIDFLSKG 1142
             + L+++    +  L+  E  W ++ +DYE EL    ++ E L  ++ +L ++I  +++G
Sbjct: 1032 LKKLKSSLHKTQDLLDTHEKKWMEEKADYERELISNIEQTESLRVENSVLIEKIGSVTEG 1091

Query: 1143 KPTSSEDLMPISTETRNLLTSLRREKDILETKLEVSTREEKVLRQKLKLIESDLEGSRIE 1202
               + + L  +S       ++LR E++ LETKL    R+  +++QK   +E ++   +I+
Sbjct: 1092 SDGNEDYLKLVS-----FFSNLRHERNSLETKLTTCKRDLALVKQKNASLEKNINDLQID 1146

Query: 1203 LSKLQRAASGNSATLKDQEEIMTQLNQLNLLRESNITLRNEAQKNGERSRELKAELDALY 1262
                Q     ++  + +  +I  ++ Q+NLL+E+N  L+   +   E++RE+  EL    
Sbjct: 1147 QPASQTELQCSAVIIDEFNDITKEIAQVNLLKENNAILQKSLKNVTEKNREIYEELTIRQ 1206

Query: 1263 GKVQPLESKVTLLQNSVREKDLQISLKNEEAERWKQRSQDILHKYERIDPEEHQKLADKV 1322
             +V  L+S +   +  V     +I +   E ++ KQR  D+  +   +  +  +KL  ++
Sbjct: 1207 EEVSQLKSDLIKTKEQVSVNANKILIYESEMDQCKQRYHDLSTQQREVQKKTIEKLNSEI 1266

Query: 1323 SELQQEIKSKSDENEELDTRFKRLKQQAHEKLNAAKTAQSTLTSQLNDLKATKEKLENDL 1382
            S+ + ++    +   EL+ +F RLK+QAHEKL+A+K  Q+ LT++L +LKA ++KLE DL
Sbjct: 1267 SDFKAKLLDAENTKTELENKFNRLKKQAHEKLDASKKQQTALTNELKELKAVRDKLEQDL 1326

Query: 1383 GSQKEEVKNLESKITDIEKNKSSEKNDLQEQLENSQAKLLETENKLEQVTSSSALLEKE- 1441
             S     KN   K  D                       L+TE K   V S   L ++E 
Sbjct: 1327 NS-----KNF--KTVD-----------------------LDTEPKEHTVQSGDLLRDQEK 1356

Query: 1442 -----LNERIESLMNKIKLLEEDLEKAKTESPNDGSQSSELVENTSKIVENLKIEFEEEK 1496
                 L E IESL  ++++ +                      N+S   E L+   EEEK
Sbjct: 1357 VASLPLIEEIESLKRELQVFKN-------------------ANNSSDAFEKLRDNMEEEK 1397

Query: 1497 AKMISDKESELREQFEEEKASILEAKEQELREQLATQKL-DPPVNIDEIKKKWEEEYEQK 1555
             K+I+++  E  ++ EE     + +K +      +T K+ D   NI+ +KK+W +EYE++
Sbjct: 1398 NKIINERTKEFEKKLEE-----IVSKSK------STGKVADNSENIETLKKEWLKEYEEE 1446

Query: 1556 TSQRIRESNEQLKKRIRLPTEEKINKIVEKKRLELEAEFEANVQKKAEEIXXXXXXXXXX 1615
            T +RIRE+ E LKKRIRLP+EE+I KI+ K++ ELE EF+  +++ A  +          
Sbjct: 1447 TIRRIREAEENLKKRIRLPSEERIQKIISKRKEELEEEFQRKLKENASSLTFSCD----- 1501

Query: 1616 XTEVLEKHKQDLENLKQEMQKKFDEDIAQIKKRAFEEGKQQASMKSTFLEKKIAKLETQI 1675
                           ++E     DED+     +      ++ S+ + F+++K  K++ Q+
Sbjct: 1502 ---------------RKETNDDPDEDLWNSPSKG---NSERPSVITDFMKQKNIKVQEQL 1543

Query: 1676 KAHDSAIPINDNSSATPAESGPTTQDVKQLTPILNNQAAILPGKPLPFNPAHFAFGMP-F 1734
            K   + +   D+ S++  +          L  + +++AA           + F+FG P F
Sbjct: 1544 KKAKNGVFFGDSRSSSMNKENSA------LVKVNDDKAA-----------STFSFGKPLF 1586

Query: 1735 GQTTSN--SFQNPF 1746
              TT++  SFQNPF
Sbjct: 1587 PSTTTSFQSFQNPF 1600

>Skud_9.19 Chr9 complement(40103..45145) [5043 bp, 1680 aa] {ON}
            YIL149C (REAL)
          Length = 1680

 Score =  462 bits (1189), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 487/1776 (27%), Positives = 878/1776 (49%), Gaps = 232/1776 (13%)

Query: 21   ISSFLELDASKVSTLDPAVVRQLSIKANQFGQLKAQNLKYSVTLDELKSSSERR-SEAFK 79
            IS FL + +  +  +  + +++L  K  +F + + +  K +V +DE+KS    R S+  K
Sbjct: 5    ISEFLHVPSESLRGIKHSALKRLYKKIGEFERSEKEVTKLNVFVDEIKSQYYTRISKLTK 64

Query: 80   LQLEKINENTESLRXXXXXXXXXXXXLIDEKANASKEVNLLKSQLTELKQQNEIFRSSKQ 139
            L    +NE++E               L +E++  +++++ L  QL           +S +
Sbjct: 65   L----LNESSEEKVINSKVMNRLQDQLKEERSRHTRKIDALNKQLN----------ASHE 110

Query: 140  DVVQLLNEKIGDLEASQ--------DEAKQLL-QNTKTLRKQVLELENEVQTFKSNDLRG 190
             + +L +E+    EAS         D  K +L +  K L++++LE+EN +Q  KSN +  
Sbjct: 111  TIKKLEDEEGAKEEASSWQDGLRNDDSTKHVLDKENKLLQRKLLEMENILQVCKSNAVSL 170

Query: 191  KAEMQRLTQEMNLLKSNNQWLEKELASKSEEFGSYRQRVNSELQTALSELNXXXXXXXXX 250
            + +    +QE  L   N +W E+ L+S +++         S LQ    +LN         
Sbjct: 171  QFKYDTASQEKELWLQNKKWTEERLSSCNQKALVDEVTKTSYLQNLEEKLNQTQTENESV 230

Query: 251  XXXXQTLKSRANDLSQQLQDKMTELKSLRDSSSIEKQEFTREMTLKQRLIDLLEKQIESF 310
                + L  +   LS  +++K+ E+K+L+D+++ EK EF++EMTL++++ DLL  Q+ SF
Sbjct: 231  STYNKFLLDQNKKLSHLVEEKLLEIKNLKDTANTEKSEFSKEMTLQKKMNDLLRSQLTSF 290

Query: 311  KTEL-----ESARNKSVSNSDHVDAERXXXXXXXXXXXXXXXXXXXXAVKLEETVDEL-- 363
            +        E   +K   N +H+D                        +KLE++ +E   
Sbjct: 291  ERGHSLRPKEKGDDKLCKNPEHIDV---------------AEELIDAKLKLEKSKEECQL 335

Query: 364  ---LSTDGERGAGNTSKVSLDSKNSIVPKLHGDIGLLKKRLIQERRQKEQLQYQVEAFVL 420
               + +D     G T  V+ ++    V KL  +I  LK++L++ER QK Q+Q Q++ FVL
Sbjct: 336  LKNIVSDCIEENGTT--VNTNTAAPTVGKLFSNIKTLKRQLVKERSQKFQVQNQLKDFVL 393

Query: 421  ELEHKVPVLNSFKERTEMLEKELSDVALMLEATSKDKEEKEHELTSVKSKIADYETQIHS 480
            ELEHK P L SFKERTE+LE EL     +LE  S  K + E +LTS++ KI  YE  IHS
Sbjct: 394  ELEHKTPALVSFKERTELLEHELKCSTELLETMSLAKRKDEKKLTSLEQKINSYEANIHS 453

Query: 481  LVRQRSDLAHQVQHLLIQVSVRNDSNGPLTPEETNFIKKIINSSESPVEQDAQRIISERL 540
            LVRQR DLA QV+ LL  +S    +  PL+ +E   ++K++ S  +  E+D+Q II+E+L
Sbjct: 454  LVRQRLDLARQVKILLSNISAIQTTTSPLSNDELMSLRKLLESENTVNERDSQIIITEKL 513

Query: 541  VRFESMVELQEKNMELLNSIRNLADKLXXXXXXXXXXXXXXXXXXXXXXXXXILTLQEYN 600
            V F+++ ELQEKNMELL+ IR LADKL                         I+ ++  N
Sbjct: 514  VEFKNIDELQEKNMELLDCIRILADKLETNEGEADKTVAKIENQTIKEAKEAIIEMESIN 573

Query: 601  KSLESQLEIIAKERDAFKILASDKGTSNGPSNVNSSENRHLVLAEEKIKELENHLSSLTE 660
              L  ++ I+ +ERD++K+LAS    +N       +E       E+KI+EL++ LSS   
Sbjct: 574  SKLALRVNILTRERDSYKLLAS----ANDNKTHADTEGITEATYEKKIRELQSKLSSTRV 629

Query: 661  ESAKNIKLLNEEIHSLYRAQADTSVNLEKERSSRILAEDRSKLISNTLEMTKMENDELRK 720
            ES+  I+ LN ++ +  ++Q D  + L++  + ++L  ++  ++   +   K    +L K
Sbjct: 630  ESSAIIQNLNGQLLTYKKSQTDGKIALQEFENFKVLVAEKEAMLQERINHLKT---QLEK 686

Query: 721  RFHSLQENILKQDSKTQQTIESLISCKXXXXXXXXXXXXXXXERDLLRSIQENLKKENES 780
            +  S    +  QD K    +  L   +               E   L +++E+L ++ E 
Sbjct: 687  QRLSAAPPV--QDYKY-SNLTDLSHSENKIGSLKYEISNLKKENTGLIAMKESLTRDLER 743

Query: 781  LSEERNNMRILITQLQTLQTERESLLEETQKNFQGKTNKLETELSDTLEKLDAKSKEISD 840
              +E+  + + +++ +T   E+  +    +  +  +   LE  L +   +L++K +EI  
Sbjct: 744  CCKEKMQLHVKLSESETSHNEQNLIFGSKELQYSTRIKVLEKNLKELNVRLESKEQEIKT 803

Query: 841  YISTKDSQEKWYQEKFDRLNEELNNSREKLSSKLTDIQHLELKVESLNNKLEESEARIQA 900
              S+K+SQ KW Q   D   + L +   +LS+K T I  L L++E+L N+L  ++ + + 
Sbjct: 804  LQSSKNSQLKWAQNTIDDTEKNLKSVSAELSNKETTIGRLSLEIENLGNELRMTKLQYKF 863

Query: 901  FNALNYSESVESQTETLRQELEKTRIKLADAYSQVEQYKSMADSSEESATAIKDALEQSK 960
             +  + + ++E    TLR+EL++T+I+L DA+SQ++ Y+ +  ++E     +   L+++K
Sbjct: 864  LSNTSDTNTLEP---TLRKELKQTQIELKDAHSQIKAYEEIISTNENVLKELNGELKKAK 920

Query: 961  AEYTEKIETLTKERDMFKDQVPILK---DQISNLNNELNHQKSQFESQ---ISDYTRNLE 1014
             +   KI+   KE+   ++++  L+   D+I  L  +L    S    Q   + D  + ++
Sbjct: 921  EDCETKIQLENKEKGAKEEELSHLRKELDEIRCLQPKLREGASYLVLQSEKVGDQAQRIQ 980

Query: 1015 DLKAKQSELDNMKAEYEQKISKIQEDLNQQTSYANTAQKNYEQELQKHADVSKKISLLRA 1074
            ++K K   +D M A  E              +Y       Y+ EL+ + D+S+ +  L  
Sbjct: 981  EMKNK---IDKMAAIIE--------------AYQKEESSQYQSELKTNKDLSEWVMRLEK 1023

Query: 1075 EAQKYKSETETLRNAAENAKKALEQSELSWEKQSSDYEDELRLAHQRIEDLNAQSKILYD 1134
            EA  Y++E +  + +  + ++ L++ E  W ++ +DYE EL    ++ E L  ++ +L +
Sbjct: 1024 EAFDYQTELKKTKKSLYSTQELLDRHEKKWMEEKADYERELISNIEQTESLRVENSVLIE 1083

Query: 1135 QIDFLSKGKPTSSEDLMPISTETRNLLTSLRREKDILETKLEVSTREEKVLRQKLKLIES 1194
            +ID  ++G  ++ + L  +S     L ++LR E+  LETKL    R+  +LRQK     +
Sbjct: 1084 KIDGATEGSNSNEKYLELVS-----LFSNLRHERSSLETKLTTCKRDLALLRQK----NA 1134

Query: 1195 DLEGSRIELSKLQRAAS-------GNSATLKDQEEIMTQLNQLNLLRESNI----TLRNE 1243
             LE S   +  LQRA +         +  + + E+I+ ++ Q+N+LRE+N     +L+N 
Sbjct: 1135 SLEKS---IGDLQRANTVPRNKVQCPAVIIDEYEKIIKEIAQVNILRENNAILHKSLKNV 1191

Query: 1244 AQKNGERSRELKAELDALYGKVQPLESKVTLLQNSVREKDLQISLK-------NEEAERW 1296
             +KN           +A+Y ++  ++ +++ LQ  + +   Q+S+          E E+ 
Sbjct: 1192 TEKN-----------EAIYKELINMQEEISRLQGHLIQTKEQVSINANKVLAYESEIEQC 1240

Query: 1297 KQRSQDILHKYERIDPEEHQKLADKVSELQQEIKSKSDENEELDTRFKRLKQQAHEKLNA 1356
            KQR QD+  + +     E +KL + + +L+ ++ +  + N +L+ +F RLK+QAHEKL+A
Sbjct: 1241 KQRYQDLSQQQKLTHKNETEKLHNVIGDLEVKLLNVQNANADLENKFNRLKKQAHEKLDA 1300

Query: 1357 AKTAQSTLTSQLNDLKATKEKLENDLGSQKEEVKNLESKITDIEKNKSSEKNDLQEQLEN 1416
            +K  Q+ LT++LN+LK TK+KLE       E + N ESK+ D+E                
Sbjct: 1301 SKKQQTALTNELNELKETKDKLE-------ENLHNEESKVVDLE---------------- 1337

Query: 1417 SQAKLLETENKLEQVT-SSSALLEKELNERIESLMNKIKLLEEDLEKAKTESPNDGSQSS 1475
               KL E   ++ +V+    ++  K   E IESL  ++++           + ND S + 
Sbjct: 1338 --LKLKEHGLQVGEVSKDHDSIAFKPFVEEIESLKKELQVF---------RNANDASDAF 1386

Query: 1476 ELVENTSKIVENLKIEFEEEKAKMISDKESELREQFEEEKASILEAKEQELREQLATQKL 1535
            E ++N            EEEK K+I +K  +  ++ ++   ++ ++K  E        ++
Sbjct: 1387 EKIKNN----------MEEEKNKIIDEKTKDFEKKLQD---AVNKSKSNE-------SEV 1426

Query: 1536 DPPVNIDEIKKKWEEEYEQKTSQRIRESNEQLKKRIRLPTEEKINKIVEKKRLELEAEFE 1595
            +   +I+ +KK+W +EYE++T +RI+E+ E LKKRIRLP+EE+I KI+ K++ ELE EFE
Sbjct: 1427 ENSEHIEALKKEWLKEYEEETVKRIKEAEENLKKRIRLPSEERIQKIISKRKGELEQEFE 1486

Query: 1596 ANVQKKAEEIXXXXXXXXXXXTEVLEKHKQDLENLKQEMQKKFDEDIAQIKKRAFEEGKQ 1655
              +++  + +            E+     +                             +
Sbjct: 1487 RKLKENNKSLVFSGSNEEEAEDELWNSPSKG--------------------------SSE 1520

Query: 1656 QASMKSTFLEKKIAKLETQIKAHDSAIPINDNSSATPAESGPTTQDVKQLTPILNNQAAI 1715
            + S+ +  +++K  KL+ Q+K   +A+  ND                    P   N+   
Sbjct: 1521 KPSVVTDLIKQKNIKLQEQLKNVKNAVTFNDKR------------------PKSENKENN 1562

Query: 1716 LPGKPLPFN--PAHFAFGMP-FGQTTSN--SFQNPF 1746
            +P      N  P+ F+FG P F   TS+  SF NPF
Sbjct: 1563 IPDSAAADNRVPSAFSFGKPLFSSNTSSFQSFHNPF 1598

>NCAS0G00230 Chr7 complement(33629..38836) [5208 bp, 1735 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1735

 Score =  462 bits (1188), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 533/1835 (29%), Positives = 939/1835 (51%), Gaps = 203/1835 (11%)

Query: 16   IDVTTISSFLELDASKVSTLDPAVVRQLSIKANQFGQLKAQNLKYSVTLDELKSSSERRS 75
            +++  +++ LE+ A+ + T++P V+ +++ K     Q K    + + T+D  KS    + 
Sbjct: 2    VNLNNLATSLEVTATDLETIEPTVLEKINAKLLSSEQEKD---RLNATIDNFKSKMSSQF 58

Query: 76   EAFKLQLEKINENTESLRXXXXXXXXXXXXLIDEKANASKEVNLLKSQLT--ELKQQNEI 133
            +  K  LE + +  E L              I  +   ++  ++ K+ L   ++ ++NE 
Sbjct: 59   DTVKNDLELLQKEKELL---IQDKKQLESKCIQWEQQYAQHQDISKTDLASDDVIKENET 115

Query: 134  FRSSKQ----DVVQLLNEKIGDLEAS---QDEAKQLLQNTKT-LRKQVLELENEVQTFKS 185
            F+   Q    D++ L ++K+   +A+   +  A   LQN    +R Q+   ++E +  KS
Sbjct: 116  FKRDHQLLTSDLMNL-SKKLSSCDAALEKKSTAYLELQNDNIDIRTQLNNFKSETKGLKS 174

Query: 186  NDLRGKAEMQRLTQEMNLLKSNNQWLEKELASKSEEFGSYRQRVNSELQTALSELNXXXX 245
               R   + + L    + +K+  +   KEL+  S +F + +   ++EL+ A   L+    
Sbjct: 175  KYERKVKDFEELKNAYSSMKTYEETSRKELSEMSNKFYTLKTSSSNELRNAKDALHSLEK 234

Query: 246  XXXXXXXXXQTLKSRANDLSQQLQDKMTELKSLRDSSSIEKQEFTREMTLKQRLIDLLEK 305
                     +  K R N+L+  + D++ + KSL +  +  K+ FTREMTL Q   DLL++
Sbjct: 235  QYELLLEENKAFKERNNELTTTVSDELFKKKSLENDLNELKESFTREMTLTQHENDLLKE 294

Query: 306  QIESFK-TELESARNKSVSNSDHVDAERXXXXXXXXXXXXXXXXXXXXAVKLEETVDELL 364
             IE  K T  E+    S    D +  E                      V L + +++ L
Sbjct: 295  HIEYLKNTTKETTGGTSTLEKDRLLHE-------LVDIKKSLEKSELENVHLNDFIEQYL 347

Query: 365  STDGERGAGNTSKVSLDSKNSIVPKLHGDIGLLKKRLIQERRQKEQLQYQVEAFVLELEH 424
            + + E  + N                  ++ LLK++LI+E+RQK+ LQ QVE FV+ELE+
Sbjct: 348  TENEESTSDN------------------ELVLLKEQLIKEKRQKDYLQEQVELFVIELEN 389

Query: 425  KVPVLNSFKERTEMLEKELSDVALMLEATSKDKEEKEHELTSVKSKIADYETQIHSLVRQ 484
            ++P +NS K+R + LE+EL  +  +LE T ++ + +  ELT+   ++ +    I+ L+ Q
Sbjct: 390  QLPTVNSLKDRNQTLEQELMQITGLLEETERESDIRIKELTTENRRLKEQTENINVLMSQ 449

Query: 485  RSDLAHQVQHLLIQVSVRNDSNGPLTPEETNFIKKIINSSESPVEQDAQRIISERLVRFE 544
            R DLAHQVQ LL+ + ++      LTP+E  F++KII S  S  + D+Q+IISERLV+F 
Sbjct: 450  RVDLAHQVQFLLLNLDLKKHQQHLLTPDEITFLRKIIKSRNSQNDSDSQKIISERLVKFH 509

Query: 545  SMVELQEKNMELLNSIRNLADKLXXXXXXXXXXXXXXXXXXXXXXXXXILTLQEYNKSLE 604
             +  LQ++NMELL + RNLA++L                         I  LQE    L 
Sbjct: 510  DISVLQKQNMELLTTTRNLAEQLESSDTKSVQKITRNESKEK------IAKLQESINGLT 563

Query: 605  SQLEIIAKERDAFKILASDKGTSNGPSNVNSSENRHLVLAEEKIKELENHLSSLTEESAK 664
            S+LE + KE+DA+K+L+        P+    S+   L   EE++ +LE  +SSL    A+
Sbjct: 564  SKLEKLQKEKDAYKLLSLQNTGEQTPTEELRSQ---LQKKEEQLTKLE-RMSSLDSHLAE 619

Query: 665  -NIKLLNEEIHSLYRAQADTSVNLEKERSSRILAEDRSKLISNTLEMTKMENDELRKRFH 723
               K+LN+ I  L + + D +  + KE S R +AE +SK++ ++LE+   + D   K++ 
Sbjct: 620  EKAKVLNQSIIKLKKEKYDLNNAIIKETSQRAIAEKKSKMLEDSLELLHKKYDLAVKKYE 679

Query: 724  SLQ--------ENILKQDSKTQQTIESLISCKXXXXXXXXXXXXXXXERDLLRSIQENL- 774
              +        ENI  + S+  +T ++ IS                     + S ++NL 
Sbjct: 680  HYETLLNDHNAENI--KHSRENETTQAKISILQKE----------------IESYKQNLL 721

Query: 775  --KKENES----LSEERNNMRILITQLQTLQTERE---SLLEETQKNFQGKTNKLETELS 825
               K+NE+    L+        L ++L T++ E E   +L++E +  ++   +  E  L 
Sbjct: 722  QYSKDNENTLSKLAAATQEKETLGSRLSTVKNELEQKINLMQERETYYKEHDSISERLLK 781

Query: 826  DTLEKLDAKSKEISDYISTKDSQEKWYQEKFDRLNEELNNSREKLSSKLTDIQHLELKVE 885
             +  +L+ K KE+ D+ + K+SQ  WYQ++ D L    +  + +L+ +LT I    LK+ 
Sbjct: 782  KSKIQLEDKIKEVKDFEAKKNSQINWYQKRLDSLTTTNDKLQVELNKELTKINIQRLKIS 841

Query: 886  SLNNKLEESEARIQAFNALNYSESVESQTETLRQELEKTRIKLADAYSQVEQYKSMADSS 945
             L   L ++          N S S+      + Q+ EK + +L +   ++ QY+ + + +
Sbjct: 842  DLEKTLSQN---------TNGSSSLPR----VDQDFEKLKNELKEKQLEINQYRDLLNLA 888

Query: 946  EESATAIKDALEQSKAEYTEKIETLTKERDMFKDQVPILKDQISNLNNELNHQKSQFESQ 1005
            EE+   ++  L + +    + +E     ++    Q+  L  + S++N+ L  QK++ E  
Sbjct: 889  EETKNRLQKDLNKQRQIVDDAMEG----KEQLDQQLAELTQECSSMNSLLQKQKAKCEDD 944

Query: 1006 ---ISDYTRNLEDLKAKQSELDNMKAEYEQKISKIQEDLNQQTSYANTAQKNYEQELQKH 1062
               I D     E+LK   S L+N       KI+ ++ ++ ++T      +  Y+++L K 
Sbjct: 945  QKIIQDKATETENLKNSLSSLEN-------KITTLENEMVEKTKSFEEKENTYKEQLHKL 997

Query: 1063 ADVSKKISLLRAEAQKYKSETETLRN---AAENAKKALEQSELSWEKQSSDYEDELRLAH 1119
            ++ S  I  + AE + YK+  + L+    A E+A  A  Q  L  +       DE +   
Sbjct: 998  SESSTLIEKMEAENKAYKTSLDGLKANIAAYEDAISAYRQKLLDEKFNHELQVDEFK--- 1054

Query: 1120 QRIEDLNAQSKILYDQIDFLSKGKPTSSED----LMPISTETRNLLTSLRREKDILETKL 1175
            + I++LN Q  I   +  F++    T+S D    ++  +++   L+ +LRRE+D L+ KL
Sbjct: 1055 ETIDNLNFQIHIQKGKRSFITSEGSTTSNDTDETVVNDTSDKNELILALRRERDGLDIKL 1114

Query: 1176 EVSTREEKVLRQKLKLIESDLEGSRIELSKLQRAASGNSATLKDQEEIMTQLNQLNLLRE 1235
            ++S RE   LR++++ +++ L+ +R     L+   SG   T +  +E + QLN+LN L+E
Sbjct: 1115 DISQREVYSLREQVENLKNSLDETRQSFKGLESEVSGEMTTTEQHKEAVKQLNELNTLKE 1174

Query: 1236 SNITLRNEAQKNGERSRELKAELDALYGKVQPLESKVTLLQNSVREKDLQISLKNEEAER 1295
            +N  L+ + ++N + +  +  +L+ L  ++ PL+ KV  L+NS+ EKD Q++L +EE ER
Sbjct: 1175 TNEQLQQKLRENDKENNIIHTKLELLKNEMNPLKDKVERLKNSIMEKDQQLTLLSEENER 1234

Query: 1296 WKQRSQDILHKYERIDPEEHQKLADKVSELQQEIKSKSDENEELDTRFKRLKQQAHEKLN 1355
            WK RS++IL K +++D EEH KL +++S L+ ++ +K+ +NE+L+ RF RLK+QAHEKL+
Sbjct: 1235 WKLRSREILMKRQQVDLEEHNKLMEELSTLKTQLDTKTKDNEDLNDRFNRLKKQAHEKLD 1294

Query: 1356 AAKTAQSTLTSQLNDLKATKEKLENDLGSQKEEVKNLESK----------ITDIEKNKSS 1405
            AAK   ++LT+++ DL   K KLE DL  +++ ++ +ES+          IT +EK    
Sbjct: 1295 AAKAQNASLTAEITDLIDAKSKLEIDLDEERKRIQEVESQLKQKPDNPDVITALEK---- 1350

Query: 1406 EKNDLQEQLENSQAKLLETENKLEQVTSSSALLEKELNERIESLMNKIKLLEEDLEKAKT 1465
               +L + +ENS+    + E  L++  +SS  L K+L E + SL ++++ L+    +   
Sbjct: 1351 ---ELSDSVENSK----KIEENLQETVNSSLELNKKLTEEVNSLKSQLETLK---NQNGV 1400

Query: 1466 ESPNDGSQSSELVENTSKIVENLKIEFEEEKAKMISDKESELREQFEEEKASILEAKEQE 1525
             S  DGS  +      S+ + +LK  FE EK ++I+  + E ++Q EEEK  +LE KE+E
Sbjct: 1401 ISVADGSAIN------SETIAHLKESFEVEKTELITTLKEEFKKQLEEEKKKLLEEKEKE 1454

Query: 1526 LREQLATQKLDPPVNIDEIKKKWEEEYEQKTSQRIRESNEQLKKRIRLPTEEKINKIVEK 1585
              +   T     P++I+++K +WEE+ E+   QRI ++ E LKKRIRLP+EEKIN+++EK
Sbjct: 1455 YYDSKPTGG-SEPIDIEKMKSEWEEKQEEIIMQRIADAEENLKKRIRLPSEEKINRVIEK 1513

Query: 1586 KRLELEAEFEANVQKKAEEIXXXXXXXXXXXTEVLEKHKQDLENLKQEMQKKFDEDIAQI 1645
            +R ELE E+E  ++++               T + E+ ++++E   +E++ KFD ++A++
Sbjct: 1514 RRKELEEEYEKKLKRQG----------LTTETAIEEELRKEVE---RELRVKFDNELAEV 1560

Query: 1646 KKRAFEEGKQQASMKSTFLEKKIAKLETQIKAHDSAIPINDNS------SATPAESGPT- 1698
            KK+AF EGKQQ+ MK+T LE+K++KLE+Q  A  S  P  ++S       AT    GP+ 
Sbjct: 1561 KKKAFLEGKQQSQMKTTLLERKLSKLESQ--ASPSRTPDLESSQKENTEGATKTTLGPSK 1618

Query: 1699 ----------TQD-----VKQLTPILN-NQAAILP--GKPLPF-----NPAHFAFGMPFG 1735
                      T D     V Q   +L  N+ ++ P  G   PF     N   F F     
Sbjct: 1619 INLLPFSMSNTDDSIEKQVPQGEKVLQINRRSLEPSFGSSNPFTLPTQNKPAFLFASNNH 1678

Query: 1736 QTTSNSFQNPFNSQPPEQTPNSPKRPSEEPVGGSP 1770
              T      P N  P + T  +P         G+P
Sbjct: 1679 SQTKKQDGLPINKSPFQTTLFAPFSSKTTTPNGTP 1713

>YIL149C Chr9 complement(63028..68067) [5040 bp, 1679 aa] {ON}
            MLP2Myosin-like protein associated with the nuclear
            envelope, connects the nuclear pore complex with the
            nuclear interior; involved in the Tel1p pathway that
            controls telomere length
          Length = 1679

 Score =  439 bits (1129), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 484/1774 (27%), Positives = 873/1774 (49%), Gaps = 201/1774 (11%)

Query: 21   ISSFLELDASKVSTLDPAVVRQLSIKANQFGQLKAQNLKYSVTLDELKSSSERRSEAFKL 80
            IS FL +    +  +   V+R+L  K  +F + + +  K +V +DE+KS    R    K 
Sbjct: 5    ISEFLNVPFESLQGVTYPVLRKLYKKIAKFERSEEEVTKLNVLVDEIKSQYYSRISKLK- 63

Query: 81   QLEKINENTESLRXXXXXXXXXXXXLIDEKANASKEVNLLKSQL-------------TEL 127
            QL  ++E++E               L +E++   +E++ LK QL               +
Sbjct: 64   QL--LDESSEQKNTAKEELNGLKDQLNEERSRYRREIDALKKQLHVSHEAMREVNDEKRV 121

Query: 128  KQQNEIFRSSKQDVVQLLNEKIGDLEASQDEAKQLLQNTKTLRKQVLELENEVQTFKSND 187
            K++ +I++S  Q      N+ + D          L +  K LR++++E+EN +Q  KSN 
Sbjct: 122  KEEYDIWQSRDQG-----NDSLND---------DLNKENKLLRRKLMEMENILQRCKSNA 167

Query: 188  LRGKAEMQRLTQEMNLLKSNNQWLEKELASKSEEFGSYRQRVNSELQTALSELNXXXXXX 247
            +  + +     QE  L+  + + +E++L+S S++  +     +S ++    +L       
Sbjct: 168  ISLQLKYDTSVQEKELMLQSKKLIEEKLSSFSKKTLTEEVTKSSHVENLEEKLYQMQSNY 227

Query: 248  XXXXXXXQTLKSRANDLSQQLQDKMTELKSLRDSSSIEKQEFTREMTLKQRLIDLLEKQI 307
                   + L ++   LSQ +++K+ E+K+L+D++S+EK EF++EMTL++ + DLL  Q+
Sbjct: 228  ESVFTYNKFLLNQNKQLSQSVEEKVLEMKNLKDTASVEKAEFSKEMTLQKNMNDLLRSQL 287

Query: 308  ESFKTE-----LESARNKSVSNSDHVDAERXXXXXXXXXXXXXXXXXXXXAVKLEETVDE 362
             S + +     +E   + S  N +H D                         +L+  V  
Sbjct: 288  TSLEKDCSLRAIEKNDDNSCRNPEHTDV-----IDELIDTKLRLEKSKNECQRLQNIV-- 340

Query: 363  LLSTDGERGAGNTSKVSLDSKNSIVPKLHGDIGLLKKRLIQERRQKEQLQYQVEAFVLEL 422
            +  T  E     TS VS       V KL  DI +LK++LI+ER QK QLQ Q+E F+LEL
Sbjct: 341  MDCTKEEEATMTTSAVS-----PTVGKLFSDIKVLKRQLIKERNQKFQLQNQLEDFILEL 395

Query: 423  EHKVPVLNSFKERTEMLEKELSDVALMLEATSKDKEEKEHELTSVKSKIADYETQIHSLV 482
            EHK P L SFKERT+ LE EL     +LE  S  K ++E E+TS++ KI   E  IHSLV
Sbjct: 396  EHKTPELISFKERTKSLEHELKRSTELLETVSLTKRKQEREITSLRQKINGCEANIHSLV 455

Query: 483  RQRSDLAHQVQHLLIQVSVRNDSNGPLTPEETNFIKKIINSSESPVEQDAQRIISERLVR 542
            +QR DLA QV+ LL+  S   ++  PL+ +E   ++KI+ SS    E D+Q II+ERLV 
Sbjct: 456  KQRLDLARQVKLLLLNTSAIQETASPLSQDELISLRKILESSNIVNENDSQAIITERLVE 515

Query: 543  FESMVELQEKNMELLNSIRNLADKLXXXXXXXXXXXXXXXXXXXXXXXXXILTLQEYNKS 602
            F ++ ELQEKN+ELLN IR LADKL                         I+ L+  N  
Sbjct: 516  FSNVNELQEKNVELLNCIRILADKLENYEGKQDKTLQKVENQTIKEAKDAIIELENINAK 575

Query: 603  LESQLEIIAKERDAFKILASDKGTSNGPSNVNSSENRHLVLAEEKIKELENHLSSLTEES 662
            +E+++ I+ +ERD++K+LAS +      ++V S E       E+KI+ELE  LSS   E+
Sbjct: 576  METRINILLRERDSYKLLASTEENKANTNSVTSME----AAREKKIRELEAELSSTKVEN 631

Query: 663  AKNIKLLNEEIHSLYRAQADTSVNLEKERSSRILAEDRSKLISNTLEMTKMENDE----L 718
            +  I+ L +E+    ++Q      LE   + + LA+++ +++   ++  K E ++    +
Sbjct: 632  SAIIQNLRKELLIYKKSQCKKKTTLEDFENFKGLAKEKERMLEEAIDHLKAELEKQKSWV 691

Query: 719  RKRFHSLQENILKQDSKTQQTIESLISCKXXXXXXXXXXXXXXXERDLLRSIQENLKKEN 778
                H  +E    + S+++  I+SL                   E       +E+L ++ 
Sbjct: 692  PSYIHVEKERASTELSQSRIKIKSL----------EYEISKLKKETASFIPTKESLTRDF 741

Query: 779  ESLSEERNNMRILITQLQTLQTERESLLEETQKNFQGKTNKLETELSDTLEKLDAKSKEI 838
            E   +E+  +++ + + +    E +      +  ++ K  +LE  L      L +K +EI
Sbjct: 742  EQCCKEKKELQMRLKESEISHNENKMDFSSKEGQYKAKIKELENNLERLRSDLQSKIQEI 801

Query: 839  SDYISTKDSQEKWYQEKFDRLNEELNNSREKLSSKLTDIQHLELKVESLNNKLEESEARI 898
                S KDSQ KW Q   D    ++ +   +LS+K T I+ L  ++E+L+ +L +++ + 
Sbjct: 802  ESIRSCKDSQLKWAQNTIDDTEMKMKSLLTELSNKETTIEKLSSEIENLDKELRKTKFQ- 860

Query: 899  QAFNALNYSESVESQTETLRQELEKTRIKLADAYSQVEQYKSMADSSEESATAIKDALEQ 958
              +  L+ +    +   TLR+ELE+ +++L DA SQ++ Y+ +  S+E +   +K+ L +
Sbjct: 861  --YKFLDQNSDASTLEPTLRKELEQIQVQLKDANSQIQAYEEIISSNENALIELKNELAK 918

Query: 959  SKAEYTEKIETLTKERDMFKDQVPILKDQISNLNNELNHQKSQFESQISDYTRNLEDLKA 1018
            +K  Y  KIE   KE+          ++ +S L  EL   ++  + ++ +   +      
Sbjct: 919  TKENYDAKIELEKKEK-------WAREEDLSRLRGELGEIRA-LQPKLKEGALHF----V 966

Query: 1019 KQSELDNMKAEYEQKISKIQEDLNQQTSYANTAQKN----YEQELQKHADVSKKISLLRA 1074
            +QSE   ++ E E +I K+ E + + ++     +K     Y+  ++++ D+S+ +  L  
Sbjct: 967  QQSE--KLRNEVE-RIQKMIEKIEKMSTIVQLCKKKEMSQYQSTMKENKDLSELVIRLEK 1023

Query: 1075 EAQKYKSETETLRNAAENAKKALEQSELSWEKQSSDYEDELRLAHQRIEDLNAQSKILYD 1134
            +A   ++E    +++  +A+  L++ E  W ++ +DYE EL    ++ E L  ++ +L +
Sbjct: 1024 DAADCQAELTKTKSSLYSAQDLLDKHERKWMEEKADYERELISNIEQTESLRVENSVLIE 1083

Query: 1135 QIDFLSKGKPTSSEDLMPISTETRNLLTSLRREKDILETKLEVSTREEKVLRQKLKLIE- 1193
            ++D          +D + + +    L ++LR E++ LETKL    RE   ++QK   +E 
Sbjct: 1084 KVD--DTAANNGDKDHLKLVS----LFSNLRHERNSLETKLTTCKRELAFVKQKNDSLEK 1137

Query: 1194 --SDLEGSRIELSKLQRAASGNSATLKDQ-EEIMTQLNQLNLLRESNITLRNEAQKNGER 1250
              +DL+ ++     L       SA + D+ ++I  ++ Q+N+L+E+N  L+   +   E+
Sbjct: 1138 TINDLQRTQT----LSEKEYQCSAVIIDEFKDITKEVTQVNILKENNAILQKSLKNVTEK 1193

Query: 1251 SRELKAELDALYGKVQPLESKVTLLQNSVREKDLQISLKNEEAERWKQRSQDILHKYERI 1310
            +RE+  +L+    ++  L+  +   +  V     +I +   E E+ KQR QD+  + +  
Sbjct: 1194 NREIYKQLNDRQEEISRLQRDLIQTKEQVSINSNKILVYESEMEQCKQRYQDLSQQQKDA 1253

Query: 1311 DPEEHQKLADKVSELQQEIKSKSDENEELDTRFKRLKQQAHEKLNAAKTAQSTLTSQLND 1370
              ++ +KL +++S+L+ ++ S  + N +L+ +F RLK+QAHEKL+A+K  Q+ LT++LN+
Sbjct: 1254 QKKDIEKLTNEISDLKGKLSSAENANADLENKFNRLKKQAHEKLDASKKQQAALTNELNE 1313

Query: 1371 LKATKEKLENDLGSQKEEVKNLESKITDIEKNKSSEKNDLQEQLENSQAKLLETENKLEQ 1430
            LKA K+KLE DL                                EN++   L+T+ K  +
Sbjct: 1314 LKAIKDKLEQDL------------------------------HFENAKVIDLDTKLKAHE 1343

Query: 1431 VTSSSALLEKELNERIESLMNKIKLLEEDLEKAKTESPNDGSQSSELVENTSKIVENLKI 1490
            + S     + E  +   +LM +I+ L+++L+  KT              ++S   E LK+
Sbjct: 1344 LQSEDVSRDHE-KDTYRTLMEEIESLKKELQIFKT------------ANSSSDAFEKLKV 1390

Query: 1491 EFEEEKAKMISDKESELREQFEEEKASILEAKEQELREQLATQKLDPPVNIDEIKKKWEE 1550
              E+EK ++I ++  E             E K QE   +  + + +   +I+ +KK+W +
Sbjct: 1391 NMEKEKDRIIDERTKE------------FEKKLQETLNKSTSSEAEYSKDIETLKKEWLK 1438

Query: 1551 EYEQKTSQRIRESNEQLKKRIRLPTEEKINKIVEKKRLELEAEFEANVQKKAEEIXXXXX 1610
            EYE +T +RI+E+ E LKKRIRLP+EE+I KI+ K++ ELE EF   +++ A  +     
Sbjct: 1439 EYEDETLRRIKEAEENLKKRIRLPSEERIQKIISKRKEELEEEFRKKLKENAGSLTF--- 1495

Query: 1611 XXXXXXTEVLEKHKQDLENLKQEMQKKFDEDIAQIKKRAFEEGK-QQASMKSTFLEKKIA 1669
                            L+N      K   ED  +    +  +G  ++ S  + F+ +K  
Sbjct: 1496 ----------------LDN------KGSGEDAEEELWNSPSKGNSERPSAVAGFINQKNL 1533

Query: 1670 KLETQIKAHDSAIPINDNSSATPAESGPTTQDVKQLTPILNNQAAILPGKPLPFNPAHFA 1729
            K + Q+K   + +  ND+ S    +             I+++ AA    K +P     F+
Sbjct: 1534 KPQEQLKNVKNDVSFNDSQSMVTNKEN----------NIVDSSAA--GNKAIP----TFS 1577

Query: 1730 FGMPFGQTTSN---SFQNPFNSQPPEQTPNSPKR 1760
            FG PF  + ++   SFQNPF +       N+P R
Sbjct: 1578 FGKPFFSSNTSSLQSFQNPFTASQSNINTNAPLR 1611

>KNAG0C06590 Chr3 (1276738..1281693) [4956 bp, 1651 aa] {ON} Anc_5.702
            YIL149C
          Length = 1651

 Score =  394 bits (1012), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 458/1674 (27%), Positives = 817/1674 (48%), Gaps = 173/1674 (10%)

Query: 117  VNLLKSQLTELKQQNEIFRSSKQDVVQLLNEKIGDLEASQDEAKQLLQNTKTLRKQVLEL 176
            V  ++ ++  + ++N + +SS  D+ +++ E+  ++   +DE   +   T  LR ++  L
Sbjct: 43   VRTVEGRMELIVEENRLLKSSNLDMSRIVTERAEEIGRLRDEVSTVTGQTSALRAELENL 102

Query: 177  ENEVQTFKSNDLRGKAEMQRLTQEMNLLKSNNQWLEKELASKSEEFGSYRQR-VNSELQT 235
            +N+++  K  DL  ++E       ++ LK  N  L  E+  +++E  S RQ    ++L +
Sbjct: 103  QNDLELLKDKDLALQSERDSTVALLDGLKLENSALRAEI-EQAKELASIRQHDYEADLDS 161

Query: 236  ALSELNXXXXXXXXXXXXXQTLKSRANDLSQQLQDKMTELKSLRDSSSIEKQEFTREMTL 295
                L               +L S+   LSQ+L  +  +++ L D+  + + E+T E+ L
Sbjct: 162  KTGALVSKEEELRLAKSERASLISQTERLSQELLQRDADIRQLVDADKLRQDEYTDEINL 221

Query: 296  KQRLIDLLEKQIESFKTELESARNKSVSNSDHVDAERXXXXXXXXXXXXXXXXXXXXAVK 355
            ++    LL++Q+ S + E           +  V  E                     ++ 
Sbjct: 222  QKHRARLLQEQVASLEKE-----------AKLVGHETEPEYEIPPPGEEVALQQRSHSI- 269

Query: 356  LEETVDELLSTDGERGAGNTSKVSLDSKNSIVPKLHGDIGLLKKRLIQERRQKEQLQYQV 415
               ++D LL+       GN      D  +  + +L+ +I +L  RL +E   K++L+ QV
Sbjct: 270  ---SMDSLLT-------GN------DETSHSMSELNNNISILSNRLKRETLSKQKLEKQV 313

Query: 416  EAFVLELEHKVPVLNSFKERTEMLEKELSDVALMLEATSKDKEEKEHELTSVKSKIADYE 475
              FV ELE   P++ SFK+++E  + ++  + L LE  +KDKE    E+   K ++    
Sbjct: 314  HKFVTELEQTAPIIKSFKQKSEQSDAQIHKLQLHLEHVTKDKETIFQEVEQYKKQLEQIS 373

Query: 476  TQIHSLVRQRSDLAHQVQHLLIQVSVRNDSNGPLTPEETNFIKKIINSSESPVEQ----- 530
             Q   L R+R DLA Q+Q+LL+   V+ DS+ PLT  E ++IK+I+N+   P E      
Sbjct: 374  GQDKILRRERFDLARQLQYLLLNGFVK-DSDDPLTSSEFSYIKEILNTD--PEEGNTSST 430

Query: 531  DAQRIISERLVRFESMVELQEKNMELLNSIRNLADKLXXXXXXXXXXXXXXXXXXXXXXX 590
            D+Q IIS+R+++F+S+VELQ++N+ LL+++R L+D+                        
Sbjct: 431  DSQLIISKRMLKFKSIVELQQQNINLLSAVRTLSDR---AETLERKLESGDSIEAINEAK 487

Query: 591  XXILTLQEYNKSLESQLEIIAKERDAFKILASDKGTSNGPSNVNSSENRHLVLAEEKIKE 650
              +L LQ+YN SLE+++E +  +  A +   S      G S+++   N         I+ 
Sbjct: 488  QTLLDLQQYNSSLEAKVESLTNKLKANEHFTSIGDGEFGNSDLSDGNN---------IQA 538

Query: 651  LENHLSSLTEESAKNIKLLNEEIHSLYRAQADTSVNLEKERSSRILAEDRSKLISNTLEM 710
            L+N   SL  ES++ I  L  +I++L ++++D +   E   +S+ L EDR K+  + L++
Sbjct: 539  LKNKYDSLMAESSETIGHLYSQINNLQQSKSDLAKECESLINSKHLIEDRLKITQDMLDL 598

Query: 711  TKMENDELRKRFHSLQENILKQDSKTQQTIESLISCKXXXXXXXXXXXXXXXERDLLRSI 770
            +K EN  LR R  +  + + +++ +T QTI+  + C                E+D+L++ 
Sbjct: 599  SKNENSTLRNRIKNTSQALKEREVETSQTIKKYLDCVAKLDVIQRQLENTLVEKDILQNA 658

Query: 771  QENLK-KENESLSEERNNMRILITQLQTLQTERESLLEETQKNFQGKTNKLETELSDTLE 829
            Q +++ K N++L +ERNN + LI QL+ LQ  ++  L++ Q + Q K + LE E ++   
Sbjct: 659  QSSIENKLNQAL-KERNNFQGLIPQLRALQKNQDEQLKDIQVSLQNKIDDLELENTELRN 717

Query: 830  KLDAKSKEISDYISTKDSQEKWYQEKFDRL---NEELNNSREKLSSKLTDIQHLELKVES 886
            K+D K    S  ++   ++ +WYQ KFD L   N+ LN   EK+    + I+ L +K ++
Sbjct: 718  KIDTKETSPSSALTNPKAELEWYQTKFDSLSGSNDALN---EKMIECASTIETLTVKTQT 774

Query: 887  LNNKLEESEARIQAFNALNYSESVESQTETLRQELEKTRIKLADAYSQVEQYKSMADSSE 946
            L+  L+E+ ++ +   A    + V   T  L  EL  +R +L D   ++E          
Sbjct: 775  LDILLQEANSKNKLLEARETVDDVNKLTGALETELATSRTRLTDTSRELEI--------- 825

Query: 947  ESATAIKDALEQSKAEYTEKIETLTKERDMFKDQVPILKDQISNLNNELNHQKSQFESQI 1006
             S+  I+        +Y  +I+ L + +   +++   L+D+I+ L +EL H   +FE + 
Sbjct: 826  -SSNTIR--------QYQSEIKVLNERQSELENENKHLRDEIAILRDELTHNGGEFEREK 876

Query: 1007 SDYTRNLEDLKAKQSELDNMKAEYEQKISKIQEDLNQQTSYANTAQKNYEQELQKHADVS 1066
                + L +L+ +Q+EL  ++ +Y  +I K++ DL++Q       +  +++E++      
Sbjct: 877  EALMKKLSNLEIRQAELTKLEEDYTAEIEKLKLDLDKQAMLGKEIKLAHDEEVR------ 930

Query: 1067 KKISLLRAEAQKYKSETETLRNAAE----NAKKALEQSELSWEKQSSDYEDELRLAHQRI 1122
                    E Q     TET RN  E       K   + E   E +     +++ L  +R+
Sbjct: 931  --------EVQNRN--TETYRNELELVEIRQTKVFVEKEKELESRIKILNEQIELDKERM 980

Query: 1123 EDLNAQSKILYDQIDFLSKGKPTSSEDLMPISTETRNLLTSLRREKDILETKLEVSTREE 1182
            +  + +  +L +Q+  L+  K +   D   +S E  +L+  L  EK  LE+KL  S  E+
Sbjct: 981  KQFSDEESLLREQVKLLADEKASDLVD-AGVSPEYTDLVRKLSDEKKNLESKLFASQSEK 1039

Query: 1183 KVLRQKLKLIESDLE--GSRIELSKLQRAASGNSATLKDQEEIMTQLNQLNLLRESNITL 1240
              LR++L   ES++       E +K + AA  N+ + + +E I     QL  L+ESN++L
Sbjct: 1040 NRLREQLTKTESEIAVLNMNYEQAKKEVAAEVNNESGRAEEHIA----QLESLKESNMSL 1095

Query: 1241 RNEAQKNGERSRELKAELDALYGKVQPLESKVTLLQNSVREKDLQISLKNEEAERWKQRS 1300
             NE +    R+ E+ AEL+ L  K + +ES++   +N +  KD+++     E  R K  S
Sbjct: 1096 TNEVKLAQMRNGEIIAELNELKTKFKSVESQLDEARNVLSSKDMKLMELQTECSRLKATS 1155

Query: 1301 QDILHKYERIDPEE-HQKLADKVSELQQEIKSKSDENEELDTRFKRLKQQAHEKLNAAKT 1359
             D+     +    E    L   V+ L +++ +    N EL+ RF RLK+QA E+L+A+K 
Sbjct: 1156 HDMPQNGNKDSSSELVGALQSSVATLTEQVDNLKHANTELEDRFGRLKRQARERLDASKV 1215

Query: 1360 AQSTLTSQLNDLKATKEKLENDLGSQKEEVKNLESKITD-IEKNKSSEKNDLQEQLENSQ 1418
              ++L   +  L   K  L++ +   K+E+  L +KI + IE   S+   +L+ +L    
Sbjct: 1216 TINSLRDNVETLTKDKTALQDVIERSKDELNELRAKIQEHIE--TSAVMKELKTELAAVM 1273

Query: 1419 AKLLETENKLEQVTSSSALLEKELNERIESLMNKIKLLEEDLEKAKTESPNDGSQSSELV 1478
            +K  + E +L + + SS  L   LNE IESL ++++ L+E    A +  P    + S +V
Sbjct: 1274 SKNKDIEAELNETSKSSNQLTTALNEEIESLKHEVQYLKE----ASSAEPQGNEEMSGVV 1329

Query: 1479 ENTSKIVENLKIEF-----EEEKAKMISDKESELREQ--FEEEKASILEAKEQELREQLA 1531
            E+  K  E+ KI F     E+ +A++  ++    RE    E+EK S++  K +   E  A
Sbjct: 1330 ESMRKAFEDEKIAFMKATSEDSEARLAEERGKLKREMEALEKEKDSLVMEKTRLGEENTA 1389

Query: 1532 TQKL--DPPVNIDEIKKKWEEEYEQKTSQRIRESNEQLKKRIRLPTEEKINKIVEKKRLE 1589
              K   D P +I+ ++K+WE             SN   K+R+ L  +EK ++++  K  E
Sbjct: 1390 LMKARSDVP-DIETLQKQWE------------ASN---KERLVLLYKEKSDQMMRAKMDE 1433

Query: 1590 LEAEFEANVQKKAEEIXXXXXXXXXXXTEVLEKHKQDLENLKQEMQKKF----DEDIAQI 1645
            LE +F+  V+ K +E                      L  LK E+++K     ++ +  +
Sbjct: 1434 LEEQFQNRVRNKEKE----------------------LNALKDEIEEKCKTGHEDTLIAV 1471

Query: 1646 KKRAFEEGKQQASMKSTFLEKKIAKLETQIKAHDSAIPINDNSSATPAESGPTTQDVKQL 1705
            KKRAFEEGKQQA+MK + LE+KIAKLE + KA  S   ++ +  A P    P    V+Q 
Sbjct: 1472 KKRAFEEGKQQATMKMSILERKIAKLEAESKATKSGSDMSVSEDA-PRFVTPNNNKVQQA 1530

Query: 1706 T-PILNNQAAILPGKPLPFNPAHFAFGMPFGQTTSNS-----FQNPF--NSQPP 1751
              P L    +    +    NP  F   +  G   +N+     F   F  NSQPP
Sbjct: 1531 NQPFLATAGSGFSVQSSESNP--FTTPVSRGAAHTNASSQSKFAPTFLLNSQPP 1582

>KAFR0D02220 Chr4 complement(443928..448952) [5025 bp, 1674 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1674

 Score =  385 bits (990), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 434/1617 (26%), Positives = 790/1617 (48%), Gaps = 162/1617 (10%)

Query: 172  QVLELENEVQTFKSNDLRGKAEMQRLTQEMNLLKSNNQWLEKELASKSEEFGSYRQRVNS 231
            ++L L+ E++  KS  L  ++E +R  ++  L++ +NQWLE+ L   +EE  + +Q +  
Sbjct: 102  EILTLQRELERAKSEHLISQSEAERSLKQSELVREHNQWLEEHLVKTTEELMTQKQSI-L 160

Query: 232  ELQTALSELNXXXXXXXXXXXXXQTLKSRANDLSQQLQDKMTELKSLRDSSSIEKQEFTR 291
            +++    E++               L  +  +LS+ +Q+K+ E+K   D  S ++QEF  
Sbjct: 161  KMEEKDQEIDNLRHEVSILKKNNDLLLGKNQELSENVQEKLIEIKQKSDDYSTKQQEFLH 220

Query: 292  EMTLKQRLIDLLEKQIESFKTELESARNKSVSNSDHVD-AERXXXXXXXXXXXXXXXXXX 350
            E+ LK R+   LE Q++  + E      KS+ N D+   AE                   
Sbjct: 221  EIGLKDRINSSLETQLKEIQQE------KSIQNEDNTSRAESQKIMEQLIDTRKQLKDSR 274

Query: 351  XXAVKLEETVDELLSTDGERGAGNTSKVSLDSKNSIVPKLHGDIGLLKKRLIQERRQKEQ 410
                +L+  V+E +                   N +  +      LLKK L++ + QK+ 
Sbjct: 275  NECTRLKSYVNEFI-------------------NDVNGEYSSSSSLLKKELLKVKEQKDY 315

Query: 411  LQYQVEAFVLELEHKVPVLNSFKERTEMLEKELSDVALMLEATSKDKEEKEHELTSVKSK 470
            L+ QVE F+ ELE KVPV++S +++ + LEKELSDV  +++  S ++E  E E  S K K
Sbjct: 316  LETQVENFITELEIKVPVIDSLEKKNKDLEKELSDVTSLVDRISIERESLEKEFQSFKRK 375

Query: 471  IADYETQIHSLVRQRSDLAHQVQHLLIQVSVRNDSNGPLTPEETNFIKKIINSSESPVEQ 530
                +  I +L  QRSDLAHQ+Q LL+ +  +  +N  L+ +ET+FI+++  +       
Sbjct: 376  SEHNDGMIQTLTTQRSDLAHQIQFLLLILGEQATTNALLSKDETDFIRRLTENDTYARNN 435

Query: 531  DAQRIISERLVRFESMVELQEKNMELLNSIRNLADKLXXXXXXXXXXXXXXXXXXXXXXX 590
            D+Q IISERL++F  + ELQ++NM++L ++R+LA +L                       
Sbjct: 436  DSQSIISERLLKFADITELQKQNMDILATVRHLAGQLEEQEKLRQADHHTIERKTLEEAK 495

Query: 591  XXILTLQEYNKSLESQLEIIAKERDAFKILASDKG-TSNGPSNVNSSENRHLVLAEEKIK 649
              +L LQEY  SLE +LE   KERD +K+L+  K  +SN PS  N        + +    
Sbjct: 496  KALLDLQEYTNSLERKLETFRKERDVYKLLSKGKSPSSNKPSECND-------IDKHTTG 548

Query: 650  ELENHLSSLTEESAKNIKLLNEEIHSLYRAQADTSVNLEKERSSRILAEDRSKLISNTLE 709
            +L+N L    E   K I+ L      +   + +   +++K  S++  AE +++LI N L 
Sbjct: 549  KLQNELQQTREYLTKEIEKLTRTNKDILNKKKELEYSMKKMESAKEYAEGKAELIENNLL 608

Query: 710  MTKMENDELRKRFHSLQENILKQDSKTQQTIESLISCKXXXXXXXXXXXXXXXERDLLRS 769
            M +     + ++   LQ+ + ++++K  +  + L                   + + LR+
Sbjct: 609  MLQENRKSVLEQNDHLQQLLSQKEAKLAELTQDLHELTSQYNLLQIRFTDTQSQSNSLRT 668

Query: 770  IQENLKKENESLSEERNNMRILITQLQTLQTERESLLEETQKNFQGKTNKLETEL----S 825
              +  +KE   + EE+N +++ I +L+  + E + +    Q   + K N+  TE      
Sbjct: 669  QHQTTQKELFEVVEEKNALKVKIHELEISRNECKGI----QATVELKLNERLTEYQLHEQ 724

Query: 826  DTLEKLDAKSKEISDYISTKDSQEKWYQEKFDRLNEELNNSREKLSSKLTDIQHLELKVE 885
            D L+ ++ +  +I D    +  +  WYQ+ F         +  ++   +   +  E   +
Sbjct: 725  DLLKIIEKQEDQIRDMEVKRAEELNWYQKNFP------TQTETEIGLPVDMKKEGETGRQ 778

Query: 886  SLNNKLEESEARIQAFNALNYSESVESQT-----ETLRQELEKTRIKLADAYSQVEQYKS 940
            S  + LE  ++    F  L    SV   T     +  R E E    K  DA         
Sbjct: 779  SNRDTLESQKSGSPGFTDLGTDSSVRKSTSLPVMQVGRTEEESKEAKKCDA--------- 829

Query: 941  MADSSEESATAIKDALEQSKAEYTEKIETLTKERDMFKDQVPILKDQISNLNNELNHQKS 1000
            + DSS+     + + + + + +   +IE L  ++   K  +  ++ +  +L+++L  +K+
Sbjct: 830  LTDSSQ--VVGLPENVTKKEKDLIAQIEQLASDKKELKTSLQAIRAEYQHLHDQLQLEKN 887

Query: 1001 QFESQISDYTRNLEDLKAKQSELDNMKAEYEQKISKIQEDLNQQTSYANTAQKNYEQELQ 1060
             F+++ +     L+ +    S  +  K   E  +  ++  L              E+E Q
Sbjct: 888  SFDTEKASLNNELDKIMENNSLTEVAKKSLEDDLHDVEMKL--------------EEERQ 933

Query: 1061 KHADVSKKISLLRAEAQKYKSETETLRNAAENAKKALEQSELSWEKQSSDYEDELRLAHQ 1120
            KH + +  +S      +K   E    R   E +K A  Q ++   + + + ED L LA++
Sbjct: 934  KHEETNATLSEKELLCEKMIEEISGYR--EELSKSAEMQVDI---QHTRELEDLLDLANK 988

Query: 1121 RIEDLNAQSKILYDQIDFLSKGKPTSSEDLMPISTETRNLLTSLRREKDILETKLEVSTR 1180
            RI+DL  Q+ +L++Q++     + T ++D      + ++++  ++RE+D L+ KL +  R
Sbjct: 989  RIDDLCTQNNLLHEQLNATLDLEDTQNKD------DIKDIIVCMKRERDTLQKKLAIVER 1042

Query: 1181 EEKVLRQKLKLIESDLEGSRIELSKLQRAAS-GNSATLKDQEEIMTQLNQLNLLRESNIT 1239
            E +VLR++   ++S+L+     +SK Q+  +   S  L   E+I+ +L +++LLRE+N++
Sbjct: 1043 EGEVLRERCAGLKSELDA----VSKGQQWHNLPLSNLLTGHEKILDELKEVHLLRENNVS 1098

Query: 1240 LRNEAQKNGERSRELKAELDALYGKVQPLESKVTLLQNSVREKDLQISLKNEEAERWKQR 1299
            L  E  +    +  L  EL  +     PL+ +    +   +EKD +ISL  +E ERWK+R
Sbjct: 1099 LLTEVNQLKHDNCILNDELSQVRKLSGPLQDQKNNTERYFKEKDQEISLYKDEIERWKKR 1158

Query: 1300 SQDILHKYERIDPEEHQKLADKVSELQQEIKSKSDENEELDTRFKRLKQQAHEKLNAAKT 1359
             Q ++H+ +     E     +++  L+  I+ ++ E E+L  +F+ LK+QAHEKL+A K 
Sbjct: 1159 WQQMVHRQDDTLGLE-ANFKNEIDSLKGLIEERTKEKEKLSEKFQLLKKQAHEKLDANKI 1217

Query: 1360 AQSTLTSQLNDLKATKEKLENDLGSQKEEVKNLESKITDIEKN--KSSEKNDLQEQLENS 1417
               TL + L+++KA+  +LE       E +K  + KI +IE    ++ EK D  E+L  S
Sbjct: 1218 HIQTLNNDLSEIKASNLQLE-------EVMKEKDKKIREIELTLKENLEKFDKDEKLV-S 1269

Query: 1418 QAKLLETENKLEQVTSSSALLEKELNERIESLMNKIKLLEEDLEKAKTESPNDGSQSSEL 1477
            +    E E KL +  +    L + LN+ + SL  +I +L +  ++               
Sbjct: 1270 EKTFKENEAKLNKTITMLQKLNETLNQEVVSLREEINVLRKKDDE--------------- 1314

Query: 1478 VENTSKIVENLKIEFEEEKAKMISDKESELREQFEEEKASILEAKEQELREQLATQKLDP 1537
               T++++  +K++FE EK ++I +K  EL E+FE  +  +L  + + +         + 
Sbjct: 1315 ---TNQLISTMKLDFEREKDRLIEEKVRELNEKFESGRNEVLSKQSENVTND------NT 1365

Query: 1538 PVNIDEIKKKWEEEYEQKTSQRIRESNEQLKKRIRLPTEEKINKIVEKKRLELEAEFEAN 1597
              N+D++K++  +++E++T QRI E+ E LK+ IRLP+EEKI +I+EK+R ELE++F+  
Sbjct: 1366 GSNVDKLKQELRKDWEEQTLQRIEEAKENLKRHIRLPSEEKIQRIIEKRRAELESDFDKR 1425

Query: 1598 VQKKAEEIXXXXXXXXXXXTEVLEKHKQDLEN-LKQEMQKKFDEDIAQIKKRAFEEGKQQ 1656
            V++KA  I            E+ +K +++LE+ ++Q++Q K +     I+ +AFEEGK+Q
Sbjct: 1426 VEEKANLIALADKADMSPD-ELKQKVRRELEHAIEQDLQAKLE----TIRTKAFEEGKRQ 1480

Query: 1657 ASMKSTFLEKKIAKLETQIKAHDSAIPINDNSSATPAE---SGPTTQDVKQLTPILNNQA 1713
            A MK+T LE+K++KLE+Q+          DN S +      SG T  DV       +N  
Sbjct: 1481 AEMKTTLLERKLSKLESQVAK--------DNESGSKVRKSISGLTKIDVNSPQLYKDNTG 1532

Query: 1714 ----AILPGKPLPFNPAHFAFGMPFGQTTSNSFQNPFNSQPPEQTPNSPKRPSEEPV 1766
                A+L  +P           +  G+  SN   NPF S  P Q  +    P+  P+
Sbjct: 1533 TRTEAVLKLRP--------TAKVDSGKDVSND-SNPFTS--PTQELSKSNSPAALPI 1578

>KNAG0L02140 Chr12 (381286..386112) [4827 bp, 1608 aa] {ON} Anc_5.702
            YIL149C
          Length = 1608

 Score =  333 bits (853), Expect = 5e-92,   Method: Compositional matrix adjust.
 Identities = 479/1741 (27%), Positives = 795/1741 (45%), Gaps = 307/1741 (17%)

Query: 118  NLLKSQLTELKQQNEIFRSSKQDVVQLLNEKIGDLEASQDEAKQLLQNTKTLRKQVLEL- 176
            N L+ +L + +  N + R   + + + L EK G L+  Q          ++ R+QV+EL 
Sbjct: 41   NELREKLRQAEDSNRLLRERNELLSRSLEEKTGILDTVQSSVSTANAELRSAREQVVELR 100

Query: 177  ----ENEVQTFKSNDLRGKAEMQRLTQEMNLLKSNNQWLEKELASKSEEFGSYRQRVNSE 232
                E+E Q F+S   R +   Q    E  +  +N + LE     K  +F    QR + +
Sbjct: 101  QRLGESETQRFQSELQRDRLSEQLKQGERYINATNGRLLES--TKKLLDF----QRDDRQ 154

Query: 233  LQTALSELNXXXXXXXXXXXXXQTLKSRANDLSQQLQDKMTELKSLRDSSSIEKQEFTRE 292
            +     +L+               L      ++++L DK    K+L D  S ++ +F RE
Sbjct: 155  VGVIRGKLDQSLSEIKALRDSNSALLDSLERINRELTDKAALNKTLSDQLSSQRHDFERE 214

Query: 293  MTLKQRLIDLLEKQIESFKTELESARNKSVSNSDHVDAERXXXXXXXXXXXXXXXXXXXX 352
            +  + +L  +L+KQ+ S  +EL +              E                     
Sbjct: 215  LATRDKLNAVLKKQVNSLHSELGNG------------GETPAHAEPNDQFAKQSSQHEEE 262

Query: 353  AVKLEETVDELLSTDGERGAGNTSKVSLDSKNSIVPKLHGDIGLLKKRLIQERRQKEQLQ 412
                +E V+ELL   G  G G  S                 I  L+K L++ER++   L+
Sbjct: 263  ISNYKEQVEELL---GILGQGAPS-----------------IAHLRKLLLKERKENVSLK 302

Query: 413  YQVEAFVLELEHKVPVLNSFKERTEMLEKELSDVALMLEATSKDKEEKEHELTSVKSKIA 472
             Q+E+FV+ELEH++P L   +++ + ++++L      +   SK K   + EL+S + K+ 
Sbjct: 303  KQMESFVIELEHRLPGLQILEKQNKEVQQKLHAATNKMIEESKAKIRTQRELSSSRQKV- 361

Query: 473  DYETQI-HSLVRQRSDLAHQVQHLLIQVSVRNDSNGPLTPEETNFIKKIINSSESPVEQD 531
            D+  QI H L  QRSDLAHQ+Q LL      N S+  L P E +FIK II +      +D
Sbjct: 362  DHLNQIFHKLRVQRSDLAHQIQFLL----TVNSSDTVLPPSELSFIKTIIENENWDAYKD 417

Query: 532  AQRIISERLVRFESMVELQEKNMELLNSIRNLADKLXXXXXXXXXXXXXXXXXXXXXXXX 591
            +QRI+S+RL+RF+++ ELQE+NM+L++++R+L DK+                        
Sbjct: 418  SQRIVSDRLLRFDNIPELQEQNMKLVSTVRSLVDKV------ESWEADNDSGLTLEAAKL 471

Query: 592  XILTLQEYNKSLESQLEIIAKERDAFKILASDKGTSNGPSNVNSSENRHLVLAEEKIKEL 651
             I  L++ N  LES++    K  +A      D  + +   NV       +V  ++KI+EL
Sbjct: 472  QISKLEQSNAQLESEV----KNWEALMETLKDGDSLDSKINVT------MVEQQKKIEEL 521

Query: 652  ENHLSSLTEESAKNIKLLNEEIHSLYRAQADTSVNLEKERSSRILAED---RSKLISNTL 708
            E+ L+ + E   + I +LN+ I    R Q  +++N+  E+    +  D   +S+LI+   
Sbjct: 522  ESKLTDVGESHVQKINVLNKTID---RNQ--STINMLNEQIKNTVKSDMNAKSELIA--- 573

Query: 709  EMTKMENDELRKRFHSLQENILKQDSKTQQTIESLISCKXXXXXXXXXXXXXXXERDLLR 768
               K EN  L ++  + Q  + + +SK+ Q                        ERD   
Sbjct: 574  --CKRENLSLTQQISTKQNELDELNSKSAQ-----------------------KERDYQL 608

Query: 769  SIQENLKKENESLSEERNNMRILITQLQTLQTERESLLEETQKNFQGKTNKLETELSDTL 828
             I E     N+  S E N+  +L        TE ++ +E+ Q++     +K++ E S  L
Sbjct: 609  KIAELSVAANKCKSWE-NSFHLL--------TEEKTQMEQKQRSL---FDKIQQE-SKKL 655

Query: 829  EKLDAKSKEISDYISTKDSQEKWYQEKFDRLNEELNNSREKLSSKLTDIQH--------L 880
             +L+ ++KE+   IS K+   K               S E LSSK+T +          L
Sbjct: 656  LQLETRNKELEVKISGKELHRK--------------RSEETLSSKITFLSEENKSLHNDL 701

Query: 881  ELKVESLNNKLEESEARIQAF--NALNYSESVESQTETLRQELEKTRI------------ 926
              K E +   +E+SE +I+ +  N    SE  ++++  + +  +K R+            
Sbjct: 702  AFKEEEVKQFIEKSEKQIKWYQQNIDELSEQNKNKSNKIIELNDKLRLLSEKSLSNKPYP 761

Query: 927  ---KLADAYSQVEQYKSMADSSEESATAIKDALEQSKAEYT--------------EKIET 969
               +L +  +++   K+  + SE  AT  KD LE+++  Y                K E 
Sbjct: 762  VGTELKELQNELNGMKAALEVSESQATLYKDTLERNQNFYNNSTLSFQNTISELQSKNEA 821

Query: 970  LTKERDMFKDQVPILKDQISNLNNELNHQK--SQFESQISDYTRNLEDLKAKQSELDNMK 1027
            L+K+ +  ++Q+   ++Q   +  +L HQ    +  S+ +     L  L   + ++  MK
Sbjct: 822  LSKQHETLQNQITETENQSKGI--QLEHQTIIDRLTSEKTALEEKLNSLSHSEEKIAEMK 879

Query: 1028 AEYEQKISKIQEDLNQQTSY---ANTAQKNYEQELQKHADVSKKISLLRAEAQKYKSETE 1084
             EY+ +I KI+ +L  Q+       +A  + E+EL  +A    +I  L  E  K  S+  
Sbjct: 880  GEYDAQIQKIESNLKIQSDTRLNFESALTSKEKELTSYA---VQIEQLNTEIAKLNSDIA 936

Query: 1085 TLRNAAENAKKALEQSELSWEKQSSDYEDELRLAHQRIEDLNAQSKILYDQIDFLSKGKP 1144
             L   AE A+K L        K+      EL+LA+QRIE L AQ+ ILYD       G  
Sbjct: 937  ALTEPAE-ARKTL-------IKERDSLGQELKLANQRIESLAAQNSILYDTFS----GMR 984

Query: 1145 TSSEDLMPISTETRNLLTSLRREKDILETKLEVSTREEKVLRQKLKLIESDLEGSRIELS 1204
                D  P + + RNL+ +LR E+D+ +++   + R+ K+L++ LK I   L  +  E+ 
Sbjct: 985  HVDADAEP-NEDLRNLVINLRIERDMHQSQETTAQRDVKLLKKNLKEITEKLAITCPEID 1043

Query: 1205 KLQRAASGNSATLKDQEEIMTQLNQLNLLRESNITLRNEAQKNGERSRELKAELDALYGK 1264
            +       + +     E+IM +L  L   +E N+ L    +   E  R L+ E+  L   
Sbjct: 1044 EPTNTEKDDFSLTVTHEKIMRELEGLTNTKEENLYLDESIKSLNEDKRTLQEEVSRLR-- 1101

Query: 1265 VQPLESKVTLLQNS--VREKDLQ--ISLKNEEAERWKQRSQDILHKYERIDPEEHQKLAD 1320
                ES+    +NS  + E++ Q  I    +E+E+WK   Q +          E Q L  
Sbjct: 1102 ----ESEELAKKNSSAISEQEWQQKIETYQQESEKWKLMCQQMSENT----ATEIQNLQQ 1153

Query: 1321 KVSELQQEIKSKSDENEELDTRFKRLKQQAHEKLNAAKTAQSTLTSQLNDLKATKEKLEN 1380
            ++   + +I+ K+ EN++L+ RF RLK+QAHEKLNA+K    +L  +L++LK   + L+ 
Sbjct: 1154 QLETFKADIQLKTQENDDLNDRFTRLKKQAHEKLNASKATSDSLAIELSELKTVNDALQ- 1212

Query: 1381 DLGSQKEEVKNLESKITDIEKNKSSEKNDLQEQLENSQAKLLETENKLEQVTSSSALLEK 1440
                  E++ N E+   D E N +     LQ + EN QAK LE E  L     SS  L  
Sbjct: 1213 ------EKLNNQETNSVDSESNAAL---ILQLKEENKQAKSLELE--LRHSVDSSEKLIA 1261

Query: 1441 ELNERIESLMNKIKLLEEDLEKAKTESPNDGSQSSELVENTSKIVENLKIEFEEEKAKMI 1500
            ++ + + +L                E+P  GS +   VE+ +  +E LK EFE+EK  +I
Sbjct: 1262 DMTKELTTL---------------KENPIQGSVN---VEDYTHRLEQLKSEFEDEKRVLI 1303

Query: 1501 SDKESELREQFEEEKASILEAKEQELREQLATQKLDPPVNIDEIKKKWEEEYEQKTSQRI 1560
                SEL E+FE EK  +                ++   N++E++K  EEE+E+KT QRI
Sbjct: 1304 EKTTSELTERFEREKKEL----------------MNNNANLEELRKPLEEEWERKTLQRI 1347

Query: 1561 RESNEQLKKRIRLPTEEKINKIVEKKRLELEAEFEANVQKKAEEIXXXXXXXXXXXTEVL 1620
             E+ E LKK IRLPTEEKI +++ K++ +LE +F+  V ++A  +           +E+ 
Sbjct: 1348 EEAKENLKKHIRLPTEEKIERVIAKRKAQLEEQFQTKVAEQANLL---------KLSELS 1398

Query: 1621 EKHKQDLEN-LKQEMQKKFDEDIAQIKKRAFEEGKQQASMKSTFLEKKIAKLETQIKAHD 1679
             K   +LE  +++E++ + +ED   +KK+AFEEG+QQASMK+T LE+KIAKLE +++   
Sbjct: 1399 NKTADELEKEVREEIKTRLEEDFELLKKKAFEEGRQQASMKTTLLERKIAKLEARLQGGT 1458

Query: 1680 SAI-------PINDNSS---ATP------------AESGPTTQDVKQLTPILNNQAA--- 1714
              +        IN +S    A P            A +G TT  + Q T      +A   
Sbjct: 1459 GPLKSANGLNKINIDSPLMVAGPLTNEPVLDEKPNAFAGATTTTISQPTSTTAKDSANAF 1518

Query: 1715 ILPGKPLPFNPAH-------FAFGM-------------PFGQTTSNSFQNPFNSQPPEQT 1754
                + +P  PA        F+FG                G  +   F+  F S PP  T
Sbjct: 1519 SFNAQKVPAQPAFSSRAQPAFSFGSFNKTSFSDLSHKNSVGAASGTPFRFGFASNPP--T 1576

Query: 1755 P 1755
            P
Sbjct: 1577 P 1577

>KAFR0H00210 Chr8 complement(27128..31492) [4365 bp, 1454 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1454

 Score =  255 bits (652), Expect = 6e-68,   Method: Compositional matrix adjust.
 Identities = 276/1099 (25%), Positives = 537/1099 (48%), Gaps = 34/1099 (3%)

Query: 137  SKQDVVQLLNEKIGDLEASQDEAKQLLQNTKTLRKQVLELENEVQTFKSNDLRGKAEMQR 196
            +K ++++LL E+I  ++  + +  ++++  K L +   +L  E++T K   L  + ++ +
Sbjct: 73   TKNELLKLLEERINQIDTLKADLNKVVEENKNLYENSHKLTKEIETSKDEKLLLRTQLDK 132

Query: 197  LTQEMNLLKSNNQWLEKELASKSEEFGSYRQRVNSELQTALSELNXXXXXXXXXXXXXQT 256
            +T  ++L     Q  E E  SK + F SY+ R   E Q  +  L                
Sbjct: 133  VTFTLSLTMKQKQHTESEYLSKEKHFESYKDRKELEYQNVMENLTAIDNELRMTNGKNAE 192

Query: 257  LKSRANDLSQQLQDKMTELKSLRDSSSIEKQEFTREMTLKQRLIDLLEKQIESFKTELES 316
            L  R  +LS+ L+ K++E+KSL +S      +F  E  L+ +LI+ L+ QI++ + +LES
Sbjct: 193  LFKRNEELSKDLRGKISEIKSLENSLKTSNGDFLSEKQLQDQLINALQNQIKTLQEQLES 252

Query: 317  ARNKSVSNSDHVDAERXXXXXXXXXXXXXXXXXXXXAVKLEETVDELLSTDGERGAGNTS 376
              ++   +      ++                     + L  +++E  +   E  +  +S
Sbjct: 253  LSDEKFDDPGTQKLDKHELLRQIKNLNEKLEISERERLSLVHSMEEFQNIPEEESSSVSS 312

Query: 377  KVSLDSKNSIVPKLHGDIGLLKKRLIQERRQKEQLQYQVEAFVLELEHKVPVLNSFKERT 436
              S   +N+    L GD+ +L+K  ++ER+QK QL+ Q+   + ELE  +P L+S+KER+
Sbjct: 313  HAS--GRNNSALSLSGDVNILRKHFLKERQQKRQLEEQMRQILQELERNMPSLSSYKERS 370

Query: 437  EMLEKELSDVALMLEATSKDKEEKEHELTSVKSKIADYETQIHSLVRQRSDLAHQVQHLL 496
              LEKEL+   ++LE   K+  +K  EL   +S+ ++  + I+SL  QR+ LA QV++LL
Sbjct: 371  TFLEKELNSSNILLEHIKKENLDKSAELEKKESECSNLRSSINSLAFQRTVLARQVKYLL 430

Query: 497  IQVSVRNDSNGPLTPEETNFIKKIINSSESPVEQDAQRIISERLVRFESMVELQEKNMEL 556
            + +         L  ++   + + + ++ +    D+++I+ ERL +F+++ ELQ +NM+L
Sbjct: 431  LIIQNNETLGSSLGRKDLELLGQYLAANTAEAMSDSEKILLERLAQFKNVKELQNRNMQL 490

Query: 557  LNSIRNLADKLXXXXXXXXXXXXXXXXXXXXXXXXXILTLQEYNKSLESQLEIIAKERDA 616
            L   R LA K                          IL LQEY++ LESQ++ ++ E   
Sbjct: 491  LQVSRELASKAEKLEKVNLKQISSEEDETINDAKEAILVLQEYSQKLESQIKELSDELAV 550

Query: 617  FKILASDKGTSNGPSNVNSSENRHLVLAEEKIKELENHLSSLTEESAKNIKLLNEEIHSL 676
             K   ++K + +  S +    + H +       +L   LS+  + S   I  LN EI +L
Sbjct: 551  QKKEKTEKESISAMSKIEDDASSHTI-------DLGKQLSANLKHSKDIIDALNSEIENL 603

Query: 677  YRAQADTSVNLEKERSSRILAEDRSKLISNTLEMTKMENDELRKRFHSLQENILKQDSKT 736
            ++A  D +++L+KE+S+R LAEDR  L+   + + K E +EL++  + LQ+NIL ++ + 
Sbjct: 604  HQANTDVNISLDKEKSARKLAEDRYNLLEYNVSLLKSEKEELQEEVNKLQQNILDKEKQF 663

Query: 737  QQTIESLISCKXXXXXXXXXXXXXXXERDLLRSIQENLKKENESLSEERNNMRILITQLQ 796
              +    ISCK               E +L    Q  L+ + E+L  ERNN+R+ +TQ+ 
Sbjct: 664  SYSSRDYISCKSKLSTAEAEITSLRAENELSIETQTTLRTKKEALLNERNNLRMTVTQMN 723

Query: 797  TLQTERESLLEETQKNFQGKTNKLETELSDTLEKLDAKSKEISDYISTKDSQEKWYQEKF 856
            +L  E ++LL+ET+  +  K      + + T  +L    + +S+  S  DS+ KWY+   
Sbjct: 724  SLNNELQTLLKETKSGYDDKLKISALKCTQTNNQLQLVQQRMSELKSQNDSEIKWYKATI 783

Query: 857  DRLNEELNNSREKLSSKLTDIQHLELKVESLNNKLEESEARIQAFNALNYSESVESQTET 916
            D L   +    E+L  K   I+     +E++ N+L            L  S+ V  +   
Sbjct: 784  DDLKANVFELNEELKQKEEKIEEFSKTLENVQNEL-----------TLANSKDVSEEKRA 832

Query: 917  LRQELEKTRIKLADAYSQVEQYKSMADSSEESATAIKDALEQSKAEYTEKIETLTKERDM 976
            L +EL + + +L  +  +V++Y+++  +S       K + E    +Y ++I+ L  + D 
Sbjct: 833  LEKELSEVKSQLEKSNLEVKEYENVISTS-------KRSFENKSIQYEDRIKALASKLDS 885

Query: 977  FKDQVPILKDQISNLNNELNHQKSQFESQISDYTRNLEDLKAKQSELDNMKAEYEQKISK 1036
               +   L++ +S L   +  Q+ +  S        L +L+     L   +  ++ K ++
Sbjct: 886  ELRERTTLQENLSTLQARMVVQQDELTSN----NNTLSELRVSYDSLLLEQKTFKDKEAE 941

Query: 1037 IQEDLNQQTSYANTAQKNYEQELQKHADVSKKISLLRAEAQKYKSETETLRNAAENAKKA 1096
            ++  +  +T   ++  K+YE+ +Q+++++SK + LLR E +   S  E      E+ +  
Sbjct: 942  LRSVIAVKTGNYDSLSKSYERIMQENSELSKVVELLREEVKNRTSNGEK-EGDLEDTESI 1000

Query: 1097 LEQSELSWEKQSSDYEDELRLAHQRIEDLNAQSKILYDQIDFLSKGKPTSSEDLMPISTE 1156
            +++ +  W+++   +E ++   ++R+ +L  +++ L  +++   KG  + S +      E
Sbjct: 1001 IKKGQDVWDEEKKVFEVQITNLNERLSELLEENESLLARLESQDKGNNSPSAETNAAGNE 1060

Query: 1157 TRNLLTSLRREKDILETKLEVSTREEKVLRQKLKLIESDLEGSRIELSKLQRAASGNSAT 1216
                L +LR E+  L  KL  + +EE+ +R KL+  E  L  +  EL K++      S+ 
Sbjct: 1061 --ETLAALRSERTSLIEKLTAAQKEERSVRHKLRETEHALSENAFELKKIKSQIFELSSL 1118

Query: 1217 LKDQEEIMTQLNQLNLLRE 1235
             +++ +I+  L  L   RE
Sbjct: 1119 PQNEHDILRHLVHLKEQRE 1137

 Score =  102 bits (254), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 63/169 (37%), Positives = 110/169 (65%), Gaps = 17/169 (10%)

Query: 1506 ELREQFEEEKASILEAKEQELREQLATQKLDPPVNIDEIKKKWEEEYEQKTSQRIRESNE 1565
            E+++ FE+EK+S+L  +EQE+ +            + + ++K  E YE++  +++ ++ E
Sbjct: 1190 EMKDNFEKEKSSLLSQQEQEIEK------------LTDNERKLREFYEEEIQKKVSQAEE 1237

Query: 1566 QLKKRIRLPTEEKINKIVEKKRLELEAEFEANVQKKAEEIXXXXXXXXXXXTEVLEKHKQ 1625
             LKKRIRLPTEEKIN I+EK++ ELE+ FE  ++++A+ +            ++ + +K+
Sbjct: 1238 NLKKRIRLPTEEKINGIIEKRKSELESSFEQKIKEEAKSLLLHSDDD-----KIKKIYKE 1292

Query: 1626 DLENLKQEMQKKFDEDIAQIKKRAFEEGKQQASMKSTFLEKKIAKLETQ 1674
              E+ ++ +Q++FDE +  ++K+AFEEGKQ   MKS FLE+KI+ LE Q
Sbjct: 1293 IEESGRETLQQEFDEQLNIVRKKAFEEGKQHVLMKSAFLERKISMLEGQ 1341

>NDAI0F00290 Chr6 complement(60327..64991) [4665 bp, 1554 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1554

 Score =  203 bits (517), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 202/704 (28%), Positives = 349/704 (49%), Gaps = 71/704 (10%)

Query: 4   QNSPTTPSVIGEIDVTTISSFLELDASKVSTLDPAVVRQLSIKANQFGQLKAQNLKYSVT 63
           +N PT PS+I +I     SSF +L  +   ++D   + ++  KA     L  +N   S  
Sbjct: 6   RNEPT-PSIIDKI-----SSFFDLPGNTWESMDEHALEKIYTKA---YDLMKENSFVSAA 56

Query: 64  LDELKSSSERR-----SEAFKLQLEKINENTESLRXXXXXXXXXXXXLIDEKANASKEVN 118
           +D++K   E +      + F LQLE      + L+            L+ EK       +
Sbjct: 57  IDDIKHVYEGKINTISQKYFNLQLE-----NKKLKEKESGYLVAREKLVSEKQKEFDSND 111

Query: 119 LLKSQLTELKQQNEIFRSSKQDVVQLLNEKIGDLEASQDEAKQLLQNTKTLRKQVLELEN 178
            L S++T +K   E  +     +     +    LE S+ E +  L     L++Q+   E 
Sbjct: 112 ALNSEITLIKYDLEAMQRDHTTLEARERKTENVLEQSKLELQDSLTENSALKEQIGVFEG 171

Query: 179 EVQTFKSNDLRGKAEMQRLTQEMNLLKSNNQWLE---------KELASKSEEFGSYRQRV 229
           ++ +          E ++L   M LL+ NN +LE         K+L S +E+      R+
Sbjct: 172 KLDSMTQELWLANTENKKLQTGMKLLRENNLYLEIKCKETDKNKKLYSSAEDAS----RL 227

Query: 230 NSELQTALSELNXXXXXXXXXXXXXQTLKSRANDLSQQLQDKMTELKSLRDSSSIEKQEF 289
             +LQ   SE+               TLK     LS  LQ K+  +K L D+ +  KQEF
Sbjct: 228 QDQLQIVSSEI-------LSLKSEIATLKYMNESLSTDLQRKLFRIKDLDDNLNSSKQEF 280

Query: 290 TREMTLKQRLIDLLEKQIESFKTELESARNKSVSNSDHVDAERXXXXXXXXXXXXXXXXX 349
            +E+TLKQR+ +LL  +I S+K ++E   +K      +++                    
Sbjct: 281 AKEITLKQRVNELLHNEIASYKKQIERLTSK------NLETPEKKIIQELVDLKEKLVNS 334

Query: 350 XXXAVKLEETVDELLSTDGER---GAGNTSKVSLDSKNSIVPKLHGDIGLLKKRLIQERR 406
                +L+ TVD+ ++ D ++     GN  K+               I +L+++L++E+R
Sbjct: 335 EKECNELKSTVDKYINIDEKKLISKFGNPKKL---------------IEILRRQLVKEKR 379

Query: 407 QKEQLQYQVEAFVLELEHKVPVLNSFKERTEMLEKELSDVALMLEATSKDKEEKEHELTS 466
            K+ LQ QVE+F++ELE K+P+++SFKER   LE+EL  +   LE T+K+++ K+ ELT+
Sbjct: 380 HKDTLQRQVESFLVELEQKLPMIDSFKERNSSLERELLRITSSLEETAKERDIKDRELTN 439

Query: 467 VKSKIADYETQIHSLVRQRSDLAHQVQHLLIQVSVRNDSNGPLTPEETNFIKKIINSSES 526
           ++ KI++ E     L+RQRSDLAHQVQ+LL+ +    D+  P T +E   +KKI+++  +
Sbjct: 440 LQKKISNNEQFNDELLRQRSDLAHQVQYLLLCI----DNKSPFTEKEATLVKKIVSNENT 495

Query: 527 PVEQDAQRIISERLVRFESMVELQEKNMELLNSIRNLADKLXXXXXXXXXXXXXXXXXXX 586
             + D+ +IIS+RL+ F+++ ELQ+KNMELL + R L   L                   
Sbjct: 496 ENDTDSHKIISKRLLHFQNVKELQQKNMELLRTTRQLVQTLERQEQEQQKTLRITDNNKI 555

Query: 587 XXXXXXI-LTLQEYNKSLESQLEIIAKERDAFKILASDKGTSNGPSNVNSSENRHLVLAE 645
                   + L+++ K+LES++ II++ERD++K+L ++    +  SN + S  +   L +
Sbjct: 556 VESAKSTSVDLEKHIKTLESKINIISQERDSYKLLVTNSTIQSNTSNNSISSLQQCELEK 615

Query: 646 EKIKELENHLSSLTEESAKNIKLLNEEIHSLYRAQADTSVNLEK 689
           E+   L N LSS+ ++  K ++ L  +I +L ++Q  + + +EK
Sbjct: 616 ER---LTNELSSMKQQHVKVLEELENKIKTLQKSQLTSKMEVEK 656

 Score =  191 bits (485), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 189/562 (33%), Positives = 297/562 (52%), Gaps = 70/562 (12%)

Query: 1219 DQEEIMTQLNQLNLLRESNITLRNEAQKNGERSRELKAELDALYGKVQPLESKVTLLQNS 1278
            D+EE+M    +L  L ESN  L  E +   + +  L ++L  +  K++PLE ++  L+  
Sbjct: 1058 DKEEVMENTTKLLALEESNAKLIKEVENCTKVNETLSSQLADMQVKLEPLEQEINELKLK 1117

Query: 1279 VREKDLQISLKNEEAERWKQRSQDILHKYERIDPEEHQKLADKVSELQQEIKSKSDENEE 1338
            V EK+  +++  EE ERWK RSQ IL + + ++ E H K  +K+  L++++++   EN +
Sbjct: 1118 VAEKEQHLNICQEELERWKLRSQTILQQGKIVEEEAHMKSLEKIKTLEEQLETVRTENAQ 1177

Query: 1339 LDTRFKRLKQQAHEKLNAAKTAQSTLTSQLNDLKATKEKLENDLGSQKEEVKNLESKITD 1398
            L  RF RLK+QAHEKL+AAKT Q  LT+Q+N+L  TK  LE  L               +
Sbjct: 1178 LTDRFDRLKKQAHEKLDAAKTMQINLTTQINELNETKVNLEKSLQQ-------------E 1224

Query: 1399 IEKNKSSEKNDLQEQLENSQAKLLETENKLEQVTSSSALLEKELNERIESLMNKIKLLEE 1458
            IEKN  S      E  E     ++    +LE+  + S  LEK++ E  +   N+I+ L+ 
Sbjct: 1225 IEKNNQSGNGAADESEE-----IIRLRAELEKSNNFSNELEKKV-EDAKKFKNEIESLKS 1278

Query: 1459 DLEKAKTESPNDGSQSSELVENT---SKIVENLKIEFEEEKAKMISDKESELREQFEEEK 1515
            +L            QS +  EN+   SKI+++LK  F+ EK ++I   + E + + E+EK
Sbjct: 1279 EL------------QSVKAYENSTVNSKIIKDLKESFKREKDELIEQMKKEFKTKLEKEK 1326

Query: 1516 ASILEAKEQELREQLATQKLDPPVNIDEIKKKWEEEYEQKTSQRIRESNEQLKKRIRLPT 1575
             +IL  ++  +   LA  +     NI+E+KKKWEEE E    +RI E+ E LKKR+RLP+
Sbjct: 1327 ETILAQRKNNI---LANGQ--ESANIEELKKKWEEEQEALILKRITEAEENLKKRMRLPS 1381

Query: 1576 EEKINKIVEKKRLELEAEFEANVQKKAEEIXXXXXXXXXXXTEVLEKHKQDLENLKQEMQ 1635
            EEKIN ++EK+R  LE EFE  +++                  V+   +  +E   +E++
Sbjct: 1382 EEKINAVIEKRRKVLEQEFETKLRELG---------LNADGNGVVTDTRAQIE---KELR 1429

Query: 1636 KKFDEDIAQIKKRAFEEGKQQASMKSTFLEKKIAKLETQIKAHDSAIPI-NDNSSATPAE 1694
            +KF+ ++A+IKK+AFEEGKQQ+ MKST LE+K++KLE+Q     +  P  N++S+ T   
Sbjct: 1430 EKFNLELAEIKKKAFEEGKQQSMMKSTLLERKLSKLESQ-----TLSPTKNNDSNETQVP 1484

Query: 1695 SGPTTQDVKQLTPILNNQAAILPGKPLPFNPAHFAFGMPFGQTTSNSFQNPFNSQPPEQT 1754
            S     ++   +P            PL        +G      T N   NPF  Q  +  
Sbjct: 1485 SKINLSNINSSSP------------PLGEKVLQLNYGANVVAETDND-DNPFTLQSGKDE 1531

Query: 1755 PNSPKRPSEEPVGGSPEKKPKE 1776
                KR ++  +     K+PKE
Sbjct: 1532 TLLTKRSADNEIIQDIIKRPKE 1553

>Kpol_1043.70 s1043 (147247..151212) [3966 bp, 1321 aa] {ON}
            (147247..151212) [3966 nt, 1322 aa]
          Length = 1321

 Score =  193 bits (491), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 248/836 (29%), Positives = 408/836 (48%), Gaps = 157/836 (18%)

Query: 970  LTKERDMFKDQVPILKDQISNLNNELNHQKSQFESQISDYTRNLEDLKAKQSELDNMKAE 1029
            L +E +  K ++    +QI +L+++  H +   E++IS YT  +++L+   S+L+  K  
Sbjct: 561  LEEENNSLKQEIKSNYEQIKDLDSKSKHLEQSLENEISKYTDKVKELELNISKLNEQKLI 620

Query: 1030 YEQKISKIQ---EDLNQQTSYANTAQKNYEQELQKHADVSKKI-SLLRAEAQKYKSETET 1085
             E+K+       +DLN  ++Y   +   Y+++L ++    K + S L A+ Q  K+  E 
Sbjct: 621  LERKLQNKNIEIDDLNS-SNYDQISW--YQKKLDQYEKTIKTLESRLPADTQNSKALVED 677

Query: 1086 LRNAAENAKKALEQSELSWEKQSSDYEDELRLAHQRIEDLNAQSKILYD-----QIDFLS 1140
                     KALE S  +    SS   +E+ +   RI   + ++K +Y       ++ ++
Sbjct: 678  ---------KALEDSRDASPVSSSASCNEITI---RIFGDSNKTKKIYPIEEEKNLELIT 725

Query: 1141 KGKPTSSEDLMPISTETRNLL---------------TSLRREKDILETKLEVSTREEKVL 1185
            K    +   +  ++T+ R LL                SLR E+D L  ++    ++ +V+
Sbjct: 726  KELEDTKVRVQNLATQNRLLLEKLERSANLEVDDIFVSLRYERDTLSDQVVNYEKDMQVI 785

Query: 1186 RQKLKLIESDLEGSRIELSKL--QRAA-----SGNSATLKDQEEIMTQLNQLNLLRESNI 1238
               L+ ++S+L  +  ++     QRA       GN     ++E ++ +L +L+ L+E N+
Sbjct: 786  LADLESVQSELNAANSQILNFENQRAMVQDHKKGNV----NEETLIEKLTELDELKERNM 841

Query: 1239 TLRNEAQKNGERSRELKAELDALYGKVQPLESKVTLLQNSVREKDLQISLKNEEAERWKQ 1298
             L  E     E +  LK +L+    +++PLE+K++ L   + +KD  I++ NE+AE WK 
Sbjct: 842  ELTQEIHALNENNIALKCQLEESLERLKPLETKISELNILIEDKDNIINVSNEKAENWKT 901

Query: 1299 RSQDILHKYERIDPEEHQKLADKVSELQQEIKSKSDENEELDTRFKRLKQQAHEKLNAAK 1358
            R  ++    +  D E+       +  LQ++++ KS ENEEL  RF RLK+QA+E+L+A+K
Sbjct: 902  RFNELTLSAKNNDNED-------LINLQKQVEEKSKENEELSDRFNRLKKQANERLHASK 954

Query: 1359 TAQSTLTSQLNDLKATKEKLENDLGSQKEEVKNLESKITDIEKNKSSEKNDLQEQLENSQ 1418
             AQ+ LT Q N+LKA    LE +L  Q E  K LE+ I+ ++  +     DL+EQL N+ 
Sbjct: 955  VAQNNLTEQSNELKARNTDLERNLSEQMERFKELENSIS-LKDQELGSIGDLKEQLANAL 1013

Query: 1419 AKLLETENKLEQVTSSSALLEKELNERIESLMNKIKLLEEDLEKAKTESPNDGSQSSELV 1478
             K  + E +L +  S S  L  +L   IESL           EK K++  + G Q SE +
Sbjct: 1014 DKSKKFEEELIKTVSESESLVSDLKNEIESLN----------EKLKSKESSVGLQESE-I 1062

Query: 1479 ENTSKIVENLKIEFEEEKAKMISDKESELREQFEEEKASILEAKEQELREQLATQKLDPP 1538
            EN  KI+                   +EL E+  + K+  L+ K +E  + L T      
Sbjct: 1063 ENAKKILI------------------AELEEKLNKTKSE-LDLKHKEELKVLKT------ 1097

Query: 1539 VNIDEIKKKWEEEYEQKTSQRIRESNEQLKKRIRLPTEEKINKIVEKKRLELEAEFEANV 1598
                        EYE    +R+ E+ E LK++IRLP+EEKIN I+E K  +LE ++    
Sbjct: 1098 ------------EYEGDIQKRVAEAEEALKRKIRLPSEEKINTIIESKVADLEEDY---- 1141

Query: 1599 QKKAEEIXXXXXXXXXXXTEVLEKHKQDLENLKQEMQKKFDEDIAQIKKRAFEEGKQQAS 1658
            +KK E +                    D+E +KQE    F++++   KK+AFEEGKQQAS
Sbjct: 1142 KKKLETVSAEST---------------DIEKIKQE----FEDNLVNAKKKAFEEGKQQAS 1182

Query: 1659 MKSTFLEKKIAKLETQIKAHDSAIPINDNSSATPAESGPTTQDVKQLTPILNNQAAILPG 1718
            MK+ FLE KIAKLE+Q++        N+ S  T  E+   T D ++  P L+ Q A    
Sbjct: 1183 MKTKFLENKIAKLESQLQ--------NNESDVTDKEAEVKTTDNEKSNPELDKQEA---- 1230

Query: 1719 KPLPFNPAHFAFGMPFGQTTSNSFQNPFNSQPPEQTPNS--PKRPSEEPVGGSPEK 1772
            KP       F F  P      NS  NPF +     +P S    +P+   +G +P K
Sbjct: 1231 KP------SFTFSPP-----PNS--NPFTTTQDTDSPVSVFGIKPT-FSLGANPFK 1272

 Score =  187 bits (476), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 223/762 (29%), Positives = 361/762 (47%), Gaps = 93/762 (12%)

Query: 406  RQKEQLQYQVEAFVLELEHKVPVLNSFKERTEMLEKELSDVALMLEATSKDKEEKEHELT 465
            +Q   L+  ++ ++ ELE ++P++ +FK   E L+  L+   L++E+   DK+E    + 
Sbjct: 209  KQNNGLKSDIQNYLNELEQQLPLIENFKAEIENLQDNLNKKNLIIESLQNDKKENLKLMD 268

Query: 466  SVKSKIADYETQIHSLVRQRSDLAHQVQHLLIQVSVRNDSNGPLTPEETNFIKKIINSSE 525
            S+K  I +  + I +L  QR+DLAHQ+Q+LLI  S++ND+NGPL+  E  F++ +IN  +
Sbjct: 269  SMKKTINEKSSSIEALDIQRTDLAHQLQYLLIHSSIQNDNNGPLSKSEILFMQNLINKDK 328

Query: 526  SPVEQDAQRIISERLVRFESMVELQEKNMELLNSIRNLADKLXXXXXXXXXXXXXXXXXX 585
              +  D Q +IS+RL++F+ +V LQEKNMEL  SIRNLA  L                  
Sbjct: 329  QRLSSDVQSVISDRLIKFKDIVSLQEKNMELTKSIRNLAFSLESKESEIKNSRENYDNDT 388

Query: 586  XXXXXXXILTLQEYNKSLESQLEIIAKERDAFKILASDKGTSNGPSNVNSSENRHLVLAE 645
                   IL+LQEYN  L  +LEI   +    ++ +S         N   SE +H     
Sbjct: 389  INEAKETILSLQEYNNVL--KLEIGTLQSKISELQSS-------IPNSKESEKQHFNYHS 439

Query: 646  EKIKELENHLSSLTEESAKNIKLLNEEIHSLYRAQADTSVNLEKERSSRILAEDRSKLIS 705
              +K+LE+ LS L+  S   I+ LN++I +LY  + D  +NLEKE+SS ILA ++  L+ 
Sbjct: 440  NLVKDLESKLSKLSAYSQSTIENLNKDIQNLYNERTDILINLEKEKSSTILANEKLTLLQ 499

Query: 706  NTLEMTKMENDELRKRFHSLQENILKQDSKTQQTIESLISCKXXXXXXXXXXXXXXXERD 765
            N+ ++  +EN+EL  +   L++ + +++      +   I CK                  
Sbjct: 500  NSYDLLTLENEELSSKNSMLEQQLNEEEKNLNSVLNDYIKCKTNLLDFTNRLT------- 552

Query: 766  LLRSIQENLKKENESLSEERNNMRILITQLQTLQTERESLLEETQKNFQGKTNKLETELS 825
            LL + +  L++EN SL +E  +    I  L +     E  LE     +  K  +LE  +S
Sbjct: 553  LLNNNKLGLEEENNSLKQEIKSNYEQIKDLDSKSKHLEQSLENEISKYTDKVKELELNIS 612

Query: 826  DTLE-------KLDAKSKEISDYISTKDSQEKWYQEKFDRLNEELNNSREKLSSKL-TDI 877
               E       KL  K+ EI D  S+   Q  WYQ+K D+  + +    + L S+L  D 
Sbjct: 613  KLNEQKLILERKLQNKNIEIDDLNSSNYDQISWYQKKLDQYEKTI----KTLESRLPADT 668

Query: 878  QHLELKVESLNNKLEES-------------EARIQAFNALNYSESV-----ESQTETLRQ 919
            Q+ +  VE  +  LE+S             E  I+ F   N ++ +     E   E + +
Sbjct: 669  QNSKALVE--DKALEDSRDASPVSSSASCNEITIRIFGDSNKTKKIYPIEEEKNLELITK 726

Query: 920  ELEKTRIKLADAYSQVEQYKSMADSSEESATAIKDALEQSKAEYTEKIETLTKERDMFKD 979
            ELE T++++ +  +   Q + + +  E SA            E  +   +L  ERD   D
Sbjct: 727  ELEDTKVRVQNLAT---QNRLLLEKLERSAN----------LEVDDIFVSLRYERDTLSD 773

Query: 980  QV--------PILKDQISNLNNELNHQKSQ---FESQ---ISDYTR---NLEDLKAKQSE 1022
            QV         IL D + ++ +ELN   SQ   FE+Q   + D+ +   N E L  K +E
Sbjct: 774  QVVNYEKDMQVILAD-LESVQSELNAANSQILNFENQRAMVQDHKKGNVNEETLIEKLTE 832

Query: 1023 LDNMK---AEYEQKISKIQEDLNQQTSYANTAQK-NYEQELQKHADVSKKISLLRAEAQK 1078
            LD +K    E  Q+I  + E+        N A K   E+ L++   +  KIS L    + 
Sbjct: 833  LDELKERNMELTQEIHALNEN--------NIALKCQLEESLERLKPLETKISELNILIED 884

Query: 1079 YKSETETLRNAAENAKKALEQSELSWEKQSSDYEDELRLAHQ 1120
              +        AEN K     +EL+   +++D ED + L  Q
Sbjct: 885  KDNIINVSNEKAENWKTRF--NELTLSAKNNDNEDLINLQKQ 924

>TPHA0E00230 Chr5 complement(28358..32212) [3855 bp, 1284 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1284

 Score =  133 bits (335), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 178/731 (24%), Positives = 341/731 (46%), Gaps = 78/731 (10%)

Query: 163 LQNTKT-LRKQVLELENEVQTFKSNDLRGKAEMQRLTQEMNLLKSNNQWLEKELASKSEE 221
           + N KT L  ++ ELE +++  K N+L  K E+++++   N L+S N+ LE +L++ ++ 
Sbjct: 73  VTNEKTQLADKISELEVKLEQEKCNNLHTKLELEKMSITYNSLESKNRELESDLSAMNDN 132

Query: 222 FGS------YR-QRVNSELQTALSELNXXXXXXXXXXXXXQTLKSRANDLSQQLQDKMTE 274
             +      Y+ Q +N E+      +N             + LK   ND    L++K++E
Sbjct: 133 ENTLHDEEQYKNQCLNREV------INLKNDILILETKYDKLLKG-YNDTKDNLKEKISE 185

Query: 275 LKSLRDSSSIEKQEFTREMTLKQRLIDLLEKQIESFKTELESARNKSVS-NSDHVDAERX 333
           L +L  S       F  E  LK  +I+  +  I +   E+ES +N+ ++ +S  ++ E  
Sbjct: 186 LLALDTS-------FKSETKLKDEIIEEKDYLIANLTNEIESLKNREINEHSSDINIEYG 238

Query: 334 XXXXXXXXXXXXXXXXXXXAV-------------KLEETVDELLSTDGERGAGNTSKVSL 380
                               +             +L  TV+E  S  G       + VS 
Sbjct: 239 KNSSIIVDKQEYQRLLNEALINNEKIDEYDLKVARLTATVNEFQSKTG------INFVST 292

Query: 381 DSKNSIVPKLHGDIGLLKKRLIQERRQKEQLQYQVEAFVLELEHKVPVLNSFKERTEMLE 440
           D           D  +LKK + +   Q++ LQ ++E  + ELE+  P LN+  ++   LE
Sbjct: 293 DD--------FCDFIILKKEIQKLEGQRDLLQEKLEYLIHELENHAPELNNQYDKINELE 344

Query: 441 KELSDVALMLEATSKDKEEKEHELTSVK----------SKIADYETQIHSLVRQRSDLAH 490
                  L+L   SK+K   EH  T++K          S++   + +I +L  + +DL +
Sbjct: 345 -------LLL---SKEKNTSEHFKTTIKEIENEKKNIISRLKLSDDKIETLREENNDLTN 394

Query: 491 QVQHLLIQVSVRNDSNGPLTPEETNFIKKII-NSSESPVEQ--DAQRIISERLVRFESMV 547
           Q+Q +LI  S++ND  G LT  E  FIK +    +E+   +  ++Q IIS+RL+RFES++
Sbjct: 395 QIQFMLISNSIQNDKYGELTENEIKFIKALREKGTETSFNELYNSQDIISDRLIRFESVI 454

Query: 548 ELQEKNMELLNSIRNLADKLXXXXXXXXXXXXXXXXXXXXXXXXXILTLQEYNKSLESQL 607
            LQ+KNMEL+ ++R +  KL                         IL +   +  L+ ++
Sbjct: 455 SLQQKNMELIKTLRLITKKLDNQEHELRAKWEAENDDVLNEAKEEILKVVSESDKLKEKI 514

Query: 608 EIIAKERDAFKILASDKGTSNGPSNVNSSENRHLVLAEEKI-KELENHLSSLTEESAKNI 666
             + ++ +A + ++ +K   NG  +V  +EN+     +  I  EL+N++   T++++  I
Sbjct: 515 SELQQQLNANRPVSHEK---NGHESV-LAENKLYTEGDRLILDELKNNIPEFTKQASNII 570

Query: 667 KLLNEEIHSLYRAQADTSVNLEKERSSRILAEDRSKLISNTLEMTKMENDELRKRFHSLQ 726
            +  +++ SLY    + + +  K   SR + + +  L+ +  +   + N++L++    ++
Sbjct: 571 SMNFDQLTSLYNKNLELTADRLKAYQSRDITQKKLDLLQDKYDYLSISNEKLKEHMEVIK 630

Query: 727 ENILKQDSKTQQTIESLISCKXXXXXXXXXXXXXXXERDLLRSIQENLKKENESLSEERN 786
           + I ++D     TI + + CK               + D L+ +++   +    L  ER 
Sbjct: 631 DTIRRKDETLNSTIANHVDCKASLLSVTNDMNSLMTKYDELKYLKDQQSRITNELKMERE 690

Query: 787 NMRILITQLQTLQTERESLLEETQKNFQGKTNKLETELSDTLEKLDAKSKEISDYISTKD 846
            +++ +  ++T+Q + +    E + +   K N LE   S+  + L  K +E+ D+ISTK+
Sbjct: 691 QLKMELLNIKTVQIQSDLESAEYKASVASKINDLEITNSNLSKDLRTKEQELQDFISTKN 750

Query: 847 SQEKWYQEKFD 857
            +  WYQ+KFD
Sbjct: 751 RELDWYQKKFD 761

 Score = 40.4 bits (93), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 28/83 (33%), Positives = 52/83 (62%)

Query: 1323 SELQQEIKSKSDENEELDTRFKRLKQQAHEKLNAAKTAQSTLTSQLNDLKATKEKLENDL 1382
            S+ +++ + KS EN+E   RF RLK+QA+ +L+++K  Q+ L  Q++ LK    ++++ L
Sbjct: 971  SDFKEKYEMKSKENDENIDRFNRLKKQANARLHSSKEEQNALNEQISSLKKDLAEVQSKL 1030

Query: 1383 GSQKEEVKNLESKITDIEKNKSS 1405
              Q + V+ LE++I   E +  S
Sbjct: 1031 EVQSKTVQELETQIKSTEADSRS 1053

>TPHA0D04610 Chr4 (1006833..1010384) [3552 bp, 1183 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1183

 Score = 89.7 bits (221), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 60/179 (33%), Positives = 105/179 (58%), Gaps = 9/179 (5%)

Query: 392 GDIGLLKKRLIQERRQKEQLQYQVEAFVLELEHKVPVL--NSFKERTEMLEKELSDVALM 449
            +I  +K  LI+E+ +K  L+ +   F+ ++E K+P L  NS +  T    K + +  ++
Sbjct: 281 NNIDDIKTELIKEKYEKSLLEKKFNDFLFDIESKLPYLQNNSVENETNNGNK-IEEQKII 339

Query: 450 LEATSKDKEEKEHELTSVKSKIADYETQIHSLVRQRSDLAHQVQHLLIQVSVRN-DSNGP 508
            E  S   E +     S+K K+ D+E+ + +L++QRSDL HQ+ +LLI  S  N D+N  
Sbjct: 340 HEHDSLKLENQ-----SLKIKLNDFESTVKTLLQQRSDLGHQINYLLITQSYLNEDNNKI 394

Query: 509 LTPEETNFIKKIINSSESPVEQDAQRIISERLVRFESMVELQEKNMELLNSIRNLADKL 567
           LT  E NFI+ ++    +    + Q IISERL++F ++ +L  KN++L++ +R L +K+
Sbjct: 395 LTENELNFIRNLVAQPTNTWSTETQNIISERLLKFSNVSDLTAKNIKLISLVRELTNKM 453

 Score = 46.6 bits (109), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 137/529 (25%), Positives = 223/529 (42%), Gaps = 111/529 (20%)

Query: 1254 LKAELDALYGKVQPLESKVTLLQNSVREKDLQISLKNEEAE-RWKQRSQDILHKYERI-- 1310
            LK EL+ +    + LE+K+ L     +E D++I ++  +++ +W Q   D ++    +  
Sbjct: 680  LKEELNTVKSLNKSLEAKIKL-----QENDIKILIEKYKSQIKWYQDKIDEMNTTMEVKI 734

Query: 1311 -----DPEEHQKLADK--VSELQQEIKSKSDE-NEELDTRFKRLKQQAHEKLNAAKTAQS 1362
                   E    L +K  + EL+++I++KS E  E LD RF RLK+QA +KLN  K  ++
Sbjct: 735  SNLASSAESAAMLKNKNEIDELKKQIETKSKELTESLD-RFARLKKQAKDKLNEFKGTEN 793

Query: 1363 TLTSQLNDLKATKEKLENDLGSQKEEVKNLESKITDIEKNKSSEKNDL------QEQLEN 1416
             L     DL+ +K +LE  L   +   K+L+ +I  ++    +  N+L      QE+L N
Sbjct: 794  KLREDYCDLEKSKNELEQRLLLLESSEKSLQEEIVKMKDELMTSNNELDNNQRSQEELRN 853

Query: 1417 SQAKLLETENKLEQVTSSSALLEKELNERIESLMNKIKLLEEDLEKAKTES-PNDGSQSS 1475
                  E +NKL ++            E +ES +N++ L E        ES P+D     
Sbjct: 854  E----YEKQNKLYKIKE----------EELESALNQLMLKENQNSALDLESLPDDV---- 895

Query: 1476 ELVENTSKIVENLKIEFEEEKAKMISDKESELREQFEEEKASILEAKEQELREQLATQKL 1535
                                   M+  KE  +++  E E   IL+AK +E+ +  A    
Sbjct: 896  -----------------------MLKLKEM-VKKDIEIENDIILKAKLKEIEKNSAKDVN 931

Query: 1536 DPPV-----NIDEIKKKWEEEYEQKTSQRIRESNEQLKKRIRLPTEEKINKIVEKKRLEL 1590
               +     NI  +K+ WE+EY     Q I      LK RI    E+  N+ + + R EL
Sbjct: 932  TDSIELSDDNISTMKEAWEKEY-----QHI------LKIRI----EDAENQAMARTRKEL 976

Query: 1591 EAEFEANVQKKAEEIXXXXXXXXXXXT--EVLEKHKQDLENLKQEMQKKFDEDIAQIKKR 1648
            E E+E  + K++E++              E+L+  K+    L+ +++ + DE      K+
Sbjct: 977  EKEYEERLSKESEKLSDQYNNKLKDDLSEELLKIDKKYAMELETKLKNETDES-----KK 1031

Query: 1649 AFEEGKQQASMKSTFLEKKIAKLETQIK--------------AHDSAIPINDNSSATPAE 1694
             F++       K+  L KKI  LETQIK                D  IP   N S   A 
Sbjct: 1032 EFQDALGTEQTKNKILSKKIEFLETQIKELKDEQTKHHSNPMKSDEKIPSTTNLSTNFAF 1091

Query: 1695 S-GPTTQDVKQLTPILNNQAAILPGKPLPFNPAHFAFGMPFGQTTSNSF 1742
               P   +  Q   + N     L G P   N    AF       T++S 
Sbjct: 1092 GQNPFVSNASQNAYMSN---VFLSGSPFSRNAPEKAFKHSTPDNTNSSI 1137

>Kpol_2001.75 s2001 (206286..209306) [3021 bp, 1006 aa] {ON}
            (206286..209306) [3021 nt, 1007 aa]
          Length = 1006

 Score = 52.0 bits (123), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 84/310 (27%), Positives = 145/310 (46%), Gaps = 61/310 (19%)

Query: 1289 KNEEAERWKQRSQDILHKYERIDPEEHQKLADKVSELQQEIKSKSDENEELDTRFKRLKQ 1348
            K+ E  +W Q   D  ++ E    + +  L +    L++  + KS E EE + +F RLK+
Sbjct: 618  KHNEQIKWFQNKIDNFNE-ETTKNQFNNALKNDYENLKKSFEEKSKEVEEANDKFSRLKR 676

Query: 1349 QAHEKLNAAKTAQSTLTSQLNDLKATKEKLENDLGSQKEEVKNLESKITDIEKNKSSEKN 1408
            QA+E+LNA+KT Q  L+  +       + LE++  + KE +  LE  I           N
Sbjct: 677  QANERLNASKTTQKELSDNV-------KSLEDERTNFKEHISKLEVDI-----------N 718

Query: 1409 DLQEQLENSQAKLLETENKLEQVTSSSALLEKELNERIESLMNKIKLLEEDL-EKAKTES 1467
            +L   L  ++ KL E   K E    + + L  ++++        ++L E++L EK K   
Sbjct: 719  NLNNALVEAEKKLSEENLKYETERQTGSTLRLKIDD--------LQLNEDNLKEKVKN-- 768

Query: 1468 PNDGSQSSELVENTSKIVENLKIEFEEEKAKMISDKESELREQFEEEKASILEAKEQELR 1527
                     L EN S +         ++K KMI   E +L       K S+L++ E  L+
Sbjct: 769  ---------LEENESTL---------KDKIKMIEGNEDDLM-----GKISVLQSNEILLK 805

Query: 1528 EQL-----ATQKLDPPVNIDEIKKKWEEEYEQKTSQRIRESNEQLKKRIRLPTEEKIN-- 1580
            ++L      +      V+++ +KK WE+EY     +RI  +  QL+KR++   E +++  
Sbjct: 806  DKLNDLNSKSSNNSELVDVEGLKKDWEKEYSHIIEKRIEYAEMQLEKRLKSEMEREMDDK 865

Query: 1581 -KIVEKKRLE 1589
             K+VE K  E
Sbjct: 866  MKVVEMKGFE 875

 Score = 48.5 bits (114), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 58/115 (50%), Gaps = 9/115 (7%)

Query: 374 NTSKVSLDSKNSIVPKLHGDIGLLKKRLIQERRQKEQLQYQVEAFVLELEHKVPVLNSFK 433
           NT+K SLD           D  +LKK L+ E+    +LQ ++ + +LEL  K+P L S K
Sbjct: 198 NTNKYSLD---------LNDNKVLKKLLVHEKNSNLKLQEELNSILLELNFKLPSLTSLK 248

Query: 434 ERTEMLEKELSDVALMLEATSKDKEEKEHELTSVKSKIADYETQIHSLVRQRSDL 488
           E+   L+    ++    E   +       ++ S+ +KI DYE  +  L+ QR++L
Sbjct: 249 EKNHELQSVFENIISSNEELLQQFHSNTDKIASMNNKIVDYEQSLKQLLSQRTNL 303

>KLTH0F05720g Chr6 (490598..502924) [12327 bp, 4108 aa] {ON} similar
            to uniprot|P36022 Saccharomyces cerevisiae YKR054C DYN1
            Cytoplasmic heavy chain dynein microtubule motor protein
            required for anaphase spindle elongation involved in
            spindle assembly chromosome movement and spindle
            orientation during cell division targeted to microtubule
            tips by Pac1p
          Length = 4108

 Score = 37.7 bits (86), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 51/177 (28%), Positives = 85/177 (48%), Gaps = 18/177 (10%)

Query: 1334 DENEELDTRFKRLKQQAHEKLNAAKTAQSTLTSQLNDLKATKEKLENDLGSQKEEVKNLE 1393
            DEN    + F+ L  +   + N+ ++ + +LTS LN +  TK   E  L +   ++ +L+
Sbjct: 775  DENPASLSIFRSLVNEIITRFNSLESLERSLTSFLNSIDLTKFS-EPSLRNWITQIVSLK 833

Query: 1394 SKITDIEK-NKSSEKNDLQEQLENSQAKLLETENKLEQVTSSSALLEKELNERIESLMNK 1452
            S IT +EK N +  +  L+ Q+E S   L     K E +  +    + E+   I+S  N 
Sbjct: 834  SSITSLEKGNYTCFETYLEAQIEESVLNLTRLALKPENLPKT----KHEVT--IDS--NG 885

Query: 1453 IKLLEEDLEKAKTESPNDGSQSSELVENTSKIVENLKIEFEEEKAKMISDKESELRE 1509
            + LLE  LE  KT       +  E ++NT  I   LK  +E++K + +  K   L E
Sbjct: 886  V-LLEPSLESTKT-------RWLEHIQNTLNISFTLKAYYEDDKGEPVGQKTKRLDE 934

>KAFR0E00400 Chr5 (91314..92504) [1191 bp, 396 aa] {ON} Anc_1.496
           YML048W
          Length = 396

 Score = 36.6 bits (83), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 26/38 (68%)

Query: 636 SENRHLVLAEEKIKELENHLSSLTEESAKNIKLLNEEI 673
           SEN   +L+EE   E+EN+L S+ E+   +I L+NEEI
Sbjct: 313 SENPKFILSEEYYVEVENNLKSILEKCNNDIGLMNEEI 350

>NCAS0G00280 Chr7 (47258..49393) [2136 bp, 711 aa] {ON} Anc_5.696
            YIL144W
          Length = 711

 Score = 36.6 bits (83), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 42/132 (31%), Positives = 69/132 (52%), Gaps = 16/132 (12%)

Query: 1323 SELQQEIKSKSDENEELDTRFKRLKQQAHEKLNAAKTAQSTLTSQLNDLKATKEKLENDL 1382
            SE+Q  I+    EN +L+T    LK Q +E  +  +  +  L    ++ + T++K E+DL
Sbjct: 560  SEIQDIIRDLKAENSQLETTINELKAQINESTSQNEYLEEELAHLKSEFELTRQKDESDL 619

Query: 1383 GSQKEEVKNLESKITDIEKNKSSEKNDLQEQLENSQAKLLETENKLEQVTSSSAL-LEKE 1441
             SQK E++  E KI D        KN++       ++KLL+  N+L Q T +     ++ 
Sbjct: 620  VSQKIEIEKFERKILD-------SKNEI-------ESKLLKA-NRLVQATKTKHHEAQRS 664

Query: 1442 LNERIESLMNKI 1453
            +NE+ ESL  KI
Sbjct: 665  INEKRESLQRKI 676

>NCAS0A02450 Chr1 complement(463760..469546) [5787 bp, 1928 aa] {ON}
            Anc_4.238 YDL058W
          Length = 1928

 Score = 36.6 bits (83), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 35/124 (28%), Positives = 68/124 (54%), Gaps = 10/124 (8%)

Query: 1316 QKLADKVSELQQEIKSKSDENE-------ELDTRFKRLKQQAHEKLNAAKTAQSTLTS-- 1366
            ++L +++SE+++E+KS  +E         +L+     LK    +K+ A +    TL S  
Sbjct: 1542 EELKNQISEIKEELKSSKEEMAKKDMMLIDLNKTLASLKGDVKDKVLAIEKLNETLASLK 1601

Query: 1367 -QLNDLKATKEKLENDLGSQKEEVKNLESKITDIEKNKSSEKNDLQEQLENSQAKLLETE 1425
              + D     EKLE  L S K+++K+ +  I D++K K+SE+++ +  +E    +L + +
Sbjct: 1602 GNIKDKDLAIEKLEKTLNSLKDDIKDKDQTIEDLKKKKASEESEFKITIEGKDKELTDLK 1661

Query: 1426 NKLE 1429
            NKL+
Sbjct: 1662 NKLQ 1665

>Kpol_479.3 s479 (2938..5325) [2388 bp, 795 aa] {ON} (2938..5325)
            [2388 nt, 796 aa]
          Length = 795

 Score = 36.6 bits (83), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 65/241 (26%), Positives = 111/241 (46%), Gaps = 30/241 (12%)

Query: 1229 QLNLLRESNITLRNEAQKNGERSRELKAELDALYGKVQPLESKVTLLQNSVREKDLQISL 1288
            QLNL +        +A K+ ER  ++K +L     ++Q L     +LQ      D    +
Sbjct: 328  QLNLAQAEVDQSTEDANKHKERFEKIKKKLSETKDEIQMLNQNQRILQ------DKYDGM 381

Query: 1289 KNEEAERWKQRSQDILHKYERIDPEEHQKLADKVSELQQEI---KSKSDENE-------- 1337
             NE  + W+ + +++  K  + + E +   A K+  L+ E+   K+K DE E        
Sbjct: 382  ANE-VDEWRNKYEEVQGKMAKQENEANNS-ASKLQLLEDELEILKNKLDEYEASETKLKL 439

Query: 1338 ---ELDTRFKRLKQQAHEKLNAAKTAQSTLTSQLNDLKATKEKLENDLGSQKEEVKN--- 1391
               ELD  F++ +++   K N   T Q +L   +N  K+  E    DL  Q EE+     
Sbjct: 440  DYKELDELFQKREEELFSKANEVNTLQQSLNEIMNSQKSASE----DLVKQIEELSTSKS 495

Query: 1392 -LESKITDIEKNKSSEKNDLQEQLENSQAKLLETENKLEQVTSSSALLEKELNERIESLM 1450
             LE K++ I  + S EK+ L++++   +  L E   KLE      + L+ +LN  I++L 
Sbjct: 496  QLEVKLSQISVDHSKEKHYLEDKINGMEKDLSENVGKLEIANQKISDLQIKLNGEIQNLA 555

Query: 1451 N 1451
            N
Sbjct: 556  N 556

>TDEL0B02260 Chr2 (408913..410901) [1989 bp, 662 aa] {ON} Anc_5.696
            YIL144W
          Length = 662

 Score = 36.2 bits (82), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 44/135 (32%), Positives = 71/135 (52%), Gaps = 20/135 (14%)

Query: 1275 LQNSVREKDLQISLKNEEAERWKQRSQDILHKYERIDPEEH-------QKLADKVSELQQ 1327
            L ++V E  L++SL +EE ++     +D    YE I    H       Q+L+    E+Q+
Sbjct: 464  LGHNVDESLLKVSLSDEELQK-----EDKGIAYESIFSSNHNTAEKAQQELSKLYKEIQE 518

Query: 1328 EIKSKSDENEELDTRFKRLKQQAHEKLNAAKTAQSTLTSQLNDLKATKE-KL---ENDLG 1383
             +K+   EN  ++ +   L+++  EK NA +     L  QL+D K+  E KL   E+ L 
Sbjct: 519  RVKNCQMENSTIEAKVVDLQREIREKTNAIER----LELQLSDAKSNYELKLQENESSLL 574

Query: 1384 SQKEEVKNLESKITD 1398
            SQK E++ LE KI+D
Sbjct: 575  SQKIEIEKLEKKISD 589

>KNAG0A03360 Chr1 complement(425339..427609) [2271 bp, 756 aa] {ON}
            Anc_8.604 YOR195W
          Length = 756

 Score = 36.2 bits (82), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 95/379 (25%), Positives = 171/379 (45%), Gaps = 75/379 (19%)

Query: 822  TELSDTLEKLDAKSKEISDYISTKDSQEKWYQEKFDRLNEELNNSREKLSSKLTDIQHLE 881
            T+L D  E L     E+   +S  DS +   QEK+D++  E   S+       TD   ++
Sbjct: 309  TKLRDENESLKTSIGELKTELSMLDSNQTLLQEKYDQIYSEYEKSQ-----STTDF--MK 361

Query: 882  LKVESLNNKLEESEARIQAFNALNYSESVESQTETLRQELEKTRIKLADAYSQVEQYKSM 941
             ++ESL   LE+S   ++  +   +S+ +ES+  T+ QE                  K+M
Sbjct: 362  KEIESLQKSLEDSANILEELSE--HSKELESKLSTVEQE-----------------KKNM 402

Query: 942  ADSSEESATAIKDALEQSKAEYTEKIETLTKERDMFK----------DQVPILKDQISNL 991
             +   +     K  + Q   +  E +    K +D+            DQ+ +L ++  +L
Sbjct: 403  EEEKLKLLKENKHVMNQLSGKDNEIVSLEGKIKDLVNSERNHSKSLIDQIAVLTNEKMSL 462

Query: 992  NNELNHQKSQFESQISDYTRNLED-LKAKQSE-LDNMKA--EYEQKISKIQEDLNQQTSY 1047
              ++   ++QF+S+IS+    L+D LK K+SE LD  +A  + ++  +K+  ++  +T  
Sbjct: 463  EEQVKKSENQFQSEISE----LQDTLKEKESELLDTTRALNDAKEDNTKLINEMMDRTKE 518

Query: 1048 ANTAQKNYEQELQKHADVSKKISLLRAEAQKYKSETETLRNAA---ENAKKALEQSELSW 1104
              + +K YE E   HA      S+  AE  +  ++ ETL+ +    E     L++   +W
Sbjct: 519  VQSLKKTYE-EANDHA------SVRTAEVTELNNQIETLKESQRHLETTIDLLQEKIGTW 571

Query: 1105 EKQSSDYEDEL---RLAHQRIEDLNAQSKILYDQIDFLSKGKPTSSEDLMPISTETRNLL 1161
            +   S YED++   R  +  IE LNA+ K   D+    +   P S+E            L
Sbjct: 572  K---SKYEDQIEKERELNLEIETLNARVK---DEEHSSTGDAPNSAE------------L 613

Query: 1162 TSLRREKDILETKLEVSTR 1180
              +R+EK+ L+ KL  S +
Sbjct: 614  HQMRKEKEELQKKLSDSVK 632

>Skud_5.77 Chr5 complement(119815..120618) [804 bp, 267 aa] {ON}
            YEL019C (REAL)
          Length = 267

 Score = 35.4 bits (80), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 26/45 (57%), Gaps = 4/45 (8%)

Query: 1623 HKQDLENLKQEMQKKFDEDIAQIKKRAFEE----GKQQASMKSTF 1663
            H QDL NL Q+  K+FDE I Q+   A       G+Q A++ ST+
Sbjct: 26   HTQDLSNLYQQCYKQFDETINQLVDSASPSIADIGEQIANITSTY 70

>KLLA0D06875g Chr4 complement(591141..592529) [1389 bp, 462 aa] {ON}
            similar to uniprot|Q12234 YOR216C Saccharomyces
            cerevisiae RUD3 Golgi matrix protein that is involved in
            the structural organization of the cis-Golgi
          Length = 462

 Score = 35.4 bits (80), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 40/138 (28%), Positives = 75/138 (54%), Gaps = 27/138 (19%)

Query: 1318 LADKVSELQQEIKSKSDENEELDTRFKRLKQQAHEKLNAAKTAQSTLTSQLNDLKATKEK 1377
            L D++  L +E ++ S+E  E  ++ K L+     KLN A   +S +TS L         
Sbjct: 181  LNDEIVNLNKECENLSNECSEFKSKIKELES----KLNEASNEESNITSCL--------- 227

Query: 1378 LENDLGSQKEEVKNLESKITDIE---KNKSSEKNDLQEQLENSQAKLLETENKLEQVTSS 1434
                    K EVK+L+S+I ++E    N++ +K DL+EQ+ + + +L +++   +Q+ + 
Sbjct: 228  --------KSEVKSLKSQIDNLEIIINNEAQDKRDLEEQIADYKQQLEQSDETKKQLDNI 279

Query: 1435 SALLEKELNER---IESL 1449
             + LEK++N+    IE+L
Sbjct: 280  MSNLEKQINDNNTTIETL 297

>TPHA0A01150 Chr1 complement(224257..226713) [2457 bp, 818 aa] {ON}
            Anc_8.604 YOR195W
          Length = 818

 Score = 35.8 bits (81), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 75/283 (26%), Positives = 128/283 (45%), Gaps = 70/283 (24%)

Query: 1222 EIMTQLNQLNLLRESNITLRNEAQKNGERSRELKAELDALYGKVQPLESKVTLLQNSVRE 1281
            +++ Q+N LN  +E NI+L  + Q      + LKAE D L  K    E+K+ +   +  E
Sbjct: 308  DLIAQINNLN--KELNISLSAQEQ-TIYNFKLLKAEYDGLSEKY---ETKINI---TAEE 358

Query: 1282 KDLQISLKNEEAERWKQRSQDILHKYERIDPEEHQKLADKVSELQQEI----------KS 1331
                  ++N + ER  Q          +ID     KL  K+SE + EI          ++
Sbjct: 359  ------MENIQTERENQN--------RKID-----KLKKKISEYKDEISMLNQNQKILQN 399

Query: 1332 KSDENEELDTRFKRLKQQAHEKLNAAKTAQSTLTSQLNDLKATKEKLENDLGSQK----- 1386
            K ++  +   ++K   ++ ++KL A +     + + LN L + KEKL ++L S +     
Sbjct: 400  KYNQTSDESEKWKLSHEEVNDKLQALEKDHQAVLNNLNQLISDKEKLGSELSSYENQVKD 459

Query: 1387 -----------------------EEVKNLESKITDIEKNKSSEKNDLQEQLENSQAKLLE 1423
                                   EE K L+ K+ D    +S   NDL +QLE ++   +E
Sbjct: 460  LNENIHSLEEKDKLNSNKLETITEEYKTLQQKLQDTLSQQSGTTNDLNKQLEETRLAKIE 519

Query: 1424 TENKLEQVTSSSA----LLEKELNERIESLMNKIKLLEEDLEK 1462
             E++L+++ +SS      LE +L E  + L N  KL++E L K
Sbjct: 520  VESQLDELKTSSISEKETLEIKLKETEQQLENNTKLVDELLAK 562

>NDAI0A07030 Chr1 (1602728..1604770) [2043 bp, 680 aa] {ON} Anc_3.102
            YDR484W
          Length = 680

 Score = 35.4 bits (80), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 43/80 (53%), Gaps = 15/80 (18%)

Query: 967  IETLTKER----DMFKDQVPILKDQISNLNNELNHQKSQFESQISDYTRNLEDLKAKQSE 1022
            +E+L K+R        D VP L+D ++N           F++Q+SD+TR+L  ++ K SE
Sbjct: 61   LESLKKKRQTISHTLNDVVPPLRDYMTN-----------FKTQLSDFTRDLSFIREKSSE 109

Query: 1023 LDNMKAEYEQKISKIQEDLN 1042
            L+++      K+S I   +N
Sbjct: 110  LEHLLEYNATKLSAISPLVN 129

>TDEL0A05490 Chr1 (962132..964477) [2346 bp, 781 aa] {ON} Anc_8.604
            YOR195W
          Length = 781

 Score = 35.4 bits (80), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 54/233 (23%), Positives = 111/233 (47%), Gaps = 43/233 (18%)

Query: 1239 TLRNEAQKNGERSRELKAELDALYGKVQPLESKVTLLQNSVREKDLQISLKNEEAERWKQ 1298
            TL NE++ + +R  EL  E  +L G+V     +  LL   ++    Q+            
Sbjct: 363  TLINESETSKQRETELGVECSSLKGEVARCSKERQLLDEELKNVSTQL------------ 410

Query: 1299 RSQDILHKYERIDPEEHQKLADKVSELQQEIKSKSDENEELDTRFKRLKQQAHEKLNAAK 1358
               D+  +   ++ + ++KL +++S+L++ + +K+ E        +RL++Q  E ++A K
Sbjct: 411  --HDVTTRNTMLE-DHNEKLREEISDLKERLTTKNGE-------LERLQKQLDETISAGK 460

Query: 1359 TAQSTLTSQLNDLKATKEKLENDLGSQKEEVKNLESKITDIEKNKSSEKNDLQEQLEN-- 1416
             A   + ++LN++ A +               NLE+++  +     ++ N L++QL    
Sbjct: 461  GANDEVLAELNEVIAQR--------------ANLEAELEALRVASEADGNKLRDQLHEAV 506

Query: 1417 SQAKLLETENKLEQVTSSSALLEKELNER---IESLMNKIKLLEEDLEKAKTE 1466
            +++ L+  E  ++++   S  L+  LN R   IE +  KI+ L +D E  K E
Sbjct: 507  TRSNLMVLE--VQELKDHSDGLQAGLNARVSEIEQMSKKIEELNDDAEIGKAE 557

>TPHA0E00750 Chr5 (146045..149278) [3234 bp, 1077 aa] {ON} Anc_7.409
           YER111C
          Length = 1077

 Score = 35.4 bits (80), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 27/94 (28%), Positives = 55/94 (58%), Gaps = 13/94 (13%)

Query: 765 DLLRSIQENLKKENESLSEERNNMRILITQLQTLQTERESLLEETQKNFQGKTNKLETEL 824
           +L +SI+ +++   E +S+ +  + ++  QL+ +  +R++L+++  KNF  K NK++ EL
Sbjct: 899 NLNKSIKSDVRNMQEEISKNKRKVDVINYQLEGVDNQRKTLIDQMSKNF--KINKID-EL 955

Query: 825 SDTLEKLDAKSKEISDYISTKDSQEKWYQEKFDR 858
            D L+ L  +          KD+ +K + EKF+R
Sbjct: 956 HDKLKSLHEE----------KDALKKQFLEKFER 979

>KLTH0D09504g Chr4 (783223..785379) [2157 bp, 718 aa] {ON} weakly
           similar to uniprot|Q08581 Saccharomyces cerevisiae
           YOR195W SLK19 Kinetochore-associated protein required
           for normal segregation of chromosomes in meiosis and
           mitosis component of the FEAR regulatory network which
           promotes Cdc14p release from the nucleolus during
           anaphase potential Cdc28p substrate
          Length = 718

 Score = 35.4 bits (80), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 43/71 (60%)

Query: 145 LNEKIGDLEASQDEAKQLLQNTKTLRKQVLELENEVQTFKSNDLRGKAEMQRLTQEMNLL 204
           L ++I DL   ++E  + L++  TLR ++ E ENE+Q+ K+   R +  +Q L +E + L
Sbjct: 410 LEQRINDLTLEKNELVRELEDMSTLRSKIEESENEIQSVKTELDRTQVALQHLKEEHSEL 469

Query: 205 KSNNQWLEKEL 215
           + + + LE EL
Sbjct: 470 REHCRSLEAEL 480

>KLTH0G12144g Chr7 complement(1020201..1030949) [10749 bp, 3582 aa]
            {ON} weakly similar to uniprot|Q00402 Saccharomyces
            cerevisiae YDR150W NUM1 Protein required for nuclear
            migration localizes to the mother cell cortex and the bud
            tip may mediate interactions of dynein and cytoplasmic
            microtubules with the cell cortex
          Length = 3582

 Score = 35.4 bits (80), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 49/198 (24%), Positives = 99/198 (50%), Gaps = 34/198 (17%)

Query: 1316 QKLADKVSELQQEIKSKSDENEELDTRFKRLKQQAHEKLNAAKTAQSTLTSQLNDLKATK 1375
            +KL+ ++   ++E     D N EL+T+ +++ QQ     +A++ +Q  L +QL+    T+
Sbjct: 123  EKLSRRLHGTEKESAVLKDSNWELETKLQQMSQQLKLLRDASEKSQKELRAQLDTYNVTR 182

Query: 1376 EKLE----NDLGSQKEEVKNLESKITDIEKNKSSEKNDLQEQLENSQAKLLETENKLEQV 1431
             +LE    + LG +KE    LES    + +N   E  DL++ + +     L  EN     
Sbjct: 183  SELEELSLDRLGLKKE----LES----VHQNYLKEIADLKKNVSD-----LNEEN----- 224

Query: 1432 TSSSALLEKELNERIESLMNKIKLLEEDLEKAKTESPNDGSQSSE---LVENTSKIVENL 1488
                     EL ++++S+ N+I  L +D+  + + + +    ++E   L +N +K+ EN+
Sbjct: 225  --------DELQQKLDSMNNQILQLRKDMSNSTSPTLSSAGANAEPVTLAKNITKVSENV 276

Query: 1489 K-IEFEEEKAKMISDKES 1505
            + + F+      ++D ES
Sbjct: 277  RDLAFDSSSQSSVADLES 294

>YLR309C Chr12 complement(749034..751769) [2736 bp, 911 aa] {ON}
            IMH1Protein involved in vesicular transport, mediates
            transport between an endosomal compartment and the Golgi,
            contains a Golgi-localization (GRIP) domain that
            interacts with activated Arl1p-GTP to localize Imh1p to
            the Golgi
          Length = 911

 Score = 35.0 bits (79), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 70/271 (25%), Positives = 127/271 (46%), Gaps = 60/271 (22%)

Query: 854  EKFDRLNEELNNSREK-------------LSSKLTDIQHLELKVESLNNKLEESEARIQA 900
            E++D+L E L   +EK             + ++L D + LE      N++LE+S   ++ 
Sbjct: 320  EEYDKLKENLQELQEKYKDCEDWKQKYEDIEAELKDAKELE------NSQLEKSAKELET 373

Query: 901  FNA--LNYSESVE---SQTETLRQELEKTRIKLADAYSQVEQYKS------------MAD 943
             N   ++  +S++   S+ E +R  L     +L DA  ++++  S            + D
Sbjct: 374  LNTELIDTKKSLKEKNSELEEVRDMLRTVGNELVDAKDEIKESSSKQNEEVKTVKLELDD 433

Query: 944  SSEESATAIKDALEQSKAEYTEKIETLTKERDMFKDQVP-ILKDQISNLNN--ELNHQKS 1000
               ++AT I +A E    E   KIE L+K+ +  K+      K+Q ++ N   +LN + S
Sbjct: 434  LRHKNATMI-EAYEAKNTELRSKIELLSKKVEHLKNLCTEKEKEQTTSQNKVAKLNEEIS 492

Query: 1001 QFESQISDYTRNLEDLKAKQSELDNMKAEYEQK---ISKIQEDLNQQTSYANTAQKNYEQ 1057
            Q   + S+ T+          EL +++  Y+QK   +S ++E + Q +   + A+K+ EQ
Sbjct: 493  QLTYEKSNITK----------ELTSLRTSYKQKEKTVSYLEEQVKQFSEQKDVAEKSTEQ 542

Query: 1058 ELQKHADVSKKISLLRAEAQKYKSETETLRN 1088
              + HA +S ++ LL       K E ETL N
Sbjct: 543  LRKDHAKISNRLDLL-------KKENETLHN 566

>KNAG0F03390 Chr6 complement(635419..638046) [2628 bp, 875 aa] {ON}
            Anc_5.296 YDR285W
          Length = 875

 Score = 35.0 bits (79), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 58/112 (51%), Gaps = 14/112 (12%)

Query: 927  KLADAYSQVEQYKSMADSSEESATAIKDALEQSKAEYTEKIETLTKERDMFKDQVPILKD 986
            KL D +   EQY  +  S +E AT+    L+Q K     K+  LT + D FK ++   K 
Sbjct: 180  KLQDKF---EQYHRLLSSLQEKATS----LQQVKNTENSKLRDLTADYDTFKGKITEYKG 232

Query: 987  QISNLN---NELNHQKSQFESQISDYTRNLEDLKAKQSELDNMKAEY-EQKI 1034
            +IS+L+   NEL   K   ++++   T+ +E L   Q ELD+   +  E+KI
Sbjct: 233  EISSLHTKFNELQTAKRDCDTELLKRTKEIEYL---QRELDDYSGQLSEEKI 281

>Kpol_1067.22 s1067 complement(46246..48414) [2169 bp, 722 aa] {ON}
            complement(46246..48414) [2169 nt, 723 aa]
          Length = 722

 Score = 34.3 bits (77), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 57/197 (28%), Positives = 96/197 (48%), Gaps = 29/197 (14%)

Query: 861  EELNNSREKLSSKLTDIQHLELKVESLNNKL-EESEARIQAFNALNYSE-----SVESQT 914
            E+ N++  KL +K  +I  LEL +E LN KL EE     +   AL YS      ++ES+ 
Sbjct: 260  EKHNDTNNKLITKEENIIQLELNIEKLNAKLQEEKIIHEREIKALKYSSHQQVTNLESKI 319

Query: 915  ETLRQELEKTRIKLADAYSQVEQYKSMADSSEESAT-----AIKDALEQSKA-----EYT 964
            E LR EL+        +  +   ++S+ +SS  ++T      I++  E SKA     EY 
Sbjct: 320  EQLRIELDNDSSAPPKSLDRAISHESLKNSSGTASTKDQYLLIQEQFESSKANWQSIEYA 379

Query: 965  ---------EKIETLTKERDMFKDQVPILKDQISNLNNELNHQKSQFESQISDYTRN-LE 1014
                      ++  + +ER    +++   +   S L+NEL H  ++ E++ +  TR+ LE
Sbjct: 380  LNNRVTDLQTQLADIKEERKNLLNKIKTQETTTSKLSNELKHTITELENEKA--TRSTLE 437

Query: 1015 D-LKAKQSELDNMKAEY 1030
            D L   +S L  +K +Y
Sbjct: 438  DELAVTKSSLQELKDDY 454

>TDEL0F03240 Chr6 complement(591617..596458) [4842 bp, 1613 aa] {ON}
            Anc_3.441 YGR098C
          Length = 1613

 Score = 34.3 bits (77), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 32/47 (68%), Gaps = 4/47 (8%)

Query: 823  ELSDTLEKLDAK-SKEISDYISTKDSQEKWYQEKFD---RLNEELNN 865
            EL + +EK +A  S E++  I+TKD ++KW+Q +++   RL E LNN
Sbjct: 1203 ELFNIIEKSNASTSVEVTSSITTKDERKKWWQTRYELDHRLQELLNN 1249

>Kthe_YGOB_Anc_5.296 Chr7 (520932..522119) [1188 bp, 395 aa] {ON}
            ANNOTATED BY YGOB -
          Length = 395

 Score = 33.5 bits (75), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 34/135 (25%), Positives = 65/135 (48%), Gaps = 5/135 (3%)

Query: 897  RIQAFNALNYSESVESQTETLRQELEKTRIKLADAYSQVEQYKSMADSSEESATAIKDAL 956
            + Q F+  +++E V      L Q ++K ++ L     ++ QYK   D+  +    ++D  
Sbjct: 17   KYQNFDTNSFNEGVVQPISGLGQAMKKVQLSLTSIAERLNQYKIQVDTGLKYEQKLEDLY 76

Query: 957  EQSKAEYTEKIET--LTKERDMFKDQVPILKDQISNLNNELNHQKSQFESQISDYTRNLE 1014
            E+ +    +K E   L K +D+   ++  L DQ+    N LN   ++ +   +D  R  +
Sbjct: 77   EKLQILSMQKSEAVALIKSKDL---EIEELSDQVFTKTNALNELTTKGDEARNDSGRIRK 133

Query: 1015 DLKAKQSELDNMKAE 1029
             L+AK  EL+ +K E
Sbjct: 134  ALQAKTQELEKLKQE 148

>KNAG0B01210 Chr2 (225740..226318) [579 bp, 192 aa] {ON} Anc_3.409
            YGR081C
          Length = 192

 Score = 32.7 bits (73), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 52/112 (46%), Gaps = 20/112 (17%)

Query: 1112 EDELRLAHQRIEDLNAQSKILYDQIDFLSKGKPTSSEDLMPIS----------------T 1155
            ED     HQR E    + K+L  Q  FLS+ K +S+ +   IS                 
Sbjct: 35   EDPKAFLHQRKE--TKKDKLLTKQTAFLSQIKNSSANEFGGISKSAVRRRKRKERDDLKP 92

Query: 1156 ETRNLLTSLRREKDILET--KLEVSTREEKVLRQKLKLIESDLEGSRIELSK 1205
            + ++LLTSL +E D+ E     E  +   +V RQ  +L+E DLE   +++ K
Sbjct: 93   KMQDLLTSLEQEGDLKEFTENAEGDSTAMEVKRQTFRLVERDLEPGTVKIKK 144

>KLLA0A00286g Chr1 complement(22024..25698) [3675 bp, 1224 aa] {ON}
           similar to uniprot|P47037 Saccharomyces cerevisiae
           YJL074C SMC3 Subunit of the multiprotein cohesin complex
           required for sister chromatid cohesion in mitotic cells
          Length = 1224

 Score = 33.9 bits (76), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 33/126 (26%), Positives = 66/126 (52%), Gaps = 13/126 (10%)

Query: 804 SLLEETQKNFQGKTNKLETELSDTLEKLDAKSKEI----SDY--ISTKDSQEKWYQEKFD 857
           S + E Q  FQ  +N+ E  L   +EKL  + +E+      Y    T + +  W QE+ +
Sbjct: 347 SSIAEVQPKFQKLSNEAEI-LKVEIEKLTKRQRELLSKKGKYEDFRTVNERNDWIQEQIN 405

Query: 858 RLNEELNNS---REKLSSKLTDIQHLELKVESLNNKLEESEARIQAFNALNYSESVESQT 914
            LN+ LN S   +++L+S+L+ +QH    +E+LN ++E+    +    ++   E ++++ 
Sbjct: 406 LLNQSLNKSNILKDQLTSQLSTLQH---DLENLNAEIEDLADSVNGMGSVAQQEDLQNKV 462

Query: 915 ETLRQE 920
              ++E
Sbjct: 463 TQAKKE 468

>ADR028W Chr4 (753946..756444) [2499 bp, 832 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YGR089W
          Length = 832

 Score = 33.5 bits (75), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 32/58 (55%)

Query: 1332 KSDENEELDTRFKRLKQQAHEKLNAAKTAQSTLTSQLNDLKATKEKLENDLGSQKEEV 1389
            +  E +ELD  FKR    AHE+L+  ++    L ++   L   KE+L+NDLG   +E 
Sbjct: 716  RRSEYDELDATFKRDILSAHERLSKLQSDLEQLHAKRERLLLRKERLQNDLGQYTQEC 773

>YOR326W Chr15 (925721..930445) [4725 bp, 1574 aa] {ON}  MYO2One of
            two type V myosin motors (along with MYO4) involved in
            actin-based transport of cargos; required for the
            polarized delivery of secretory vesicles, the vacuole,
            late Golgi elements, peroxisomes, and the mitotic spindle
          Length = 1574

 Score = 33.9 bits (76), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 55/106 (51%), Gaps = 7/106 (6%)

Query: 1317 KLADKVSELQQEIKSKSDENEELDTRFKRLKQQAHEKLNAAKTAQSTLTSQLNDLKATKE 1376
            KL +KV EL Q + SK  EN+E+  R K L+ Q  E     +T ++     L D+   K 
Sbjct: 942  KLENKVIELTQNLASKVKENKEMTERIKELQVQVEESAKLQETLENMKKEHLIDIDNQKS 1001

Query: 1377 K-------LENDLGSQKEEVKNLESKITDIEKNKSSEKNDLQEQLE 1415
            K       +EN+L S ++ +K+ + ++ D+ K     K + ++QLE
Sbjct: 1002 KDMELQKTIENNLQSTEQTLKDAQLELEDMVKQHDELKEESKKQLE 1047

>ACR068W Chr3 (480141..485558) [5418 bp, 1805 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YHR023W (MYO1)
          Length = 1805

 Score = 33.5 bits (75), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 38/145 (26%), Positives = 75/145 (51%), Gaps = 10/145 (6%)

Query: 1301 QDILHKYERIDPEEHQKLADKVSELQQEIKSKSDENEELDTRFKRL---KQQAHEKLNAA 1357
            +D L     I+ EE+QKL       Q+E++   +  E+ +T+ K L   K    +++++ 
Sbjct: 880  KDTLQSETTINNEEYQKL-------QKELQQLKESREQSNTKIKELEREKSNLQKQIDSM 932

Query: 1358 KTAQSTLTSQLNDLKATKEKLENDLGSQKEEVKNLESKITDIEKNKSSEKNDLQEQLENS 1417
            K    + T Q   +KA K  LE+ L   K E+K+ E ++ ++E+   +   DL+ +L+  
Sbjct: 933  KRQVDSSTKQAMAMKADKSDLESQLRKLKLELKSKEKRVKELEQKVDNSGEDLKLKLQQV 992

Query: 1418 QAKLLETENKLEQVTSSSALLEKEL 1442
            +        +LEQ+TS + L++ ++
Sbjct: 993  ERAAATNNKRLEQLTSENKLMKDQM 1017

>ZYRO0C10604g Chr3 complement(813540..814124) [585 bp, 194 aa] {ON}
            similar to uniprot|P40155 Saccharomyces cerevisiae
            YNL214W PEX17 Peroxisomal membrane protein component of
            the peroxisomal translocation machinery required for
            peroxisome biogenesis binds Pex14p
          Length = 194

 Score = 32.7 bits (73), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 36/72 (50%), Gaps = 3/72 (4%)

Query: 1272 VTLLQNSVREKDLQISLKNEE---AERWKQRSQDILHKYERIDPEEHQKLADKVSELQQE 1328
            V+ LQN +R   + +   NE    AER  Q S+D L   E      +++L D  + LQQ 
Sbjct: 77   VSQLQNCIRTTPVAVIGYNESHNSAERCTQTSEDELEPLESSWSIINKRLTDSTTHLQQF 136

Query: 1329 IKSKSDENEELD 1340
            +KS S E   L+
Sbjct: 137  VKSNSQEPRNLN 148

>YLR086W Chr12 (302243..306499) [4257 bp, 1418 aa] {ON}  SMC4Subunit
            of the condensin complex; reorganizes chromosomes during
            cell division; forms a complex with Smc2p that has
            ATP-hydrolyzing and DNA-binding activity; required for
            tRNA gene clustering at the nucleolus; potential Cdc28p
            substrate
          Length = 1418

 Score = 33.5 bits (75), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 63/242 (26%), Positives = 129/242 (53%), Gaps = 24/242 (9%)

Query: 850  KWYQEKFDRLNEELNNSREKLSSKLTDIQHLELKVESLNNKLEESEARIQAFNALNYSES 909
            K +Q K  + N +L ++ EK+SS   D++  ++K +    K++E +A+ +       S S
Sbjct: 394  KLFQFKLLQSNSKLASTLEKISSSNKDLEDEKMKFQESLKKVDEIKAQRKEIKDRISSCS 453

Query: 910  VESQTETL-RQELEKTRIKL----ADAYSQVEQYKSMADSSEESATAIKDALEQSKAEYT 964
             + +T  L R+ELE TR+ L     +  S++E+ +    S++ S +  ++ LE+ + + T
Sbjct: 454  SKEKTLVLERRELEGTRVSLEERTKNLVSKMEKAEKTLKSTKHSISEAENMLEELRGQQT 513

Query: 965  E---KIETLT----KERDMFKDQVPILKDQISNLNNE-LNHQK--SQFESQISDYTRNLE 1014
            E   +I+ LT    KER +  D    LKD+  N++ E + H+K    ++ Q+ +    ++
Sbjct: 514  EHETEIKDLTQLLEKERSILDDIKLSLKDKTKNISAEIIRHEKELEPWDLQLQEKESQIQ 573

Query: 1015 DLKAKQSELDNMKAEYEQKISKIQEDLNQQTSYANTAQKNYEQELQKHA-DVSKKISLLR 1073
              +++ S L+  +A+ ++ +  ++E +         A+K ++QELQ    D+ KK++ L+
Sbjct: 574  LAESELSLLEETQAKLKKNVETLEEKI--------LAKKTHKQELQDLILDLKKKLNSLK 625

Query: 1074 AE 1075
             E
Sbjct: 626  DE 627

>TBLA0I01660 Chr9 complement(367039..369207) [2169 bp, 722 aa] {ON}
            Anc_5.696 YIL144W
          Length = 722

 Score = 33.1 bits (74), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 42/149 (28%), Positives = 73/149 (48%), Gaps = 8/149 (5%)

Query: 1230 LNLLRESNITLRNEAQKNGERSRELKAELDALYG---KVQPLESKVTLLQNSVREKDLQI 1286
             N+L E N  L+NE +KN     ++K     +YG   + +  +SK+T +QNS  EK+ +I
Sbjct: 341  FNVLDELNNKLQNETEKNIALKDDVKRFEKYIYGMQNRREDNQSKLTKMQNSKNEKESEI 400

Query: 1287 SLKNEEAERWKQRSQDILHKYERIDPEEHQKLADKVSELQQEIKSKSDENEELDTRFKRL 1346
             L N+E    + + Q+       ID    +KL + +  L+  I +KS+E ++L T  K L
Sbjct: 401  KLLNDELATLETQLQEKGLSASYID----EKLKE-IKVLETSINTKSEEMDKLVTSIKSL 455

Query: 1347 KQQAHEKLNAAKTAQSTLTSQLNDLKATK 1375
            K ++           +  T+ LN    ++
Sbjct: 456  KIESDNIYTVFIETTTQYTNMLNSFNQSR 484

>YDR356W Chr4 (1186107..1188941) [2835 bp, 944 aa] {ON}  SPC110Inner
           plaque spindle pole body (SPB) component, ortholog of
           human kendrin; involved in connecting nuclear
           microtubules to SPB; interacts with Tub4p-complex and
           calmodulin; phosphorylated by Mps1p in cell
           cycle-dependent manner
          Length = 944

 Score = 33.1 bits (74), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 41/117 (35%), Positives = 59/117 (50%), Gaps = 31/117 (26%)

Query: 167 KTLRKQVLELEN--EVQTFKSNDLRGKA-EMQRLTQEMNLLKSNNQWLEKELASKSEEFG 223
           KT++ QVLELEN  +VQ+ K   LR K  E++ L  E+N LKSN +  + +L  K  E  
Sbjct: 244 KTVKDQVLELENNSDVQSLK---LRSKEDELKNLMNELNELKSNAEEKDTQLEFKKNEL- 299

Query: 224 SYRQRVNSELQTALSELNXXXXXXXXXXXXXQTLKSRANDLSQQLQDKMTELKSLRD 280
             R+R N        ELN               LK +++++  QL+ K  E K L+D
Sbjct: 300 --RKRTN--------ELNE--------------LKIKSDEMDLQLKQKQNESKRLKD 332

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.304    0.122    0.305 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 170,406,710
Number of extensions: 7779413
Number of successful extensions: 95020
Number of sequences better than 10.0: 5537
Number of HSP's gapped: 71700
Number of HSP's successfully gapped: 13022
Length of query: 1779
Length of database: 53,481,399
Length adjustment: 124
Effective length of query: 1655
Effective length of database: 39,262,815
Effective search space: 64979958825
Effective search space used: 64979958825
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 43 (21.9 bits)
S2: 73 (32.7 bits)