Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
SAKL0E14872g5.700ON1140114054400.0
Kwal_55.197075.700ON1143116832430.0
KLLA0A00638g5.700ON1155114331950.0
ZYRO0G06644g5.700ON1166112530190.0
KAFR0D022405.700ON1187115729990.0
TDEL0B022105.700ON1095113029150.0
Kpol_2001.745.700ON1113114928810.0
Skud_9.215.700ON1221122728250.0
AFR284W5.700ON1103113527560.0
Ecym_40205.700ON1125113226780.0
TPHA0D045905.700ON1127115126770.0
NCAS0G002505.700ON118394725310.0
KNAG0L021105.700ON120095225200.0
Kpol_1043.685.700ON1042112324980.0
Smik_9.225.700ON123096324750.0
YIL147C (SLN1)5.700ON122095324630.0
Suva_9.415.700ON121995524470.0
TPHA0E002505.700ON1068113624160.0
TBLA0E021005.700ON1140114921660.0
KLTH0E01100g5.700ON117776620860.0
NDAI0F003105.700ON125948013351e-163
TBLA0I016805.700ON121445512891e-157
CAGL0H06567g5.700ON11691625775e-60
ADL388W4.385ON4821321682e-11
Ecym_74744.385ON4961411683e-11
KNAG0M001804.385ON6151291622e-10
KAFR0B069904.385ON5451311612e-10
NCAS0A064504.385ON6091441603e-10
KLLA0A10219g4.385ON4751401567e-10
SAKL0B12408g4.385ON4651301558e-10
CAGL0F09097g4.385ON6301391568e-10
TDEL0D003204.385ON5471311542e-09
TBLA0A107004.385ON5871311532e-09
ZYRO0G00484g4.385ON6471311523e-09
Kpol_265.24.385ON5491311504e-09
Smik_8.2964.385ON6251321504e-09
Suva_15.4124.385ON6171321505e-09
Skud_8.2734.385ON6231321505e-09
NDAI0D034304.385ON5971261495e-09
YHR206W (SKN7)4.385ON6221321496e-09
KLTH0D17182g4.385ON4641251461e-08
TPHA0C001504.385ON5101321442e-08
CAGL0D02882g5.230ON6671491408e-08
Kwal_47.167704.385ON4611251389e-08
KAFR0J007005.230ON6201251344e-07
Suva_10.845.230ON6951471301e-06
Ecym_50775.230ON7951481301e-06
KNAG0B051405.230ON6481271282e-06
YLR006C (SSK1)5.230ON7121471282e-06
Skud_12.725.230ON7021471246e-06
ZYRO0A11154g5.230ON7761471238e-06
Smik_12.685.230ON7121471221e-05
TDEL0E039805.230ON7301401221e-05
KLLA0E09505g5.230ON635721202e-05
NCAS0D029005.230ON7621391202e-05
ADR343C5.230ON7491501192e-05
Kpol_1004.45.230ON7141501157e-05
NDAI0I020005.230ON8901451103e-04
Kwal_33.152885.230ON5871711093e-04
KLTH0B02684g5.230ON5951441069e-04
TPHA0N008505.230ON6701481050.001
TBLA0D031705.230ON7651501040.001
SAKL0G12100g5.230ON73873960.012
TPHA0F024306.31ON79850840.32
KLLA0E04533g7.222ON42181820.44
TBLA0B015507.222ON39481810.68
SAKL0F08184g7.222ON41281791.0
ZYRO0D16544g7.222ON42282791.2
Kwal_47.181517.222ON41481781.5
TBLA0E049804.385ON791133781.6
Kwal_56.224766.31ON697507110.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= SAKL0E14872g
         (1140 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SAKL0E14872g Chr5 (1231857..1235279) [3423 bp, 1140 aa] {ON} sim...  2100   0.0  
Kwal_55.19707 s55 complement(89757..93188) [3432 bp, 1143 aa] {O...  1253   0.0  
KLLA0A00638g Chr1 complement(60378..63845) [3468 bp, 1155 aa] {O...  1235   0.0  
ZYRO0G06644g Chr7 complement(528671..532171) [3501 bp, 1166 aa] ...  1167   0.0  
KAFR0D02240 Chr4 complement(450837..454400) [3564 bp, 1187 aa] {...  1159   0.0  
TDEL0B02210 Chr2 complement(396111..399398) [3288 bp, 1095 aa] {...  1127   0.0  
Kpol_2001.74 s2001 (202108..205449) [3342 bp, 1113 aa] {ON} (202...  1114   0.0  
Skud_9.21 Chr9 complement(46872..50537) [3666 bp, 1221 aa] {ON} ...  1092   0.0  
AFR284W Chr6 (947118..950429) [3312 bp, 1103 aa] {ON} Syntenic h...  1066   0.0  
Ecym_4020 Chr4 complement(49684..53061) [3378 bp, 1125 aa] {ON} ...  1036   0.0  
TPHA0D04590 Chr4 (1001887..1005270) [3384 bp, 1127 aa] {ON} Anc_...  1035   0.0  
NCAS0G00250 Chr7 complement(40367..43918) [3552 bp, 1183 aa] {ON...   979   0.0  
KNAG0L02110 Chr12 (376096..379698) [3603 bp, 1200 aa] {ON} Anc_5...   975   0.0  
Kpol_1043.68 s1043 (141962..145090) [3129 bp, 1042 aa] {ON} (141...   966   0.0  
Smik_9.22 Chr9 complement(47449..51141) [3693 bp, 1230 aa] {ON} ...   957   0.0  
YIL147C Chr9 complement(69791..73453) [3663 bp, 1220 aa] {ON}  S...   953   0.0  
Suva_9.41 Chr9 complement(64510..68166) [3657 bp, 1219 aa] {ON} ...   947   0.0  
TPHA0E00250 Chr5 complement(34875..38081) [3207 bp, 1068 aa] {ON...   935   0.0  
TBLA0E02100 Chr5 (513016..516438) [3423 bp, 1140 aa] {ON} Anc_5....   838   0.0  
KLTH0E01100g Chr5 complement(106377..109910) [3534 bp, 1177 aa] ...   808   0.0  
NDAI0F00310 Chr6 complement(66930..70709) [3780 bp, 1259 aa] {ON...   518   e-163
TBLA0I01680 Chr9 (372270..375914) [3645 bp, 1214 aa] {ON} Anc_5....   501   e-157
CAGL0H06567g Chr8 (645707..649216) [3510 bp, 1169 aa] {ON} simil...   226   5e-60
ADL388W Chr4 (30355..31803) [1449 bp, 482 aa] {ON} Syntenic homo...    69   2e-11
Ecym_7474 Chr7 (967242..968732) [1491 bp, 496 aa] {ON} similar t...    69   3e-11
KNAG0M00180 Chr13 complement(22500..24347) [1848 bp, 615 aa] {ON...    67   2e-10
KAFR0B06990 Chr2 (1455520..1457157) [1638 bp, 545 aa] {ON} Anc_4...    67   2e-10
NCAS0A06450 Chr1 (1273459..1275288) [1830 bp, 609 aa] {ON} Anc_4...    66   3e-10
KLLA0A10219g Chr1 (896931..898358) [1428 bp, 475 aa] {ON} simila...    65   7e-10
SAKL0B12408g Chr2 (1065161..1066558) [1398 bp, 465 aa] {ON} simi...    64   8e-10
CAGL0F09097g Chr6 (898706..900598) [1893 bp, 630 aa] {ON} simila...    65   8e-10
TDEL0D00320 Chr4 complement(53243..54886) [1644 bp, 547 aa] {ON}...    64   2e-09
TBLA0A10700 Chr1 (2646036..2647799) [1764 bp, 587 aa] {ON} Anc_4...    64   2e-09
ZYRO0G00484g Chr7 complement(35793..37736) [1944 bp, 647 aa] {ON...    63   3e-09
Kpol_265.2 s265 (9842..11491) [1650 bp, 549 aa] {ON} (9842..1149...    62   4e-09
Smik_8.296 Chr8 (487452..489329) [1878 bp, 625 aa] {ON} YHR206W ...    62   4e-09
Suva_15.412 Chr15 (719438..721291) [1854 bp, 617 aa] {ON} YHR206...    62   5e-09
Skud_8.273 Chr8 (481627..483498) [1872 bp, 623 aa] {ON} YHR206W ...    62   5e-09
NDAI0D03430 Chr4 (809977..811770) [1794 bp, 597 aa] {ON} Anc_4.385     62   5e-09
YHR206W Chr8 (512732..514600) [1869 bp, 622 aa] {ON}  SKN7Nuclea...    62   6e-09
KLTH0D17182g Chr4 complement(1424948..1426342) [1395 bp, 464 aa]...    61   1e-08
TPHA0C00150 Chr3 complement(15029..16561) [1533 bp, 510 aa] {ON}...    60   2e-08
CAGL0D02882g Chr4 complement(300025..302028) [2004 bp, 667 aa] {...    59   8e-08
Kwal_47.16770 s47 (103208..104593) [1386 bp, 461 aa] {ON} YHR206...    58   9e-08
KAFR0J00700 Chr10 (127858..129720) [1863 bp, 620 aa] {ON} Anc_5....    56   4e-07
Suva_10.84 Chr10 complement(167272..169359) [2088 bp, 695 aa] {O...    55   1e-06
Ecym_5077 Chr5 (166792..169179) [2388 bp, 795 aa] {ON} similar t...    55   1e-06
KNAG0B05140 Chr2 (985361..987307) [1947 bp, 648 aa] {ON} Anc_5.2...    54   2e-06
YLR006C Chr12 complement(161755..163893) [2139 bp, 712 aa] {ON} ...    54   2e-06
Skud_12.72 Chr12 complement(153012..155120) [2109 bp, 702 aa] {O...    52   6e-06
ZYRO0A11154g Chr1 (893793..896123) [2331 bp, 776 aa] {ON} simila...    52   8e-06
Smik_12.68 Chr12 complement(148821..150959) [2139 bp, 712 aa] {O...    52   1e-05
TDEL0E03980 Chr5 (741644..743836) [2193 bp, 730 aa] {ON} Anc_5.2...    52   1e-05
KLLA0E09505g Chr5 (840647..842554) [1908 bp, 635 aa] {ON} weakly...    51   2e-05
NCAS0D02900 Chr4 complement(551013..553301) [2289 bp, 762 aa] {O...    51   2e-05
ADR343C Chr4 complement(1311984..1314233) [2250 bp, 749 aa] {ON}...    50   2e-05
Kpol_1004.4 s1004 complement(9754..11898) [2145 bp, 714 aa] {ON}...    49   7e-05
NDAI0I02000 Chr9 complement(464492..467164) [2673 bp, 890 aa] {O...    47   3e-04
Kwal_33.15288 s33 complement(1045147..1046910) [1764 bp, 587 aa]...    47   3e-04
KLTH0B02684g Chr2 (207260..209047) [1788 bp, 595 aa] {ON} some s...    45   9e-04
TPHA0N00850 Chr14 complement(189011..191023) [2013 bp, 670 aa] {...    45   0.001
TBLA0D03170 Chr4 complement(771345..773642) [2298 bp, 765 aa] {O...    45   0.001
SAKL0G12100g Chr7 (1029250..1031466) [2217 bp, 738 aa] {ON} weak...    42   0.012
TPHA0F02430 Chr6 complement(535865..538261) [2397 bp, 798 aa] {O...    37   0.32 
KLLA0E04533g Chr5 (408415..409680) [1266 bp, 421 aa] {ON} simila...    36   0.44 
TBLA0B01550 Chr2 (340204..341388) [1185 bp, 394 aa] {ON} Anc_7.2...    36   0.68 
SAKL0F08184g Chr6 (623521..624759) [1239 bp, 412 aa] {ON} simila...    35   1.0  
ZYRO0D16544g Chr4 (1373180..1374448) [1269 bp, 422 aa] {ON} simi...    35   1.2  
Kwal_47.18151 s47 (709368..710612) [1245 bp, 414 aa] {ON} YIL042...    35   1.5  
TBLA0E04980 Chr5 (1275927..1278302) [2376 bp, 791 aa] {ON} Anc_4...    35   1.6  
Kwal_56.22476 s56 complement(145039..147132) [2094 bp, 697 aa] {...    32   10.0 

>SAKL0E14872g Chr5 (1231857..1235279) [3423 bp, 1140 aa] {ON} similar
            to uniprot|P39928 Saccharomyces cerevisiae YIL147C SLN1
            Histidine kinase osmosensor that regulates a MAP kinase
            cascade; transmembrane protein with an intracellular
            kinase domain that signals to Ypd1p and Ssk1p, thereby
            forming a phosphorelay system similar to bacterial
            two-component regulators
          Length = 1140

 Score = 2100 bits (5440), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1034/1140 (90%), Positives = 1034/1140 (90%)

Query: 1    MTVIGHLRSKLKPPFKVGIRTQXXXXXXXXXXXXXXXXXXTTGVYFTANYKSLRADRLHV 60
            MTVIGHLRSKLKPPFKVGIRTQ                  TTGVYFTANYKSLRADRLHV
Sbjct: 1    MTVIGHLRSKLKPPFKVGIRTQLIALVCVVALLSLVILAVTTGVYFTANYKSLRADRLHV 60

Query: 61   AAQLKSSQIDQNLNYLYYQCYWLSTRDTLQDSLIRYRAGNTTKENWSEAEIVLEKFLGSS 120
            AAQLKSSQIDQNLNYLYYQCYWLSTRDTLQDSLIRYRAGNTTKENWSEAEIVLEKFLGSS
Sbjct: 61   AAQLKSSQIDQNLNYLYYQCYWLSTRDTLQDSLIRYRAGNTTKENWSEAEIVLEKFLGSS 120

Query: 121  DLFSVARIYDSTFKTVLNATNNGSGNLVPEHVLTNLFPLSTDDPLASSLQTSGILTDPVL 180
            DLFSVARIYDSTFKTVLNATNNGSGNLVPEHVLTNLFPLSTDDPLASSLQTSGILTDPVL
Sbjct: 121  DLFSVARIYDSTFKTVLNATNNGSGNLVPEHVLTNLFPLSTDDPLASSLQTSGILTDPVL 180

Query: 181  NDTVYVMSMSLPIFASPSIMLTNSEISGYITVVMSAESLKIVFNDTTALDKSDVAILSAE 240
            NDTVYVMSMSLPIFASPSIMLTNSEISGYITVVMSAESLKIVFNDTTALDKSDVAILSAE
Sbjct: 181  NDTVYVMSMSLPIFASPSIMLTNSEISGYITVVMSAESLKIVFNDTTALDKSDVAILSAE 240

Query: 241  YSNQSLPVSYHFVFPPHGVGADIIDYSFTIENGSFIQSAFDDRKSGSVKRTSFFYGKDVA 300
            YSNQSLPVSYHFVFPPHGVGADIIDYSFTIENGSFIQSAFDDRKSGSVKRTSFFYGKDVA
Sbjct: 241  YSNQSLPVSYHFVFPPHGVGADIIDYSFTIENGSFIQSAFDDRKSGSVKRTSFFYGKDVA 300

Query: 301  VGYSPCLFKQVQWVAVISQPENVFLSPSTRLTNIIIGTALGIAVFMCLVTFPLAHWAVKP 360
            VGYSPCLFKQVQWVAVISQPENVFLSPSTRLTNIIIGTALGIAVFMCLVTFPLAHWAVKP
Sbjct: 301  VGYSPCLFKQVQWVAVISQPENVFLSPSTRLTNIIIGTALGIAVFMCLVTFPLAHWAVKP 360

Query: 361  IVRLQKATEIITARRGLRSYNQSAPASRTNSFRKRPSTSSSIGSVFRTITDRPHERDNGH 420
            IVRLQKATEIITARRGLRSYNQSAPASRTNSFRKRPSTSSSIGSVFRTITDRPHERDNGH
Sbjct: 361  IVRLQKATEIITARRGLRSYNQSAPASRTNSFRKRPSTSSSIGSVFRTITDRPHERDNGH 420

Query: 421  SNFELHHRTSNSVDSQEARMELEISGALPDTNPTTPTSYTNDQHSYKSDNFVNSTNLIDA 480
            SNFELHHRTSNSVDSQEARMELEISGALPDTNPTTPTSYTNDQHSYKSDNFVNSTNLIDA
Sbjct: 421  SNFELHHRTSNSVDSQEARMELEISGALPDTNPTTPTSYTNDQHSYKSDNFVNSTNLIDA 480

Query: 481  RVPVYGRLFSDELSELTDTFNTMTDELDRHYALLEDRVRARTKQLXXXXXXXXXXXXXKT 540
            RVPVYGRLFSDELSELTDTFNTMTDELDRHYALLEDRVRARTKQL             KT
Sbjct: 481  RVPVYGRLFSDELSELTDTFNTMTDELDRHYALLEDRVRARTKQLEAAKIEAEAANEAKT 540

Query: 541  VFIANISHELRTPLNGILGMTAISMAEKDMQKVQNSLKLIFRSGXXXXXXXXXXXXFSKN 600
            VFIANISHELRTPLNGILGMTAISMAEKDMQKVQNSLKLIFRSG            FSKN
Sbjct: 541  VFIANISHELRTPLNGILGMTAISMAEKDMQKVQNSLKLIFRSGELLLHILTELLTFSKN 600

Query: 601  VLQRTKLEERNFAIMDVALQVKSIFGKLAKDQHVNLSIILSPNVIRTMILWGDSNRIIQI 660
            VLQRTKLEERNFAIMDVALQVKSIFGKLAKDQHVNLSIILSPNVIRTMILWGDSNRIIQI
Sbjct: 601  VLQRTKLEERNFAIMDVALQVKSIFGKLAKDQHVNLSIILSPNVIRTMILWGDSNRIIQI 660

Query: 661  VMNLVSNALKFSPVDGKVGVRIKLLGEYDGKKSKDSNYNDVFIKPGTEIPDASASKSSLS 720
            VMNLVSNALKFSPVDGKVGVRIKLLGEYDGKKSKDSNYNDVFIKPGTEIPDASASKSSLS
Sbjct: 661  VMNLVSNALKFSPVDGKVGVRIKLLGEYDGKKSKDSNYNDVFIKPGTEIPDASASKSSLS 720

Query: 721  TLEYTKVDAIQRRLASKSSDSQKLKEEPIASSDVSSSDGKDESEAXXXXXXXKRXXXXXX 780
            TLEYTKVDAIQRRLASKSSDSQKLKEEPIASSDVSSSDGKDESEA       KR      
Sbjct: 721  TLEYTKVDAIQRRLASKSSDSQKLKEEPIASSDVSSSDGKDESEADTDTDTDKRSNSEIS 780

Query: 781  XXXXXXXXXXXXYDDAILHAQLRKVPSCGNGEDSGDSLGRKLEISKTWVIAIEVEDTGPG 840
                        YDDAILHAQLRKVPSCGNGEDSGDSLGRKLEISKTWVIAIEVEDTGPG
Sbjct: 781  DSLSLVSSNNSSYDDAILHAQLRKVPSCGNGEDSGDSLGRKLEISKTWVIAIEVEDTGPG 840

Query: 841  IEPALHESVFEPFVQGDQTLSRQYGGTGLGLSICRQLAKMMKGTMKLESKVGVGSKFTFT 900
            IEPALHESVFEPFVQGDQTLSRQYGGTGLGLSICRQLAKMMKGTMKLESKVGVGSKFTFT
Sbjct: 841  IEPALHESVFEPFVQGDQTLSRQYGGTGLGLSICRQLAKMMKGTMKLESKVGVGSKFTFT 900

Query: 901  VPLTQTREVSFDDVENPFEDEFNAHSXXXXXXXXXXXXXSGGSKSRPSVNTSLNSGTDST 960
            VPLTQTREVSFDDVENPFEDEFNAHS             SGGSKSRPSVNTSLNSGTDST
Sbjct: 901  VPLTQTREVSFDDVENPFEDEFNAHSKKNRKVKFKMNKNSGGSKSRPSVNTSLNSGTDST 960

Query: 961  AEKMALXXXXXXXXXXXXDRPFLQXXXXXXXXXXXXXVKSLERPFKILVAEDNNVNQEVV 1020
            AEKMAL            DRPFLQ             VKSLERPFKILVAEDNNVNQEVV
Sbjct: 961  AEKMALSESEVSVGSVRVDRPFLQSTGTATSTRSITTVKSLERPFKILVAEDNNVNQEVV 1020

Query: 1021 KRMLNLEGLSDIDLACDGQEAFDKVKALQEANDHYRIIFMDVQMPRVDGLLSTKMIRQEL 1080
            KRMLNLEGLSDIDLACDGQEAFDKVKALQEANDHYRIIFMDVQMPRVDGLLSTKMIRQEL
Sbjct: 1021 KRMLNLEGLSDIDLACDGQEAFDKVKALQEANDHYRIIFMDVQMPRVDGLLSTKMIRQEL 1080

Query: 1081 RYSHPIVALTAFADDSNIKVCLDSGMNGFLSKPIKRPKLKSVLSEFCPDFVEKRNSNKAK 1140
            RYSHPIVALTAFADDSNIKVCLDSGMNGFLSKPIKRPKLKSVLSEFCPDFVEKRNSNKAK
Sbjct: 1081 RYSHPIVALTAFADDSNIKVCLDSGMNGFLSKPIKRPKLKSVLSEFCPDFVEKRNSNKAK 1140

>Kwal_55.19707 s55 complement(89757..93188) [3432 bp, 1143 aa] {ON}
            YIL147C (SLN1) - histidine kinase osmosensor that
            regulates an osmosensing MAP kinase cascade and is
            similar to bacterial two-component regulators [contig
            159] FULL
          Length = 1143

 Score = 1253 bits (3243), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 657/1168 (56%), Positives = 793/1168 (67%), Gaps = 87/1168 (7%)

Query: 7    LRSKLKPPFKVGIRTQXXXXXXXXXXXXXXXXXXTTGVYFTANYKSLRADRLHVAAQLKS 66
             + +L+ P  V IRTQ                   TGVYFT+++KSLRA+RLHVAAQLKS
Sbjct: 13   FQRRLRRPLVVSIRTQLTALVCLVALLSLIILAVITGVYFTSSFKSLRAERLHVAAQLKS 72

Query: 67   SQIDQNLNYLYYQCYWLSTRDTLQDSLIRYRAGNTTKENWSEAEIVLEKFLGSSDLFSVA 126
            SQIDQNLNYLYYQCYWLSTRD LQ++L +Y AGNT+ ENWS+A   L+KFLGSS+LFS+A
Sbjct: 73   SQIDQNLNYLYYQCYWLSTRDILQNALTQYLAGNTSTENWSDASTTLDKFLGSSNLFSLA 132

Query: 127  RIYDSTFKTVLNATNNGSGNLVPEHVLTNLFPLSTDDPLASSLQTSGILTDPVLNDTVYV 186
            R+YDS+F+ VLN +NNGSGNL+PE++LT LFPLSTD  L SSL+ +G+LTDPVLN +VY+
Sbjct: 133  RVYDSSFQDVLNVSNNGSGNLIPENLLTQLFPLSTDVALPSSLERTGMLTDPVLNGSVYL 192

Query: 187  MSMSLPIFASPSIMLTNSEISGYITVVMSAESLKIVFNDTTALDKSDVAILSAEYSNQSL 246
            MSMSLPIFA+PSI+L+ +++ GYITVV+SAE LK V+NDTTALD S V I+S  Y +  L
Sbjct: 193  MSMSLPIFANPSIILSTAKVYGYITVVISAEGLKSVYNDTTALDDSSVIIVSTVYDDHEL 252

Query: 247  PVSYHFVFPPHGVGADIIDYSFTIENGSFIQSAFDDRKSGSVKRTSFFYGKDVAVGYSPC 306
               YH VFPP+ +  D+I+  + IENGSF++ A  D K GS+K T FF  K +AVGYSPC
Sbjct: 253  -AGYHLVFPPYNMYPDVINEHYQIENGSFLEDAIKDGKGGSIKSTRFFNNKKIAVGYSPC 311

Query: 307  LFKQVQWVAVISQPENVFLSPSTRLTNIIIGTALGIAVFMCLVTFPLAHWAVKPIVRLQK 366
                 QWVA+I+QPE +FLSPSTRL  II+GT + IAV  C+VTFPL+HWAV+PIVRLQK
Sbjct: 312  NSTLAQWVAIITQPEAIFLSPSTRLAKIIVGTCIAIAVVTCVVTFPLSHWAVQPIVRLQK 371

Query: 367  ATEIITARRGLRSYNQSAPASRTNSFRKRPSTSSSIGSVFRT-----------------I 409
            ATEIITA RGLRS N S   S      KR ST+ S  S+F T                 I
Sbjct: 372  ATEIITAGRGLRSDNSSTLFSH-----KRTSTAESFSSIFGTGSVRRSGSVARAGRDKYI 426

Query: 410  TDRPHERDNGHSNFELHHRTSNSVDSQEARMELEISGALPDTNPTTPTSYTNDQHSYKSD 469
             D   E   G+S+  +H     +++  E          +   N  TP S  N+  + KS+
Sbjct: 427  PDSSKEVPRGNSSDAIHEVNQENIEDIE----------MQKVNSPTPYSMMNESQAVKSE 476

Query: 470  NFVNSTNLIDARVPVYGRLFSDELSELTDTFNTMTDELDRHYALLEDRVRARTKQLXXXX 529
             ++ STNLI+ARVPVY RLFSDELSELT+TFNTMTDELDRHYALLEDRVRART+QL    
Sbjct: 477  RYITSTNLIEARVPVYKRLFSDELSELTETFNTMTDELDRHYALLEDRVRARTRQLEAAK 536

Query: 530  XXXXXXXXXKTVFIANISHELRTPLNGILGMTAISMAEKDMQKVQNSLKLIFRSGXXXXX 589
                     KTVFIANISHELRTPLNGILGMTAI+MAE+D  KV++SLKLIFRSG     
Sbjct: 537  IEAEGANEAKTVFIANISHELRTPLNGILGMTAIAMAEEDTAKVKSSLKLIFRSGELLLH 596

Query: 590  XXXXXXXFSKNVLQRTKLEERNFAIMDVALQVKSIFGKLAKDQHVNLSIILSPNVIRTMI 649
                   FSKNVL+RTKLEER+F I+D+ALQV+SIFGKLAKDQHVNL+I + PN++R+M+
Sbjct: 597  IMTELLTFSKNVLKRTKLEERDFQIVDIALQVESIFGKLAKDQHVNLTISILPNLLRSMV 656

Query: 650  LWGDSNRIIQIVMNLVSNALKFSPVDGKVGVRIKLLGEYDGKKSKDSNYNDVFIKPGTEI 709
            LWGDSNRI+QIVMNLVSNALKF+PVDGKV V+ +LLGEYD +KSK S Y +VF+ P TE 
Sbjct: 657  LWGDSNRIVQIVMNLVSNALKFTPVDGKVDVKFRLLGEYDEEKSKASEYKEVFVLPPTES 716

Query: 710  PDASASKSSLSTLEYTKVDAIQRRLA----SKSSDSQKLK------EEPIASSDVSSSDG 759
              +S         E + VD+    L+    ++S+D + +K       E I S  + SSD 
Sbjct: 717  RTSSTEAKDEKNAE-SCVDSDTNVLSLPSTAESTDEKNVKIGQRSESEAIDSEAIESSDE 775

Query: 760  KDESEAXXXXXXXKRXXXXXXXXXXXXXXXXXXYDDAILHAQLRKVPSCGNGEDSGDSLG 819
             DE+E                            YDDAI   +LRK  S    E+     G
Sbjct: 776  DDENE----------------DTKSIGSGNTSSYDDAIFQTRLRKDSSNEENEE-----G 814

Query: 820  RKLEISKTWVIAIEVEDTGPGIEPALHESVFEPFVQGDQTLSRQYGGTGLGLSICRQLAK 879
            R LE  K WVI++EV DTGPGI+PALHESVFEPFVQGDQTLSRQYGGTGLGLSICRQLA 
Sbjct: 815  RALESPKKWVISMEVHDTGPGIDPALHESVFEPFVQGDQTLSRQYGGTGLGLSICRQLAT 874

Query: 880  MMKGTMKLESKVGVGSKFTFTVPLTQTREVSFDDVENPFEDEFN-------------AHS 926
            MM GTMKL+S+VGVGSKF+FTVPLTQT+E+ F+DVENPFEDEFN               S
Sbjct: 875  MMHGTMKLDSQVGVGSKFSFTVPLTQTKELLFEDVENPFEDEFNPDSKKNRKVKFRMGKS 934

Query: 927  XXXXXXXXXXXXXSGGSKSRPSVNTSLNSGTDSTAEKMALXXXXXXXXXXXXDRPFLQXX 986
                          G   + P V  S  +   + +E                DRPFLQ  
Sbjct: 935  NKRSKSRSESSGTEGNGGNSPGVEGSGGNSPGTGSE--------VSVGSVRVDRPFLQST 986

Query: 987  XXXXXXXXXXXVKSLERPFKILVAEDNNVNQEVVKRMLNLEGLSDIDLACDGQEAFDKVK 1046
                         SL    KILVAEDNNVNQEV+KRMLNLEGL D++LACDGQ+AFDKVK
Sbjct: 987  GTALSTTLVT-TSSLADRRKILVAEDNNVNQEVIKRMLNLEGLEDVELACDGQDAFDKVK 1045

Query: 1047 ALQEANDHYRIIFMDVQMPRVDGLLSTKMIRQELRYSHPIVALTAFADDSNIKVCLDSGM 1106
            A      HY +IFMDVQMPRVDGL +T+MIR+EL YSHPIVALTAFADDSNIK CLD+GM
Sbjct: 1046 AQDATGKHYDLIFMDVQMPRVDGLTATRMIRKELGYSHPIVALTAFADDSNIKECLDAGM 1105

Query: 1107 NGFLSKPIKRPKLKSVLSEFCPDFVEKR 1134
            NGFLSKPIKRPK+K++L E+CP  ++++
Sbjct: 1106 NGFLSKPIKRPKIKAILKEYCPRPIDEK 1133

>KLLA0A00638g Chr1 complement(60378..63845) [3468 bp, 1155 aa] {ON}
            similar to uniprot|P39928 Saccharomyces cerevisiae
            YIL147C SLN1 Histidine kinase osmosensor that regulates a
            MAP kinase cascade; transmembrane protein with an
            intracellular kinase domain that signals to Ypd1p and
            Ssk1p, thereby forming a phosphorelay system similar to
            bacterial two-component regulators
          Length = 1155

 Score = 1235 bits (3195), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 636/1143 (55%), Positives = 786/1143 (68%), Gaps = 32/1143 (2%)

Query: 7    LRSKLKPPFKVGIRTQXXXXXXXXXXXXXXXXXXTTGVYFTANYKSLRADRLHVAAQLKS 66
            LR +  PPF VG+RTQ                  TTGVYFT NYKS+RA+RL VAAQLKS
Sbjct: 14   LRERFTPPFNVGLRTQLIILVCSICVLSLTIITVTTGVYFTTNYKSVRAERLQVAAQLKS 73

Query: 67   SQIDQNLNYLYYQCYWLSTRDTLQDSLIRYRAGNTTKENWSEAEIVLEKFLGSSDLFSVA 126
            SQ+DQNLNYLYYQ YWLSTRDTLQD+L+ +RAGN++++NW+ AE  LEKFLGSS LFS A
Sbjct: 74   SQVDQNLNYLYYQIYWLSTRDTLQDALVNFRAGNSSRDNWNSAEDSLEKFLGSSGLFSAA 133

Query: 127  RIYDSTFKTVLNATNNGSGNLVPEHVLTNLFPLSTDDPLASSLQTSGILTDPVLNDTVYV 186
            R+YD++F TV+N+TNNGSG+ +PE+VL  LFPLS  +PL+SSL T+GI+TDPV N T Y+
Sbjct: 134  RVYDTSFNTVINSTNNGSGDNIPENVLAELFPLSGVEPLSSSLLTTGIVTDPVYNWTNYL 193

Query: 187  MSMSLPIFASPSIMLTNSEISGYITVVMSAESLKIVFNDTTALDKSDVAILSAEYSNQSL 246
            +SMSLP+  +PSI+L  +EI+GYITV+ SAESLK V NDT ALDKS V+ILSA + + S 
Sbjct: 194  LSMSLPVSTNPSIILNTNEIAGYITVIASAESLKAVVNDTIALDKSSVSILSAVFDSNSS 253

Query: 247  PVSYHFVFPPHGVGADIIDYSFTIENGSFIQSAFDDRKSGSVKRTSFFYGKDVAVGYSPC 306
               YHFVFPPHG  +     +F I+NG+FI  AF++ K GSV +T+    +++AVGYSP 
Sbjct: 254  LTGYHFVFPPHGTSSFSSKVTFPIKNGTFIADAFENGKVGSVMKTNMVQERNIAVGYSPP 313

Query: 307  LFKQVQWVAVISQPENVFLSPSTRLTNIIIGTALGIAVFMCLVTFPLAHWAVKPIVRLQK 366
             FK V WVAV++QPE VFLSP+ RL  II GT   IAVFMCL+TFP+AHWAV+PIVRLQK
Sbjct: 314  TFKLVNWVAVVTQPEQVFLSPTIRLMKIIAGTVCAIAVFMCLLTFPIAHWAVQPIVRLQK 373

Query: 367  ATEIITARRGLRSY----NQSAPASRTNSFRKRPSTSSSIGSVF-RTITD-RPHERDNGH 420
            ATEIIT+ R L+ Y    N  +  + T+S  +  S  + +  +F +++T   P    N +
Sbjct: 374  ATEIITSGRDLKHYSNTGNSDSNTAITHSRTRSTSNQNQVMKLFNKSVTKGTPSNYLNHN 433

Query: 421  SNFELHHRT-SNSVDSQEARMELEISGALPDTNPTTPTSYTNDQHSYKSDNFVNSTNLID 479
             N     RT S SV ++ ++      G L  +  T  T ++ND  SY S+ ++ STNL++
Sbjct: 434  YNVFPPSRTDSPSVSARNSQTIPRGPGDLTRSATTGSTPFSNDSSSYTSERYIKSTNLVE 493

Query: 480  ARVPVYGRLFSDELSELTDTFNTMTDELDRHYALLEDRVRARTKQLXXXXXXXXXXXXXK 539
            A VPVY R F DELSELTDTFNTMTDELDRHYALLE+RVRARTKQL             K
Sbjct: 494  AYVPVYRRFFQDELSELTDTFNTMTDELDRHYALLEERVRARTKQLEAAKIQAESANEAK 553

Query: 540  TVFIANISHELRTPLNGILGMTAISMAEKDMQKVQNSLKLIFRSGXXXXXXXXXXXXFSK 599
            TVFIANISHELRTPLNGILGMTAI+MAE DMQKVQNSLKLIFRSG            FSK
Sbjct: 554  TVFIANISHELRTPLNGILGMTAIAMAETDMQKVQNSLKLIFRSGELLLHILTELLTFSK 613

Query: 600  NVLQRTKLEERNFAIMDVALQVKSIFGKLAKDQHVNLSIILSPNVIRTMILWGDSNRIIQ 659
            NVL+RTKLEER+F++MD+ALQ+KSIFGKLAKDQHV LSI L+PN IRT++LWGDSNRIIQ
Sbjct: 614  NVLKRTKLEERDFSVMDIALQIKSIFGKLAKDQHVKLSIALTPNFIRTLVLWGDSNRIIQ 673

Query: 660  IVMNLVSNALKFSPVDGKVGVRIKLLGEYDGKKSKDSNYNDVFIKPGTEIPDASASKSSL 719
            IVMNLVSNALKF+PVDGKV VRIKLLGEYD K+S+  +Y +VF+ PG+E  D        
Sbjct: 674  IVMNLVSNALKFTPVDGKVDVRIKLLGEYDSKRSESVDYQEVFVVPGSEAND-------- 725

Query: 720  STLEYTKVDAIQRRLASKSSD--------------SQKLKEEPIASSDVSSSDGKDESEA 765
               E+        RL   SS               + K KE  I     +S++G D  E+
Sbjct: 726  -DFEFNLTSTTPMRLPFNSSSGSVNTATKDGSTSPTTKTKEGSIQVESETSTEGNDNDES 784

Query: 766  XXX-XXXXKRXXXXXXXXXXXXXXXXXXYDDAILHAQLRKVPSCGNGEDSGDSLGRKLEI 824
                    +                   YDDAI H+Q +KV S  +  D+ ++  R L++
Sbjct: 785  SIVLESKHEENEDEKEKMSILSTSTSSSYDDAIFHSQFKKVLSSTDS-DTEENTFRDLKV 843

Query: 825  SKTWVIAIEVEDTGPGIEPALHESVFEPFVQGDQTLSRQYGGTGLGLSICRQLAKMMKGT 884
             KTWVI++EVEDTG GI+P+L ESVFEPFVQGDQTLSRQYGGTGLGLSICRQLAKMMKGT
Sbjct: 844  PKTWVISMEVEDTGSGIDPSLQESVFEPFVQGDQTLSRQYGGTGLGLSICRQLAKMMKGT 903

Query: 885  MKLESKVGVGSKFTFTVPLTQTREVSFDDVENPFEDEFNAHSXXXXXXXXXXXXXSGGSK 944
            MKL+SKVGVGSKF FTVPL QT+E+ FD  E  FEDEFN HS                 +
Sbjct: 904  MKLDSKVGVGSKFIFTVPLQQTKEIVFDGAEKQFEDEFNIHSRKNRKVKFKINSSRKSVQ 963

Query: 945  SRPSVNTSLNSGTDSTAEKMALXXXXXXXXXXXXDRPFLQXXXXXXXXXXXXXVKSLERP 1004
            ++ S ++      ++ +E+ A             DRPFLQ             V S    
Sbjct: 964  TKKSKSSIDGHSDNNVSERKASNSTENSVGNVRVDRPFLQSTGTATSTRSISSVASEVTR 1023

Query: 1005 FKILVAEDNNVNQEVVKRMLNLEGLSDIDLACDGQEAFDKVKALQEANDHYRIIFMDVQM 1064
             ++LVAEDNNVNQEV+KRML LEGL+D+D+ACDGQEA++KV+ + +  + Y +IFMDVQM
Sbjct: 1024 HRVLVAEDNNVNQEVIKRMLQLEGLTDLDMACDGQEAYEKVEEILKNGESYSMIFMDVQM 1083

Query: 1065 PRVDGLLSTKMIRQELRYSHPIVALTAFADDSNIKVCLDSGMNGFLSKPIKRPKLKSVLS 1124
            PRVDGLL+TKMIR +L Y  PIVALTA+ADDSNIKVCL+SGM+GFL KPIKRP LK +++
Sbjct: 1084 PRVDGLLATKMIRNDLLYKGPIVALTAYADDSNIKVCLESGMDGFLPKPIKRPLLKKIIA 1143

Query: 1125 EFC 1127
            ++C
Sbjct: 1144 QYC 1146

>ZYRO0G06644g Chr7 complement(528671..532171) [3501 bp, 1166 aa] {ON}
            similar to uniprot|P39928 Saccharomyces cerevisiae
            YIL147C SLN1 Histidine kinase osmosensor that regulates a
            MAP kinase cascade; transmembrane protein with an
            intracellular kinase domain that signals to Ypd1p and
            Ssk1p, thereby forming a phosphorelay system similar to
            bacterial two-component regulators
          Length = 1166

 Score = 1167 bits (3019), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 614/1125 (54%), Positives = 764/1125 (67%), Gaps = 33/1125 (2%)

Query: 10   KLKPPFKVGIRTQXXXXXXXXXXXXXXXXXXTTGVYFTANYKSLRADRLHVAAQLKSSQI 69
            K + P ++GIR Q                  +TGVYFT NYK+LR++RL++AAQLKS+QI
Sbjct: 10   KFQSPIRLGIRAQLTALVSIVALVSLIILAVSTGVYFTDNYKNLRSERLYMAAQLKSTQI 69

Query: 70   DQNLNYLYYQCYWLSTRDTLQDSLIRYRAGNTTKENWSEAEIVLEKFLGSSDLFSVARIY 129
            DQNLNY+YYQCYWLS+RDTLQ++L  Y AGN T  NW ++  V++KFL SS LFSVA IY
Sbjct: 70   DQNLNYMYYQCYWLSSRDTLQEALANYVAGNKTYANWVDSGNVIQKFLTSSGLFSVATIY 129

Query: 130  DSTFKTVLNATNNGSGNLVPEHVLTNLFPLSTDDPLASSLQTSGILTDPVLNDTVYVMSM 189
            D+TF  VL+ATNNG+GN +PE  L  L PLS + PL SSLQ+ GILT+PVLN T Y+MSM
Sbjct: 130  DATFTPVLSATNNGTGNHIPESTLDRLMPLSGNKPLPSSLQSEGILTNPVLNGTSYLMSM 189

Query: 190  SLPIFASPSIMLTNSEISGYITVVMSAESLKIVFNDTTALDKSDVAILSAEYSNQSLPVS 249
            SLPIFA+PSI+LT S + GYIT+VMSA+SLK VF+DTTAL+KS+VAILSA Y       S
Sbjct: 190  SLPIFANPSIILTTSHVYGYITIVMSADSLKNVFDDTTALEKSNVAILSAVYDQNETLSS 249

Query: 250  YHFVFPPHGVGADIIDYSFTIENGSFIQSAFDDRKSGSVKRTSFFYGKDVAVGYSPCLFK 309
            Y+FVF P GV + I+  +  I+NG+F+ SA    K G+++RT F Y K VAVGYSPC   
Sbjct: 250  YNFVFAPLGVPSSILAETIPIKNGTFLSSALRQGKGGALERTKFLYTKKVAVGYSPCSVV 309

Query: 310  QVQWVAVISQPENVFLSPSTRLTNIIIGTALGIAVFMCLVTFPLAHWAVKPIVRLQKATE 369
             V W+AV+ Q E VF+ P+T+LT II GT +GI VF+CLVTFPLAHWAVKPIVRLQKATE
Sbjct: 310  FVNWIAVVLQSEAVFMEPATKLTKIISGTVVGIGVFVCLVTFPLAHWAVKPIVRLQKATE 369

Query: 370  IITARRGLRSYNQSAPA---SRTNSFRKRPSTSSSIGSVFRTITDRPHERDNGHSNFELH 426
            +IT  RGLR+ +  A +   SR +SF  RPS   S  S+   +TD  +E+  GH   +LH
Sbjct: 370  LITEGRGLRASSPGAGSSNVSRRSSFFHRPSNCGS--SIRSRVTDNHNEK--GH---DLH 422

Query: 427  HRTSNSVDSQEARMELEISGALPDTNPTTPTSYTNDQHSYKSDNFVNSTNLIDARVPVYG 486
                     Q       ++G++  +   +  S  N+  S KS     S NLI+ARVPVY 
Sbjct: 423  GE-------QIQHGFFAMNGSINHSLAASIASSGNEALSDKSKGLTTSANLIEARVPVYR 475

Query: 487  RLFSDELSELTDTFNTMTDELDRHYALLEDRVRARTKQLXXXXXXXXXXXXXKTVFIANI 546
            R FSDELSELTDTFNTMTD LD+HYALLEDRVRART+QL             KTVFIANI
Sbjct: 476  RFFSDELSELTDTFNTMTDALDQHYALLEDRVRARTRQLEAAKIDAEAANEAKTVFIANI 535

Query: 547  SHELRTPLNGILGMTAISMAEKDMQKVQNSLKLIFRSGXXXXXXXXXXXXFSKNVLQRTK 606
            SHELRTPLNGILGMTAISM E+D+ K+QNSLKLIFRSG            FSKNVL+RTK
Sbjct: 536  SHELRTPLNGILGMTAISMEERDIDKIQNSLKLIFRSGELLLHILTELLTFSKNVLKRTK 595

Query: 607  LEERNFAIMDVALQVKSIFGKLAKDQHVNLSIILSPNVIRTMILWGDSNRIIQIVMNLVS 666
            LE+RNF++ DVALQ+KSIFGK+AKDQ V LSI L PN+IRTM+L+GDSNRIIQIVMNLVS
Sbjct: 596  LEKRNFSVTDVALQIKSIFGKVAKDQRVRLSITLYPNLIRTMVLFGDSNRIIQIVMNLVS 655

Query: 667  NALKFSPVDGKVGVRIKLLGEYDGKKSKDSNYNDVFIKPGTEIPDAS--ASKSSLSTLEY 724
            NALKF+PVDGKV V + LLGEYD ++S++ N+  V++ PGTE P  +    K  +   E 
Sbjct: 656  NALKFTPVDGKVNVYMSLLGEYDAERSENENHKKVYVIPGTE-PKGNDEKDKGGIEEKER 714

Query: 725  TKVDAIQRRLASKSSDSQKLKEEPIASSDVSSSDGKDESEAXXXXXXXKRXXXXXXXXXX 784
              ++      +S SS+     E     +D       D+ +                    
Sbjct: 715  FSIENTPNDTSSNSSNKHSDTETTPGLNDTDEKQASDDMDGG-------EEDVEDADEVS 767

Query: 785  XXXXXXXXYDDAILHAQLRKVPSCGNGEDSGDSLGRKLEISKTWVIAIEVEDTGPGIEPA 844
                    Y+D + H+Q +K P     +DS + LG +++  K WVI+I VEDTGPGI+ +
Sbjct: 768  SFSTSTSSYNDTVFHSQFKKTPKV--CDDSSEELGVEVKDKKKWVISIVVEDTGPGIDSS 825

Query: 845  LHESVFEPFVQGDQTLSRQYGGTGLGLSICRQLAKMMKGTMKLESKVGVGSKFTFTVPLT 904
            LHESVFEPFVQGDQ LSRQYGGTGLGLSICRQLA MM GTM L+SK+GVGS+FTFTVPLT
Sbjct: 826  LHESVFEPFVQGDQALSRQYGGTGLGLSICRQLATMMNGTMDLKSKLGVGSRFTFTVPLT 885

Query: 905  QTREVSFDDVENPFEDEFNAHSXXXXXXXXXXXXXSGGSKSRPSVNTSLNSGTDSTAEKM 964
            QTRE++FDD+   FEDEFN  S                 +S+ S+ T +   + S+ + +
Sbjct: 886  QTREINFDDIPAAFEDEFNPDSKKNRKVKFKIAKSLKSKRSKSSLMT-VGPKSSSSDKSL 944

Query: 965  ALXXXXXXXXXXXXDRPFLQXXXXXXXXXXXXXVKSLERPFKILVAEDNNVNQEVVKRML 1024
            +             DRPFLQ               ++    KILVAEDN+VNQEV+KRML
Sbjct: 945  SQLKLTDSDRSVRLDRPFLQSTGTASSNTNLGTTSTIN---KILVAEDNDVNQEVIKRML 1001

Query: 1025 NLEGLSDIDLACDGQEAFDKVKALQEANDHYRIIFMDVQMPRVDGLLSTKMIRQELRYSH 1084
            NLEG+ +I+L CDGQEA DKVK L E  +HY +IFMDVQMP++DGLLSTKMIR++L Y+H
Sbjct: 1002 NLEGVHNIELVCDGQEALDKVKQLVENGEHYNLIFMDVQMPKMDGLLSTKMIRRDLNYTH 1061

Query: 1085 PIVALTAFADDSNIKVCLDSGMNGFLSKPIKRPKLKSVLSEFCPD 1129
            PIVALTAFADDSNI+ CLD+GM+GFL+KPIKR +L+ ++ EFCPD
Sbjct: 1062 PIVALTAFADDSNIRECLDAGMDGFLAKPIKRAQLRKIIEEFCPD 1106

>KAFR0D02240 Chr4 complement(450837..454400) [3564 bp, 1187 aa] {ON}
            Anc_5.700 YIL147C
          Length = 1187

 Score = 1159 bits (2999), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 625/1157 (54%), Positives = 773/1157 (66%), Gaps = 40/1157 (3%)

Query: 4    IGHLRSKLKPPFKVGIRTQXXXXXXXXXXXXXXXXXXTTGVYFTANYKSLRADRLHVAAQ 63
            + HL +K  PP+++ IRTQ                  TTGVYFT++YK+LRA+RL++AAQ
Sbjct: 18   LAHLNTK--PPYRISIRTQLIAVVSLVAILSLLILAVTTGVYFTSSYKNLRANRLYIAAQ 75

Query: 64   LKSSQIDQNLNYLYYQCYWLSTRDTLQDSLIRYRAGNTTKENWSEAEIVLEKFLGSSDLF 123
            LKSSQIDQ L YLYYQ YW+STRDTLQDSL  + AGN +  NW   E VLEKFL SSD F
Sbjct: 76   LKSSQIDQTLTYLYYQSYWISTRDTLQDSLANFVAGNKSSSNWESTESVLEKFLSSSDYF 135

Query: 124  SVARIYDSTFKTVLNATNNGSGNLVPEHVLTNLFPLSTDDPLASSLQTSGILTDPVLNDT 183
            S  ++YD  F TVL+ TNNG+GN +   VL  LFPLST+ PL+SSL+T+GILTDPVLN T
Sbjct: 136  SAVKVYDENFDTVLSVTNNGTGNQIAADVLEKLFPLSTNIPLSSSLETTGILTDPVLNGT 195

Query: 184  VYVMSMSLPIFASPSIMLTNSEISGYITVVMSAESLKIVFNDTTALDKSDVAILSAEYSN 243
             Y+MSMSLP+FA+PSI+L+ S + GYIT++M+A+ L  VFNDTTA++KS+VAI+SA Y+N
Sbjct: 196  SYLMSMSLPVFANPSIILSTSRVYGYITIIMTADGLLSVFNDTTAIEKSNVAIVSAVYNN 255

Query: 244  QSLPVSYHFVFPPHGVGADIIDYSFTIENGSFIQSAFDDRKSGSVKRTSFFYGKDVAVGY 303
            QS   +YH   PP+G  A + D +F ++N SF+  A    K GS+K+T F Y K VAVGY
Sbjct: 256  QSELDAYHLALPPYGFTASVTDINFQLKNSSFLNGALKQGKGGSIKKTHFLYNKAVAVGY 315

Query: 304  SPCLFKQVQWVAVISQPENVFLSPSTRLTNIIIGTALGIAVFMCLVTFPLAHWAVKPIVR 363
            SPC F+   WV+V+SQ E+VF  PST+LT II G  +GI+VF+ LVT PLA++AVKPIVR
Sbjct: 316  SPCSFELANWVSVVSQAESVFSGPSTKLTKIIAGVVVGISVFVMLVTLPLAYFAVKPIVR 375

Query: 364  LQKATEIITARRGLR-SYNQSAPASRTNSFRKRPSTSSSIGSVFR-TITDRPHERDNGHS 421
            L+KATEIIT  RGLR +   S   SRT+S R+  S  +SI S  + T T   +  +   +
Sbjct: 376  LKKATEIITEGRGLRPTTPGSGSVSRTSSMRREKSPRTSIVSSRKSTATGNSNSLNENSA 435

Query: 422  NFELHHR--TSNSV----DSQEARMELEISGALPD----TNPTTPTSYTNDQHSYKSDNF 471
            +   H    TS +V     S  +R+ + ++  L D    +   T T  +ND+ S +S + 
Sbjct: 436  SLSSHPMVLTSENVLVTNHSGLSRIPVNMNQELLDRASASTVNTLTIDSNDRLSERSKHL 495

Query: 472  VNSTNLIDARVPVYGRLFSDELSELTDTFNTMTDELDRHYALLEDRVRARTKQLXXXXXX 531
            +  TNL +ARVP+  +LF DELS+LT+TFNTMTD LD HY LLEDRVRARTKQL      
Sbjct: 496  ITFTNLTEARVPIARKLFFDELSDLTETFNTMTDALDEHYTLLEDRVRARTKQLEAAKIQ 555

Query: 532  XXXXXXXKTVFIANISHELRTPLNGILGMTAISMAEKDMQKVQNSLKLIFRSGXXXXXXX 591
                   KTVFIANISHELRTPLNGILGMTAISM E+D+ K+++SLKLIFRSG       
Sbjct: 556  AEAANEAKTVFIANISHELRTPLNGILGMTAISMEEEDITKIRSSLKLIFRSGELLLHIL 615

Query: 592  XXXXXFSKNVLQRTKLEERNFAIMDVALQVKSIFGKLAKDQHVNLSIILSPNVIRTMILW 651
                 FSKNVLQRTKLE+RNF I DVALQ+KSIFGK+AKDQHV LSIILSPN++RTM+L+
Sbjct: 616  TELLTFSKNVLQRTKLEKRNFCITDVALQMKSIFGKVAKDQHVRLSIILSPNIMRTMVLY 675

Query: 652  GDSNRIIQIVMNLVSNALKFSPVDGKVGVRIKLLGEYDGKKSKDSNYNDVFIKPGTEIPD 711
            GDSNRIIQ+VMNLVSNALKF+PVDGKV V+IKLLGEYD + SK+S +  V++K GTE   
Sbjct: 676  GDSNRIIQVVMNLVSNALKFTPVDGKVQVKIKLLGEYDEESSKNSKFEKVYVKGGTEFTS 735

Query: 712  ASASKSSLSTLEYTKVDAIQRRLASKSSDSQKLKEEPIASSDVSSSDGKDESEAXXXXXX 771
              A  ++LS  E T   A      S S   +KL   P A+   S SD  D SE       
Sbjct: 736  IPAELAALSKREST---AGSHFSGSSSHIKEKLDGIP-ANVFASDSDSDDPSEGTTINTS 791

Query: 772  XKRXXXXX--XXXXXXXXXXXXXYDDAILHAQLRKVPSCGNGEDSGDSLGRKLEISKTWV 829
             +R                    YDDAI ++Q +K P     ED   +LG +L   KTWV
Sbjct: 792  QQRTSSNEDYVDNISIASTSTSSYDDAIFNSQFKKTPDLYEDEDG--NLGEELSQQKTWV 849

Query: 830  IAIEVEDTGPGIEPALHESVFEPFVQGDQTLSRQYGGTGLGLSICRQLAKMMKGTMKLES 889
              IEV DTGPGI+ +L ESVFEPFVQGDQTLSRQYGGTGLGLSICRQLA MM GTM LES
Sbjct: 850  FRIEVIDTGPGIDSSLQESVFEPFVQGDQTLSRQYGGTGLGLSICRQLATMMNGTMTLES 909

Query: 890  KVGVGSKFTFTVPLTQTREVSFDDVENPFEDEFNAHSXXXXXXXXXXXXXSGGSKSRPSV 949
             VG GSKF FTVPLTQTR +  D+ E+P+EDEFN  S                 +SR S+
Sbjct: 910  TVGSGSKFIFTVPLTQTRVIKLDESEHPYEDEFNPKSKMNRKVKFNVARSINSRRSRSSL 969

Query: 950  NTSLNSGTDSTAEKMALXXXXXXXXXXXX------------------DRPFLQXXXXXXX 991
             TS +S   +  E+  L                              DRPFLQ       
Sbjct: 970  ITSNSSRIATVREESRLETRSNHSDVSTSNKNESASPQPESGSNLNLDRPFLQSTGTAIS 1029

Query: 992  XXXXXXVKSLERPFKILVAEDNNVNQEVVKRMLNLEGLSDIDLACDGQEAFDKVKALQEA 1051
                  V +L +   +LVAEDN+VNQEV+KRML+LEG+ +IDLACDGQ+AFD VK+L+E 
Sbjct: 1030 SANVPTVATLGKTLNVLVAEDNHVNQEVIKRMLSLEGVKNIDLACDGQDAFDNVKSLKER 1089

Query: 1052 NDHYRIIFMDVQMPRVDGLLSTKMIRQELRYSHPIVALTAFADDSNIKVCLDSGMNGFLS 1111
             + Y +IFMDVQMP+VDGL +TKMIR +L+Y HPIVALTAFADDSNIK CLD+GM+GFLS
Sbjct: 1090 GEFYDMIFMDVQMPKVDGLSATKMIRNDLKYEHPIVALTAFADDSNIKECLDAGMDGFLS 1149

Query: 1112 KPIKRPKLKSVLSEFCP 1128
            KPIKRP+LK++L E+CP
Sbjct: 1150 KPIKRPQLKTILLEYCP 1166

>TDEL0B02210 Chr2 complement(396111..399398) [3288 bp, 1095 aa] {ON}
            Anc_5.700 YIL147C
          Length = 1095

 Score = 1127 bits (2915), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 608/1130 (53%), Positives = 746/1130 (66%), Gaps = 58/1130 (5%)

Query: 8    RSKLKPPFKVGIRTQXXXXXXXXXXXXXXXXXXTTGVYFTANYKSLRADRLHVAAQLKSS 67
            + K  PPF++ IRTQ                  TTGVYFT+NYKSLR++RL+VAAQLKSS
Sbjct: 8    KEKFSPPFRISIRTQLTALVSLVALVSLIILAVTTGVYFTSNYKSLRSERLYVAAQLKSS 67

Query: 68   QIDQNLNYLYYQCYWLSTRDTLQDSLIRYRAGNTTKENWSEAEIVLEKFLGSSDLFSVAR 127
            QIDQNLNYLYYQCYWLS++ TLQ SL  Y +GN T  NW ++  VL+KFL SS LFSVAR
Sbjct: 68   QIDQNLNYLYYQCYWLSSQSTLQTSLANYVSGNKTDANWVDSSSVLQKFLSSSALFSVAR 127

Query: 128  IYDSTFKTVLNATNNGSGNLVPEHVLTNLFPLSTDDPLASSLQTSGILTDPVLNDTVYVM 187
            +YD+ F+TVLNATNNG+G+++ + VL  L PLS++  L +SL++ G+LTDPVLN T Y+M
Sbjct: 128  VYDADFQTVLNATNNGTGDVLGDDVLAKLMPLSSNMALPASLESEGMLTDPVLNGTSYLM 187

Query: 188  SMSLPIFASPSIMLTNSEISGYITVVMSAESLKIVFNDTTALDKSDVAILSAEYSNQSLP 247
            SMSLPI+A+PSI+LT S + GY+T++MSA+SLK V++D TAL+KS V I+SA Y      
Sbjct: 188  SMSLPIYANPSIILTESRVYGYVTIIMSADSLKSVYDDRTALEKSSVTIVSAIYKKDQGL 247

Query: 248  VSYHFVFPPHGVGADIIDYSFTIENGSFIQSAFDDRKSGSVKRTSFFYGKDVAVGYSPCL 307
             SY FVF P+G    I+D ++ I N SF+ +A    K+GS +RT  FY +  AVGYSPC 
Sbjct: 248  GSYRFVFAPYGTTPGILDETWPINNNSFLSAALRQGKAGSEQRTDLFYNRPSAVGYSPCS 307

Query: 308  FKQVQWVAVISQPENVFLSPSTRLTNIIIGTALGIAVFMCLVTFPLAHWAVKPIVRLQKA 367
            FK V WVA+ISQ E VF+ PSTRLT IIIG  +GI  F+C+ TFPLAHWAV+PIVRLQKA
Sbjct: 308  FKFVNWVAIISQSEAVFMEPSTRLTKIIIGVVVGIGAFVCIATFPLAHWAVQPIVRLQKA 367

Query: 368  TEIITARRGLRSYNQSAPASRTNSFRKRPSTSSSIGSVFRTITDRPHERDNGHSNFELHH 427
            TEIIT  RGLRS    + +   NS   R   S S      ++ D                
Sbjct: 368  TEIITEGRGLRSGTPGSSSVSRNSSFIRRRFSGSSSVRSPSLADE--------------- 412

Query: 428  RTSNSVDSQEARMELEISGALPDTNPTTPTSYTNDQHSYKSDNFVNSTNLIDARVPVYGR 487
                +V             A+P  N     S      S ++  ++ S+NL++ARVPVY  
Sbjct: 413  --KGAVGRASTEGSFNYDQAVPSLNSNAEIS------SDRTRKYMTSSNLVEARVPVYRI 464

Query: 488  LFSDELSELTDTFNTMTDELDRHYALLEDRVRARTKQLXXXXXXXXXXXXXKTVFIANIS 547
             FSDE SELTDTFNTMT+ LD+HYALLEDRVRARTKQL             KTVFIANIS
Sbjct: 465  FFSDEFSELTDTFNTMTNALDQHYALLEDRVRARTKQLEAAKVEAEAANEAKTVFIANIS 524

Query: 548  HELRTPLNGILGMTAISMAEKDMQKVQNSLKLIFRSGXXXXXXXXXXXXFSKNVLQRTKL 607
            HELRTPLNGILGMTAISM E+D+ K+Q+SLKLIFRSG            FSKNVLQRTKL
Sbjct: 525  HELRTPLNGILGMTAISMEERDIDKIQSSLKLIFRSGELLLHILTELLTFSKNVLQRTKL 584

Query: 608  EERNFAIMDVALQVKSIFGKLAKDQHVNLSIILSPNVIRTMILWGDSNRIIQIVMNLVSN 667
            E+R+F+I DVA+Q+KSIFGK+AKDQ V  SI L PN IR M+L+GDSNRIIQIVMNLVSN
Sbjct: 585  EKRDFSITDVAVQIKSIFGKVAKDQRVKFSITLFPNQIRKMVLYGDSNRIIQIVMNLVSN 644

Query: 668  ALKFSPVDGKVGVRIKLLGEYDGKKSKDSNYNDVFIKPGTE------IPDASASKSSLST 721
            ALKF+PVDGKV VR++LLGEYD ++S++ ++  V++  GTE      IP           
Sbjct: 645  ALKFTPVDGKVSVRMRLLGEYDKQRSENEDFKAVYVIDGTEPREDGLIPPPVKQFEKQED 704

Query: 722  LEYTKVDAIQRRLASKSSDSQKLKEEPIASSDVSSSDGKDESEAXXXXXXXKRXXXXXXX 781
            LE  K+        + +SDS+K   +   + D   SD  D+                   
Sbjct: 705  LEKEKISEKHNEEEASTSDSEKTNLDD-KTPDSKRSDADDQ------------------- 744

Query: 782  XXXXXXXXXXXYDDAILHAQLRKVPSCGNGEDSGDSLGRKLEISKTWVIAIEVEDTGPGI 841
                       YDD I H Q +K  S      SGD  G  LE  K W I++EVEDTGPGI
Sbjct: 745  -VSLISISTSSYDDTIFHTQFKKHTSS-----SGDENGHLLEHPKNWAISVEVEDTGPGI 798

Query: 842  EPALHESVFEPFVQGDQTLSRQYGGTGLGLSICRQLAKMMKGTMKLESKVGVGSKFTFTV 901
            +P+LHESVFEPFVQGDQ LSRQYGGTGLGLSICRQLA MM GTMKL+SK+GVGSKFTFT+
Sbjct: 799  DPSLHESVFEPFVQGDQALSRQYGGTGLGLSICRQLATMMNGTMKLDSKLGVGSKFTFTL 858

Query: 902  PLTQTREVSFDDVENPFEDEFNAHSXXXXXXXXXXXXXSGGSKSRPSVNTSLNSGTDSTA 961
            PLTQTRE+ F+D EN FEDEFN  S                 KS+ S++ S   G  S  
Sbjct: 859  PLTQTREIEFED-ENAFEDEFNPLSKKNRKVKFKVAKSIKSRKSKSSLSNSSGKGGSSDK 917

Query: 962  EKMALXXXXXXXXX--XXXDRPFLQXXXXXXXXXXXXXVKSLERPFKILVAEDNNVNQEV 1019
                L              DRPFLQ             V ++ + ++ILVAEDN+VNQEV
Sbjct: 918  SSKQLKGSESEFSVGNVSLDRPFLQSTGTASSSKNVTVVSNVNKSYRILVAEDNHVNQEV 977

Query: 1020 VKRMLNLEGLSDIDLACDGQEAFDKVKALQEANDHYRIIFMDVQMPRVDGLLSTKMIRQE 1079
            +KRML LEG+  IDLA DGQ+AFDKVKALQE  +HY +IFMDVQMP+VDGLL+TKMIR++
Sbjct: 978  IKRMLTLEGIDRIDLAADGQDAFDKVKALQEKGEHYELIFMDVQMPKVDGLLATKMIRKD 1037

Query: 1080 LRYSHPIVALTAFADDSNIKVCLDSGMNGFLSKPIKRPKLKSVLSEFCPD 1129
            L Y +PIVALTAFADDSNI+VCL++GMNGFLSKPIKRPKLK++++++C D
Sbjct: 1038 LDYQYPIVALTAFADDSNIRVCLEAGMNGFLSKPIKRPKLKTIIAQYCHD 1087

>Kpol_2001.74 s2001 (202108..205449) [3342 bp, 1113 aa] {ON}
            (202108..205449) [3342 nt, 1114 aa]
          Length = 1113

 Score = 1114 bits (2881), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 599/1149 (52%), Positives = 757/1149 (65%), Gaps = 79/1149 (6%)

Query: 8    RSKLKPPFKVGIRTQXXXXXXXXXXXXXXXXXXTTGVYFTANYKSLRADRLHVAAQLKSS 67
            R   KPP+++ IR Q                  TTGVYFT NYK LR+ RL++AA+LKSS
Sbjct: 6    RKAFKPPYRITIRAQLTALVSLVAIISLIILAVTTGVYFTENYKELRSGRLNIAAKLKSS 65

Query: 68   QIDQNLNYLYYQCYWLSTRDTLQDSLIRYRAGNTTKENWSEAEIVLEKFLGSSDLFSVAR 127
            QIDQ LNYL+YQC +L++RDTLQ++LI Y AGN T ENW E+E V++KFL SSDLF VAR
Sbjct: 66   QIDQTLNYLFYQCRYLTSRDTLQNALINYEAGNKTYENWIESENVVQKFLSSSDLFYVAR 125

Query: 128  IYDSTFKTVLNATNNGSGNLVPEHVLTNLFPLSTDDPLASSLQTSGILTDPVLNDTVYVM 187
            +YD  FK V+NATNNG+G+L+P  VL+ LFPLST+  L SSL   GILTDPVLN ++Y+M
Sbjct: 126  LYDLNFKQVVNATNNGTGDLIPNEVLSELFPLSTNQSLPSSLNNDGILTDPVLNGSIYLM 185

Query: 188  SMSLPIFASPSIMLTNSEISGYITVVMSAESLKIVFNDTTALDKSDVAILSAEYSNQSLP 247
            SMSLPI  +PSI+L++S + GYIT+VMSA+ LK V+ + TAL+ S+V ++SA Y++Q   
Sbjct: 186  SMSLPILTNPSIILSSSRVYGYITIVMSADGLKNVYLNNTALENSNVTVISAIYNDQGKV 245

Query: 248  VSYHFVFPPHGVG-ADIIDYSFTIENGSFIQSAFDDRKSGSVKRTSFFYGKDVAVGYSPC 306
              +HFVF       + +I+Y   I+NG+++ SA  + KSGS+K+T + + +++A+GYSPC
Sbjct: 246  DGFHFVFEVENDDFSTLIEYP--IQNGTYLSSALVEGKSGSIKKTKYPFNRELAIGYSPC 303

Query: 307  LFKQVQWVAVISQPENVFLSPSTRLTNIIIGTALGIAVFMCLVTFPLAHWAVKPIVRLQK 366
             F    WVA+++QPE VFLSPST+L  II GT + IAVF+CL+TFPL+HWAVKPIVRLQK
Sbjct: 304  SFSLSNWVALVTQPEAVFLSPSTKLEKIISGTVVAIAVFVCLITFPLSHWAVKPIVRLQK 363

Query: 367  ATEIITARRGLR-SYNQSAPASRTNSFRKRPSTSSSIGS---VFRTITDRPHERDNGHSN 422
            ATE+I+  RGL+ + N S   S + S   R S  S + +   +F+++      R+NG   
Sbjct: 364  ATELISQGRGLKPTSNFSNGDSSSTSDNWRESVESHVRASLGIFKSL------RNNG--- 414

Query: 423  FELHHRTSNSVDSQEARMEL-EISGALPDTNPTTPTSYTNDQHSYKSDNFVNSTNLIDAR 481
                   SN + S +   E+ E S     T     +S  +   S++      ++NL+ AR
Sbjct: 415  -------SNELQSNDDMNEINERSSKNNSTGDNIKSSDNDSSSSFQR---YTTSNLVQAR 464

Query: 482  VPVYGRLFSDELSELTDTFNTMTDELDRHYALLEDRVRARTKQLXXXXXXXXXXXXXKTV 541
            VPVYGR   DELSELTDTFN MT+ LD+HY LLEDRVRARTKQL             KTV
Sbjct: 465  VPVYGRFLQDELSELTDTFNAMTNALDQHYTLLEDRVRARTKQLEAAKIEAEAANEAKTV 524

Query: 542  FIANISHELRTPLNGILGMTAISMAEKDMQKVQNSLKLIFRSGXXXXXXXXXXXXFSKNV 601
            FIANISHELRTPLNGILGMTAISM E D  K++ +LKLIFRSG            FSKNV
Sbjct: 525  FIANISHELRTPLNGILGMTAISMEEDDSDKIKENLKLIFRSGELLLHILTELLTFSKNV 584

Query: 602  LQRTKLEERNFAIMDVALQVKSIFGKLAKDQHVNLSIILSPNVIRTMILWGDSNRIIQIV 661
            L+RT LE+R+F I ++ALQ+KSIFGK+A+DQHV L IIL PN IR+M+LWGDSNRIIQIV
Sbjct: 585  LKRTNLEKRDFCITEIALQIKSIFGKVARDQHVKLLIILMPNRIRSMVLWGDSNRIIQIV 644

Query: 662  MNLVSNALKFSPVDGKVGVRIKLLGEYDGKKSKDSNYNDVFIKPGTEIPDASASKSSL-- 719
            MNLVSNALKF+P+DGKV VRIKLLGEYD ++S + +Y +V+IK GTE+P  +  K+ +  
Sbjct: 645  MNLVSNALKFTPIDGKVDVRIKLLGEYDEERSMNDDYKEVYIKSGTELPIGNGKKTDMVR 704

Query: 720  -STLEYTKVDAIQRRLASKSSDS------QKLKEEPIASSDVSSSDGKDESEAXXXXXXX 772
                E ++ D I+   AS  S         KL E+   +S   + D  ++ E        
Sbjct: 705  KKIQELSEKDCIEGDTASSGSHMSGSSKIDKLIEDEEKNSFSDNEDTNNDIEILSMTTSS 764

Query: 773  KRXXXXXXXXXXXXXXXXXXYDDAILHAQLRKVPSCGNGEDSGDSLGRKLEISKTWVIAI 832
             R                  YDDA L  Q +K P     +D  ++LG +L   KTWVI++
Sbjct: 765  TR-----------------SYDDAALQRQFKKTPDL---DDKEETLGVELSEPKTWVISV 804

Query: 833  EVEDTGPGIEPALHESVFEPFVQGDQTLSRQYGGTGLGLSICRQLAKMMKGTMKLESKVG 892
            EVEDTGPGIEP L E+VFEPFVQGDQ LSRQYGGTGLGLSICRQLA MM GTMKLES VG
Sbjct: 805  EVEDTGPGIEPKLQEAVFEPFVQGDQALSRQYGGTGLGLSICRQLATMMHGTMKLESTVG 864

Query: 893  VGSKFTFTVPLTQTREVSFDDVENPFEDEFNAHSXXXXXXXXXXXXXSG----------G 942
            VGSKF FTVPL QTRE+ FDD    FEDEFNA S             S           G
Sbjct: 865  VGSKFIFTVPLKQTREIHFDD--EKFEDEFNAESKKNRRIKFKIYDSSKSHDSNDEDEEG 922

Query: 943  SKSRPSVNTSLNSGTDSTAEKMALXXXXXXXXXXXXDRPFLQXXXXXXXXXXXXXV---- 998
             KS   +++S N   D                    DRPFLQ             +    
Sbjct: 923  IKSSRDIDSSNNEHKDENG------TSPDNHSKVRLDRPFLQSTGTATSSQKIPTLINKE 976

Query: 999  -KSLERPFKILVAEDNNVNQEVVKRMLNLEGLSDIDLACDGQEAFDKVKALQEANDHYRI 1057
              ++E+  +ILVAEDN+VNQEV+KRMLNLE + +IDLACDGQ+AFDKVK+L +  ++Y I
Sbjct: 977  DTNIEKSIRILVAEDNHVNQEVIKRMLNLEKIDNIDLACDGQDAFDKVKSLADNEEYYDI 1036

Query: 1058 IFMDVQMPRVDGLLSTKMIRQELRYSHPIVALTAFADDSNIKVCLDSGMNGFLSKPIKRP 1117
            IFMDVQMP+VDGL+STKMIR++L Y HPIVALTAFA+D NIK CLD+GM+GFL KPIKRP
Sbjct: 1037 IFMDVQMPKVDGLVSTKMIRKDLNYKHPIVALTAFANDDNIKECLDAGMDGFLGKPIKRP 1096

Query: 1118 KLKSVLSEF 1126
            KLK +L E+
Sbjct: 1097 KLKQILQEY 1105

>Skud_9.21 Chr9 complement(46872..50537) [3666 bp, 1221 aa] {ON}
            YIL147C (REAL)
          Length = 1221

 Score = 1092 bits (2825), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 620/1227 (50%), Positives = 774/1227 (63%), Gaps = 114/1227 (9%)

Query: 8    RSKLKPPFKVGIRTQXXXXXXXXXXXXXXXXXXTTGVYFTANYKSLRADRLHVAAQLKSS 67
            RS   PPF++GIR Q                  TTGVYFT+NYK+LR+DRL++AAQLKSS
Sbjct: 8    RSDFIPPFRIGIRAQLTALVSIVALVSLTILAVTTGVYFTSNYKNLRSDRLYIAAQLKSS 67

Query: 68   QIDQNLNYLYYQCYWLSTRDTLQDSLIRYRAGNTTKENWSEAEIVLEKFLGSSDLFSVAR 127
            Q+DQ LNYLYYQ Y+L++RD LQ SL  Y AGN +++NW ++  V++KFL SS+LF VAR
Sbjct: 68   QVDQTLNYLYYQAYYLASRDALQSSLTSYVAGNKSEDNWVDSLSVVQKFLSSSNLFYVAR 127

Query: 128  IYDSTFKTVLNATNNGSGNLVPEHVLTNLFPLSTDDPLASSLQTSGILTDPVLNDTVYVM 187
            +YDS+F TVLNATNNG+G+L+PE VL NLFPLSTD PL SSL+T+GILTDP++N+T Y+M
Sbjct: 128  VYDSSFTTVLNATNNGTGDLIPEDVLDNLFPLSTDIPLPSSLETTGILTDPIVNNTDYLM 187

Query: 188  SMSLPIFASPSIMLTNSEISGYITVVMSAESLKIVFNDTTALDKSDVAILSAEYSNQSLP 247
            SMSLPIFA+PSI+LT+S + GYIT+VMSAE LK VFNDTTAL+KS+VAI+SA Y+ Q   
Sbjct: 188  SMSLPIFANPSIILTDSRVYGYITIVMSAEGLKSVFNDTTALEKSNVAIISATYNAQGRA 247

Query: 248  VSYHFVFPPHGVGADIIDYSFTIENGSFIQSAFDDRKSGSVKRTSFFYGKDVAVGYSPCL 307
              YHFVFPP+G    I    F IEN +FI S F + K GS+K+T+ F  K++A+GYSPC 
Sbjct: 248  SGYHFVFPPYGTLLSITQRIFPIENNTFISSTFRNGKGGSLKKTNNFGTKNLALGYSPCS 307

Query: 308  FKQVQWVAVISQPENVFLSPSTRLTNIIIGTALGIAVFMCLVTFPLAHWAVKPIVRLQKA 367
            F+ V WVAV+SQPE+VFLSP+T+LT II GT + I VF+ L+T PL HWAVKPIVRLQKA
Sbjct: 308  FQLVNWVAVVSQPESVFLSPATKLTKIIAGTVIAIGVFVILLTLPLTHWAVKPIVRLQKA 367

Query: 368  TEIITARRGLRSYNQSAP--ASRTNSFRK-------RPST--SSSIGSVFRTITDRPHER 416
            TE+IT  RGLR    S P   SR +SFR+        PS+    + G    T +   H  
Sbjct: 368  TELITEGRGLRP---STPRTVSRASSFRRGFSSGFTAPSSLLQFNTGEACSTTSANGHGS 424

Query: 417  DNGHSNFEL-------------HHRTS-----NSVDSQEARMELEISGALPDTNPTTPTS 458
                S   L             H + S     N + +    +++ + G+L + +   P S
Sbjct: 425  SGHGSGVALSTESSMKSAINLGHEKLSPSEEENKIPNNHNDVKISMDGSL-NHDLLAPNS 483

Query: 459  YTN---DQHSYKSDNFVNSTNLIDARVPVYGRLFSDELSELTDTFNTMTDELDRHYALLE 515
              N   D+ S +S     S NL +AR+P Y RLFSDELS+LT+TFNTMTD LD+HYALLE
Sbjct: 484  LRNNDTDRSSSRSHILTTSANLTEARLPDYKRLFSDELSDLTETFNTMTDALDQHYALLE 543

Query: 516  DRVRARTKQLXXXXXXXXXXXXXKTVFIANISHELRTPLNGILGMTAISMAEKDMQKVQN 575
            DRVRARTKQL             KTVFIANISHELRTPLNGILGMTAISM E D+ K++N
Sbjct: 544  DRVRARTKQLEAAKIEAEAANEAKTVFIANISHELRTPLNGILGMTAISMEETDVNKIRN 603

Query: 576  SLKLIFRSGXXXXXXXXXXXXFSKNVLQRTKLEERNFAIMDVALQVKSIFGKLAKDQHVN 635
            +LKLIFRSG            FSKNVLQRTKLE R+F I DVALQ+KSIFGK+AKDQ V 
Sbjct: 604  NLKLIFRSGELLLHILTELLTFSKNVLQRTKLERRDFCITDVALQIKSIFGKVAKDQRVR 663

Query: 636  LSIILSPNVIRTMILWGDSNRIIQIVMNLVSNALKFSPVDGKVGVRIKLLGEYDGKKSKD 695
            LSI L PN+IRTM+LWGDSNRIIQIVMNLVSNALKF+PVDG V VR+KLLGEYD   S+ 
Sbjct: 664  LSISLFPNLIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVDVRMKLLGEYDKDSSEK 723

Query: 696  SNYNDVFIKPGTEIPDASAS------KSSLSTLEYTKVDAIQRRLASKSSDSQKLKEEPI 749
              + +V +K GTEI D   S       +SL   +Y  +++    + S   D+  ++EE I
Sbjct: 724  RQFKEVHVKKGTEITDVVESIDKRDLPTSLGRRKYVNLESTTASITS-CRDNSAIQEE-I 781

Query: 750  ASSDVSSSDGKDESEAXXXXXXXKRXXXXXXXXXXXXXXXXXXYDDAILHAQLRKVPSCG 809
               + ++++               R                  YDDAI ++Q  K  +  
Sbjct: 782  TKRNTAANEN-------IYKKANDREKSSNDDVSSIVSTTTSSYDDAIFNSQFNK--ALD 832

Query: 810  NGEDSGDSLGRKLEISKTWVIAIEVEDTGPGIEPALHESVFEPFVQGDQTLSRQYGGTGL 869
            +  D   ++GR +E  KTWVI+IEVEDTGPGIEP+L ESVF+PFVQGDQTLSRQYGGTGL
Sbjct: 833  SDSDESGNVGRPIENPKTWVISIEVEDTGPGIEPSLQESVFQPFVQGDQTLSRQYGGTGL 892

Query: 870  GLSICRQLAKMMKGTMKL-------------------------------------ESKVG 892
            GLSICRQLA MM GTMKL                                     ESK  
Sbjct: 893  GLSICRQLANMMHGTMKLESQVGVGSKFTFTLPLHQTKEISFANIEFPFEDEFNPESKKN 952

Query: 893  VGSKFT-------------FTVPLTQTREVSFDD-VENPFEDEFNAHSXXXXXXXXXXXX 938
               KF+              T P+T +  ++ D  +E    DE                 
Sbjct: 953  RRVKFSVAKSIKSRQSTSSLTTPVTNSNTLANDVLIEARSSDEEEVEKTKNFIKRKEGEN 1012

Query: 939  XSGGSKSRPSVNTSLNSGTDSTAEKMALXXXXXXXXXXXX-------DRPFLQXXXXXXX 991
             +G ++ +P    + +S + S+AE+ +                    DRPFLQ       
Sbjct: 1013 ENGKAQQQPQEKNTKHSVSFSSAERSSQKTVSSKRRSQEENLGSVNIDRPFLQSTGTATS 1072

Query: 992  XXXXXXVKSLER---PFKILVAEDNNVNQEVVKRMLNLEGLSDIDLACDGQEAFDKVKAL 1048
                  V+  ++     KILV EDN+VNQEV++RMLNLEG+ +I+LACDGQEAFDKVK L
Sbjct: 1073 SRNVPTVQGGDKDGTSIKILVVEDNHVNQEVIRRMLNLEGIDNIELACDGQEAFDKVKEL 1132

Query: 1049 QEANDHYRIIFMDVQMPRVDGLLSTKMIRQELRYSHPIVALTAFADDSNIKVCLDSGMNG 1108
                ++Y +IFMDVQMP+VDGLLSTKMIR++L Y  PIVALTAFADDSNIK CL+SGMNG
Sbjct: 1133 TSKGENYNMIFMDVQMPKVDGLLSTKMIRRDLGYKSPIVALTAFADDSNIKECLESGMNG 1192

Query: 1109 FLSKPIKRPKLKSVLSEFCPDFVEKRN 1135
            FLSKPIKRPKL ++LSEFC  +  K+N
Sbjct: 1193 FLSKPIKRPKLNTILSEFCAAYQGKKN 1219

>AFR284W Chr6 (947118..950429) [3312 bp, 1103 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YIL147C (SLN1)
          Length = 1103

 Score = 1066 bits (2756), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 583/1135 (51%), Positives = 731/1135 (64%), Gaps = 54/1135 (4%)

Query: 4    IGHLRSKL---KPPFKVGIRTQXXXXXXXXXXXXXXXXXXTTGVYFTANYKSLRADRLHV 60
            +G+LR +L   KPPFK G+RTQ                  TTGVYFT+NY++LRADRLHV
Sbjct: 3    LGYLRKRLAVLKPPFKAGLRTQLTILVCIIALSSLIILACTTGVYFTSNYRTLRADRLHV 62

Query: 61   AAQLKSSQIDQNLNYLYYQCYWLSTRDTLQDSLIRYRAGNTTKENWSEAEIVLEKFLGSS 120
            AA+L SSQ+DQ+L  LYYQC  LST+DT+Q++L  YRAGN + ENW EA+ +L  FL  S
Sbjct: 63   AARLMSSQVDQSLTLLYYQCNMLSTKDTIQNALSDYRAGNRSAENWIEADKILGGFLERS 122

Query: 121  DLFSVARIYDSTFKTVLNATNNGSGNLVPEHVLTNLFPLSTDDPLASSLQTSGILTDPVL 180
              F +A +YD  ++ VL+  NN +   + E  L  L PL  D    +      + T P  
Sbjct: 123  KTFYIAYLYDEMYQEVLSRWNNDTEGSLAEESLVRLRPLEMDKYEYNEALDVQVETLP-Y 181

Query: 181  NDTVYVMSMSLPIFASPSIMLTNSEISGYITVVMSAESLKIVFNDTTALDKSDVAILSAE 240
            N T+ +MSM+LP+ AS  I   N  + G++T+VMSA+ +  V NDT+ L +S V+IL+  
Sbjct: 182  NKTLNLMSMTLPVEASTIIGRGN--VVGFLTIVMSADPITAV-NDTSVLGESMVSILTGI 238

Query: 241  YSNQSLPVSYHFVFPPHGVGADIIDYSFTIENGSFIQSAFDDRKSGSVKRTSFFYG---- 296
             +++   V Y FVFPP      + +  + I+N SF++ AF +R    V  TS FY     
Sbjct: 239  PNDKGNLVKYRFVFPPGETDRSVTETEYPIKNASFLRDAFLNRSDNYVTSTSSFYHFGAL 298

Query: 297  ----KDVAVGYSPCLFKQVQWVAVISQPENVFLSPSTRLTNIIIGTALGIAVFMCLVTFP 352
                K VAVGYS C F+Q+ WVAV+SQ E+VFLSP+ +LT IIIGT LG+AVFMC+VTF 
Sbjct: 299  GHDFKKVAVGYSACKFRQLDWVAVVSQDESVFLSPAFKLTKIIIGTVLGVAVFMCIVTFI 358

Query: 353  LAHWAVKPIVRLQKATEIITARRGLRSYNQSAPASRTNSFRKRPSTSSSIGSVFRTITDR 412
            LA WAVKPIVRLQKATE I A RGLR+YN S  +S  N+   R ++  S  S+ R + ++
Sbjct: 359  LASWAVKPIVRLQKATEFIAAGRGLRTYNHSGRSSSQNTSIDRSNSRGSDHSLPRELFEK 418

Query: 413  PHERDNGHSNFELHHRTSNSVD-SQEARMELEISGALPDTNPTTPTSYTNDQHSYKSDNF 471
             H      S F   +  +NS   S  +  E  +       +  T T+  +D     +   
Sbjct: 419  KHHV----SPFVTENHAANSGSCSSMSDHERYLHHIARYHDGETSTNILSDHEKGST--- 471

Query: 472  VNSTNLIDARVPVYGRLFSDELSELTDTFNTMTDELDRHYALLEDRVRARTKQLXXXXXX 531
             ++TN ID RVPVY RLF+DELSELTDTFNTMTDELDR Y +LEDRVRARTKQL      
Sbjct: 472  -SATNWIDTRVPVYRRLFTDELSELTDTFNTMTDELDRQYVVLEDRVRARTKQLEAAKIQ 530

Query: 532  XXXXXXXKTVFIANISHELRTPLNGILGMTAISMAEKDMQKVQNSLKLIFRSGXXXXXXX 591
                   KTVFIANI HELRTPLNGILGMTAI+MAE+D +K+QNSLKLIFRSG       
Sbjct: 531  AEAANEAKTVFIANIFHELRTPLNGILGMTAIAMAEQDQEKIQNSLKLIFRSGELLLHIL 590

Query: 592  XXXXXFSKNVLQRTKLEERNFAIMDVALQVKSIFGKLAKDQHVNLSIILSPNVIRTMILW 651
                 FSKNVL+RTKLEER+F+I+D+ALQVKSIFGKLAKDQHV LSI L PN IRTM+LW
Sbjct: 591  TELLTFSKNVLKRTKLEERHFSIIDIALQVKSIFGKLAKDQHVKLSIYLMPNAIRTMVLW 650

Query: 652  GDSNRIIQIVMNLVSNALKFSPVDGKVGVRIKLLGEYDGKKSKDSNYNDVFIKPGTEIPD 711
            GDSNRIIQIVMNLVSNALKF+PVDGKV VRIKL+GEYD  +S+  N+++V+I PGTE+ +
Sbjct: 651  GDSNRIIQIVMNLVSNALKFTPVDGKVDVRIKLVGEYDSARSEACNFSEVYILPGTEVTN 710

Query: 712  ASASKSSLSTLEYTKVDAIQRRLASKSSDSQKLKEEPIASSDVSSSDGKDESEAXXXXXX 771
            +S +    + +E  +    +   A  + + +K   E +  +D  S               
Sbjct: 711  SSVNNIP-TVVEEEEKACEEEPTADDTPERKKKDSETVDDADAIS--------------- 754

Query: 772  XKRXXXXXXXXXXXXXXXXXXYDDAILHAQLRKVPSCGNGEDSGDSLG-RKLEISKTWVI 830
                                 YDDA+LHAQL+K+P+  + EDS +++   KLE  ++WVI
Sbjct: 755  -------------ISSSVATSYDDAVLHAQLKKIPTFIDLEDSDNNVTMSKLEKPRSWVI 801

Query: 831  AIEVEDTGPGIEPALHESVFEPFVQGDQTLSRQYGGTGLGLSICRQLAKMMKGTMKLESK 890
             IEV+DTGPGIEP+LHESVF+PFVQGDQTLSRQYGGTGLGLSICRQLA MMKGTMKLESK
Sbjct: 802  VIEVQDTGPGIEPSLHESVFKPFVQGDQTLSRQYGGTGLGLSICRQLATMMKGTMKLESK 861

Query: 891  VGVGSKFTFTVPLTQTREVSFDDVENPFEDEFNAHSXXXXXXXXXXXXXSGGSKSRPSVN 950
            VG GSKFTFTVPL QT  V F+D +  FEDEFN  S                 K + + +
Sbjct: 862  VGSGSKFTFTVPLQQTGTVKFNDGDTLFEDEFNIFSKKNRKVKFQLNRSGKSRKGKMNNS 921

Query: 951  TSLNSGTDSTAEKMALXXXXXXXXXXXXDRPFLQXXXXXXXXXXXXXVKSLERPFKILVA 1010
                S  +S  E                DRPFLQ             + S E   +ILVA
Sbjct: 922  NGAGSIAESAIESFGKSESEASFGSVRVDRPFLQSTGTATSTRSVPTLSSAESSLRILVA 981

Query: 1011 EDNNVNQEVVKRMLNLEGLSDIDLACDGQEAFDKVKALQEANDHYRIIFMDVQMPRVDGL 1070
            EDNNVNQEV+KRML+LEG  +IDLACDG++A+ KV AL E  +HY +IFMDVQMPR+DGL
Sbjct: 982  EDNNVNQEVIKRMLHLEGAHNIDLACDGEDAYQKVSALVEQGEHYDLIFMDVQMPRMDGL 1041

Query: 1071 LSTKMIRQELRYSHPIVALTAFADDSNIKVCLDSGMNGFLSKPIKRPKLKSVLSE 1125
            L+TK++RQ+L Y +PIVALTAFADDSNIK CL+SGMN FL+KPIKRP LK +L E
Sbjct: 1042 LTTKLLRQKLHYEYPIVALTAFADDSNIKECLESGMNSFLAKPIKRPMLKKILLE 1096

>Ecym_4020 Chr4 complement(49684..53061) [3378 bp, 1125 aa] {ON}
            similar to Ashbya gossypii AFR284W
          Length = 1125

 Score = 1036 bits (2678), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 595/1132 (52%), Positives = 735/1132 (64%), Gaps = 67/1132 (5%)

Query: 11   LKPPFKVGIRTQXXXXXXXXXXXXXXXXXXTTGVYFTANYKSLRADRLHVAAQLKSSQID 70
             +PP+K G+ TQ                  TTGVYFT NYKSLRADRL VAAQL S+QI+
Sbjct: 23   FRPPYKAGLSTQLTILVCIIALCSLIILAVTTGVYFTTNYKSLRADRLTVAAQLTSAQIN 82

Query: 71   QNLNYLYYQCYWLSTRDTLQDSLIRYRAGNTTKENWSEAEIVLEKFLGSSDLFSVARIYD 130
            Q LN +YYQCYWLS+RD++Q++L+ Y+ GNT+  N   A+ VL KFL SS+      +YD
Sbjct: 83   QTLNIIYYQCYWLSSRDSIQNALVSYKVGNTSSLNLDNAKEVLVKFLDSSNSIFRTHLYD 142

Query: 131  STFKTVLNATNNGSGNLVPEHVLTNLFPLSTDDPLASSLQTSGILTDPVLNDTVYVMSMS 190
            S F  VL+ + N +GN++ + +L +L PLS++ PL SS+   G+L++PV N + + MSMS
Sbjct: 143  SAFNEVLSVSTNSTGNIIGDDLLRDLLPLSSNSPLPSSIIDDGMLSNPVFNGSSFFMSMS 202

Query: 191  LPIFASPSIMLTNSEISGYITVVMSAESLKIVFNDTTALDKSDVAILSAEYSNQSLPVSY 250
            LP+ A  SI+   S+  GYIT+VMSA+ +  V     AL+ S V++L+  Y   ++  SY
Sbjct: 203  LPVSAKASILYPKSDTVGYITMVMSADQVSSVCAGKPALNGSTVSVLAGVYDENNILNSY 262

Query: 251  HFVFPPHGVGAD-IIDYSFTIENGSFIQSAFDDRKSGSVKRTSFFYGKDVAVGYSPCLFK 309
              +FPP  V    +++  F I N SF+ +AF +R SGSV +T+ FY  +VAVGY+ C FK
Sbjct: 263  QVLFPPSIVQVPRLLEIVFPIANNSFLYNAFVNRSSGSVSKTNAFYEPNVAVGYAACSFK 322

Query: 310  QVQWVAVISQPENVFLSPSTRLTNIIIGTALGIAVFMCLVTFPLAHWAVKPIVRLQKATE 369
             V WVAV++Q E VFLSPST+LT IIIGT +GIA F+C+VTF +A+WAVKPIVRLQKATE
Sbjct: 323  LVNWVAVVAQQEAVFLSPSTKLTKIIIGTVIGIAFFICIVTFIVANWAVKPIVRLQKATE 382

Query: 370  IITARRGLRSYNQSAPA-------SRTNSFRKRPSTSSSIGSVFRTITDRPHERDNGHSN 422
            +I A RGLRSY  S+ +       +R+NS +  PS +   G   R     P+     HS+
Sbjct: 383  LIAAGRGLRSYRHSSRSSSRTTSINRSNS-KGSPSPTLREGDGLRKTPPSPYTP--MHSH 439

Query: 423  FELHHR---TSNSVDSQEARMELEISGALPDTNPTTPTSYTNDQHSYKSDNFVNSTNLID 479
             E +        SVD   A     I   +P ++P           S + D F  S N I+
Sbjct: 440  VEPNPSGIGREYSVDIARA-----IGIEVPSSHP-----------SERVDAFTTSANWIE 483

Query: 480  ARVPVYGRLFSDELSELTDTFNTMTDELDRHYALLEDRVRARTKQLXXXXXXXXXXXXXK 539
             RVPVY RLFSDELSELTDTFN+MTDELDRHYALLEDRVRARTKQL             K
Sbjct: 484  TRVPVYRRLFSDELSELTDTFNSMTDELDRHYALLEDRVRARTKQLEAAKIQAESANEAK 543

Query: 540  TVFIANISHELRTPLNGILGMTAISMAEKDMQKVQNSLKLIFRSGXXXXXXXXXXXXFSK 599
            T+FIANISHELRTPLNGILGMTAI+MAE DM+KVQNSLKLIFRSG            FSK
Sbjct: 544  TMFIANISHELRTPLNGILGMTAIAMAENDMEKVQNSLKLIFRSGELLLHILTELLTFSK 603

Query: 600  NVLQRTKLEERNFAIMDVALQVKSIFGKLAKDQHVNLSIILSPNVIRTMILWGDSNRIIQ 659
            N+L+R KLE+RNF+++DVALQVKSIFGKLAKDQ+V  SI L PN+IR M+LWGDSNRIIQ
Sbjct: 604  NILKRNKLEQRNFSMVDVALQVKSIFGKLAKDQNVKFSIFLMPNLIRKMVLWGDSNRIIQ 663

Query: 660  IVMNLVSNALKFSPVDGKVGVRIKLLGEYDGKKSKDSNYNDVFIKPGTEIPDASASKSSL 719
            IVMNLVSNALKF+PVDGKV +RIKLLGEYD ++S+  N  +VFIK GTEI D   +K+  
Sbjct: 664  IVMNLVSNALKFTPVDGKVSLRIKLLGEYDEEESEKCNNAEVFIKQGTEISD--ETKNVF 721

Query: 720  STLEYTKVDAIQRRLASKSSDSQKLKEEPIASSDVSSSDGKDESEAXXXXXXXKRXXXXX 779
             T                      + EE   S    S+D   E+         K      
Sbjct: 722  DT----------------------ITEEKYVSCSGESTDDTIETGQEGAQKPDK------ 753

Query: 780  XXXXXXXXXXXXXYDDAILHAQLRKVPSCGNGEDSGD--SLGRKLEISKTWVIAIEVEDT 837
                         YDDAI H++ +K+P+  +  D GD  S+G K E  K WVI+IEVEDT
Sbjct: 754  ADNISVVSSGTSSYDDAIFHSRFKKIPAVLD-VDEGDLSSIG-KSEKKKVWVISIEVEDT 811

Query: 838  GPGIEPALHESVFEPFVQGDQTLSRQYGGTGLGLSICRQLAKMMKGTMKLESKVGVGSKF 897
            GPGI+P+L ESVF+PFVQGDQTLSRQYGGTGLGLSICRQL+ MMKGTMKL S+VGVGSKF
Sbjct: 812  GPGIDPSLQESVFKPFVQGDQTLSRQYGGTGLGLSICRQLSTMMKGTMKLHSEVGVGSKF 871

Query: 898  TFTVPLTQTREVSFDDVENPFEDEFNAHSXXXXXXXXXXXXXSGGSKSRPSVNTSLNSGT 957
             FTVPL QT  V   D E+ FEDEFNA S              GG   + S++    SG 
Sbjct: 872  IFTVPLRQTGTVEDLDDEDLFEDEFNAQS--KINRRVKFKLNKGGKSRQSSLSVPEISGV 929

Query: 958  -DSTAEKMALXXXXXXXXXXXXDRPFLQXXXXXXXXXXXXXVKSLERPFKILVAEDNNVN 1016
             DS    M              DRPFLQ             V SLE  FK+LVAEDNNVN
Sbjct: 930  PDSPLNSMGRSESELSVSSVRVDRPFLQSTGTATSTRSIPTVGSLESNFKVLVAEDNNVN 989

Query: 1017 QEVVKRMLNLEGLSDIDLACDGQEAFDKVKALQEANDHYRIIFMDVQMPRVDGLLSTKMI 1076
            QEV+KRML LEG+ DI+LACDG+EA +KV  L    DHY I+FMDVQMP++DGL++T+ I
Sbjct: 990  QEVIKRMLQLEGIYDIELACDGEEALEKVANLTNQYDHYNIVFMDVQMPKMDGLIATRNI 1049

Query: 1077 RQELRYSHPIVALTAFADDSNIKVCLDSGMNGFLSKPIKRPKLKSVLSEFCP 1128
            R+EL Y++PIVALTAFADDSNIKVCL+SGM+GFLSKPIKR KL+ +L E+CP
Sbjct: 1050 RKELNYTYPIVALTAFADDSNIKVCLESGMDGFLSKPIKREKLRKILLEYCP 1101

>TPHA0D04590 Chr4 (1001887..1005270) [3384 bp, 1127 aa] {ON} Anc_5.700
            YIL147C
          Length = 1127

 Score = 1035 bits (2677), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 576/1151 (50%), Positives = 734/1151 (63%), Gaps = 66/1151 (5%)

Query: 12   KPPFKVGIRTQXXXXXXXXXXXXXXXXXXTTGVYFTANYKSLRADRLHVAAQLKSSQIDQ 71
            KPP+++ IR Q                  T GVYFTANYK+L+  RL++AAQLK+SQIDQ
Sbjct: 10   KPPYRISIRAQLTALVSLVAIISLIILAVTAGVYFTANYKNLKTGRLYIAAQLKASQIDQ 69

Query: 72   NLNYLYYQCYWLSTRDTLQDSLIRYRAGNTTKENWSEAEIVLEKFLGSSDLFSVARIYDS 131
             LNYLYYQCY+LS+ +TLQ+SL+ Y AGN +  NW E+ +VLEKFL SSDLFSVAR+YD+
Sbjct: 70   TLNYLYYQCYYLSSGETLQNSLVSYSAGNISSTNWYESSLVLEKFLTSSDLFSVARLYDT 129

Query: 132  TFKTVLNATNNGSGNLVPEHVLTNLFPLSTDDPLASSLQTSGILTDPVLNDTVYVMSMSL 191
             F  ++NATNN SGN VPE V+  LF LS +  L SSL+T GI TDPVLN + ++MSMSL
Sbjct: 130  NFNIMINATNNASGNYVPESVIDKLFTLSLNISLPSSLETIGICTDPVLNGSNFLMSMSL 189

Query: 192  PIFASPSIMLTNSEISGYITVVMSAESLKIVFNDTTALDKSDVAILSAEYSNQSLPVSYH 251
            PIFA+PSI+L++S I GY++V+MSAE LK VFNDTTAL+ S+V ++SA+YS  +    ++
Sbjct: 190  PIFANPSIILSDSRIYGYLSVIMSAEGLKSVFNDTTALENSEVFVISADYSITTNLEYFN 249

Query: 252  FVFPPHGVGADI-IDYSFTIENGSFIQSAFDDRKSGSVKRTSFFYGKDVAVGYSPCLFKQ 310
            F+F      AD   D  + I+N +F+ +   + K G+VK+T+ F G   AVGYS C F  
Sbjct: 250  FLFASAYDNADKDYDLHYRIDNDTFVYNGLVNGKGGAVKKTNGFLGTAAAVGYSSCSFSL 309

Query: 311  VQWVAVISQPENVFLSPSTRLTNIIIGTALGIAVFMCLVTFPLAHWAVKPIVRLQKATEI 370
            V W+A+++QPE  F   +T+L  II G  + +AVF+CL+TFPL+HWAV+P++RLQKATE 
Sbjct: 310  VNWLAIVAQPEAAFSESATKLERIISGVVVAVAVFVCLLTFPLSHWAVQPLIRLQKATER 369

Query: 371  ITARRGLRSYNQS--APASRTNSFRKRPS----TSSSIGSVFRTITD-------RPHERD 417
            I   RGLR    +  +  SR +S + R S      SS+G     ++D             
Sbjct: 370  IAEGRGLRPPQPTVGSSVSRNSSIKWRNSLENHVRSSLGFNANKLSDSGSITANNFKNNT 429

Query: 418  NGHSNFELHHRTSNSVDSQEARMELEISGALPDTNPTTPTSYTNDQHSYKSDNFVNSTNL 477
            +  ++    H   N+  S  +       G  PD           D  S  S  +  S NL
Sbjct: 430  SSSNSITSSHIYGNNNSSHSSM------GINPD-----------DDLSSSSQKYKTSANL 472

Query: 478  IDARVPVYGRLFSDELSELTDTFNTMTDELDRHYALLEDRVRARTKQLXXXXXXXXXXXX 537
            I+ARVPVY RL  DELSELTDTFNTMTD LD+HY LLE+RVRARTKQL            
Sbjct: 473  IEARVPVYWRLLQDELSELTDTFNTMTDALDQHYCLLEERVRARTKQLEAAKIQAESANE 532

Query: 538  XKTVFIANISHELRTPLNGILGMTAISMAEKDMQKVQNSLKLIFRSGXXXXXXXXXXXXF 597
             KTVFIANISHELRTPLNGILGMTAISM E D+ K++ +LKLIFRSG            F
Sbjct: 533  AKTVFIANISHELRTPLNGILGMTAISMEEDDVDKIRGNLKLIFRSGELLLHILTELLTF 592

Query: 598  SKNVLQRTKLEERNFAIMDVALQVKSIFGKLAKDQHVNLSIILSPNVIRTMILWGDSNRI 657
            SKNVLQRTKLE+R+F I +VALQ+KSIFGKLAKDQHV LSIIL PN++R+ +LWGDSNRI
Sbjct: 593  SKNVLQRTKLEKRDFCITEVALQIKSIFGKLAKDQHVKLSIILMPNILRSYVLWGDSNRI 652

Query: 658  IQIVMNLVSNALKFSPVDGKVGVRIKLLGEYDGKKSKDSNYNDVFIKPGTEIPDASASKS 717
            IQ+VMNLVSNALKF+PVDG V VRI LLGEYD ++SK  +Y  V++K GTE+P       
Sbjct: 653  IQVVMNLVSNALKFTPVDGNVDVRINLLGEYDEERSKAEDYKKVYVKQGTELP------L 706

Query: 718  SLSTLEYTKVDAIQRRLASKSSDSQKLKEEPIASSDVSSSDGKDESEAXXXXXXXKRXXX 777
            ++S L+  + + I R+  ++ ++ +  +   I+  D + S  K  +E        K    
Sbjct: 707  NISHLKTEENNDISRKSETELNNDEN-ETHTISKDDTADSSIKIGNEDVEISEVDK---- 761

Query: 778  XXXXXXXXXXXXXXXYDDAILHAQLRKVPSCGNGEDSGDSLGRKLEISKTWVIAIEVEDT 837
                           YDD  L  QL K       +D  + LG +L+  KTWVI++EV+DT
Sbjct: 762  --MGMASLVTTSSKSYDDTALMKQLIKSTDL---DDDENKLGVELKEQKTWVISVEVKDT 816

Query: 838  GPGIEPALHESVFEPFVQGDQTLSRQYGGTGLGLSICRQLAKMMKGTMKLESKVGVGSKF 897
            G GI+P L ESVFEPFVQGDQ LSRQYGGTGLGLSIC+QL+ MM GTM+LES+VGVGSKF
Sbjct: 817  GSGIDPKLQESVFEPFVQGDQALSRQYGGTGLGLSICKQLSTMMNGTMELESEVGVGSKF 876

Query: 898  TFTVPLTQTREVSFDDVENPFEDEFNAHSXXXXXXXXXXXXXSGGS--KSRPSVNTSLNS 955
             FT+PL QTRE+S  D E  F DEFNA S             S     K+R S+ +SLN+
Sbjct: 877  IFTLPLKQTREISIPDDE-LFNDEFNAVSKKNRKVKFKFSGSSSAKSIKTRNSIGSSLNN 935

Query: 956  ----GTDSTAEKMALXXXXXXXXXXXXDRPFLQXXXXXXXXXXXXXV------KSLERPF 1005
                 +  ++   +             +RPFLQ             +      KS  +  
Sbjct: 936  RHSTTSIDSSSSDSDEEDNVRPSSVRLNRPFLQSTGTATSTQNVPTLNAHTDDKSKNKVL 995

Query: 1006 K------ILVAEDNNVNQEVVKRMLNLEGLSDIDLACDGQEAFDKVKALQEANDHYRIIF 1059
                   ILVAEDN+VNQEV+KRML LEG+++IDLA DGQ+AFDK K L E N +Y IIF
Sbjct: 996  NKMDLIYILVAEDNHVNQEVIKRMLKLEGINNIDLARDGQDAFDKTKMLSENNGNYDIIF 1055

Query: 1060 MDVQMPRVDGLLSTKMIRQELRYSHPIVALTAFADDSNIKVCLDSGMNGFLSKPIKRPKL 1119
            MDVQMPR+DGL +TKMIR+EL Y+ PIVAL+AF  + N+K CLD GMN FLSKPIKRP L
Sbjct: 1056 MDVQMPRLDGLAATKMIREELNYTQPIVALSAFPKEENVKECLDVGMNDFLSKPIKRPDL 1115

Query: 1120 KSVLSEFCPDF 1130
            K +L ++  DF
Sbjct: 1116 KIILKKYIEDF 1126

>NCAS0G00250 Chr7 complement(40367..43918) [3552 bp, 1183 aa] {ON}
           Anc_5.700 YIL147C
          Length = 1183

 Score =  979 bits (2531), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 520/947 (54%), Positives = 647/947 (68%), Gaps = 53/947 (5%)

Query: 11  LKPPFKVGIRTQXXXXXXXXXXXXXXXXXXTTGVYFTANYKSLRADRLHVAAQLKSSQID 70
           LKPPF++GIRTQ                  TTGVYFT+NYK+LR+DRL++AAQLKSSQID
Sbjct: 11  LKPPFRLGIRTQLTVLVSVVALCSLVILAITTGVYFTSNYKNLRSDRLYIAAQLKSSQID 70

Query: 71  QNLNYLYYQCYWLSTRDTLQDSLIRYRAGNTTKENWSEAEIVLEKFLGSSDLFSVARIYD 130
           QNLNYLYYQ YWLS+RDTLQ  L  Y AGN T ENW+++E V++KFL S++LFS A++YD
Sbjct: 71  QNLNYLYYQSYWLSSRDTLQIGLTNYVAGNKTAENWADSEQVIQKFLTSNNLFSNAQLYD 130

Query: 131 STFKTVLNATNNGSGNLVPEHVLTNLFPLSTDDPLASSLQTSGILTDPVLNDTVYVMSMS 190
           S+F  VL ATNNG+G+L+PE VL  L+PL+T+ PL+SSL+T GILTDPVLN + Y+MSMS
Sbjct: 131 SSFNAVLTATNNGTGDLIPESVLKKLYPLATNQPLSSSLETIGILTDPVLNGSTYIMSMS 190

Query: 191 LPIFASPSIMLTNSEISGYITVVMSAESLKIVFNDTTALDKSDVAILSAEYSNQSLPVSY 250
           LPIFA+PSI+LT+S++ GYIT+VMSAE LK VFNDTTAL++S+VAI+S  Y+N+S   +Y
Sbjct: 191 LPIFANPSIILTDSKVYGYITIVMSAEGLKTVFNDTTALEQSNVAIVSGVYNNESTLNAY 250

Query: 251 HFVFPPHGVGADIIDYSFTIENGSFIQSAFDDRKSGSVKRTSFFYGKDVAVGYSPCLFKQ 310
           HFVF P+G  + +I+ +F I N SF+ +A  + K GSVK+T FFY K++AVGYSPC F  
Sbjct: 251 HFVFAPYGAPSYVINSTFRIMNNSFLNTALREGKGGSVKKTKFFYTKNIAVGYSPCTFSF 310

Query: 311 VQWVAVISQPENVFLSPSTRLTNIIIGTALGIAVFMCLVTFPLAHWAVKPIVRLQKATEI 370
           V W+A++SQ E+VFLSPST+L  II GT + I VF+ L+TFPLAHWAVKPIVRLQKATE+
Sbjct: 311 VNWIAIVSQDESVFLSPSTKLAKIISGTVVAIGVFVFLITFPLAHWAVKPIVRLQKATEL 370

Query: 371 ITARRGLRSYNQ-SAPASRTNSFRK--RPSTSSSIGSVFRTITDRPHERDNGHSNFELHH 427
           ++  RGL+S    S   SR++S +   R +  S+  SV     D      NGH    L+ 
Sbjct: 371 MSEGRGLKSTTPGSKNVSRSSSIKHYVRSNIPSTASSVHNFSGDNLSTTTNGH----LNQ 426

Query: 428 R--------TSNSVDSQEARMELE-ISGALPDTNPTTPTSYTNDQH-SYKSDNFVNSTNL 477
           R        T++     ++    E IS A       + + +T+    S +S     S NL
Sbjct: 427 RGLTPTPMPTTDLPSPSDSNFATEMISNANTSQRANSISRFTDHTDLSNRSKKLTTSANL 486

Query: 478 IDARVPVYGRLFSDELSELTDTFNTMTDELDRHYALLEDRVRARTKQLXXXXXXXXXXXX 537
           I+ARVP Y RLFSDELS+LTDTFN MTD LD+HYALLEDRVRARTKQL            
Sbjct: 487 IEARVPDYRRLFSDELSDLTDTFNAMTDALDQHYALLEDRVRARTKQLEAAKIEAETANE 546

Query: 538 XKTVFIANISHELRTPLNGILGMTAISMAEKDMQKVQNSLKLIFRSGXXXXXXXXXXXXF 597
            KT+FIANISHELRTPLNGILGMTAISM E D+ K+++SLKLIFRSG            F
Sbjct: 547 AKTIFIANISHELRTPLNGILGMTAISMEETDIAKIRSSLKLIFRSGELLLHILTELLTF 606

Query: 598 SKNVLQRTKLEERNFAIMDVALQVKSIFGKLAKDQHVNLSIILSPNVIRTMILWGDSNRI 657
           SKNVL+RT LE+R+F I DVALQ+KSIFGK+AKDQ V LSI+L PN+IRTMIL+GDSNRI
Sbjct: 607 SKNVLKRTTLEKRDFCITDVALQIKSIFGKVAKDQRVRLSIVLLPNIIRTMILFGDSNRI 666

Query: 658 IQIVMNLVSNALKFSPVDGKVGVRIKLLGEYDGKKSKDSNYNDVFIKPGTEIPDASASKS 717
           IQIVMNLVSNALKF+PVDGKV VRIKL+GEYD   S++SN+  V +K GTE  +      
Sbjct: 667 IQIVMNLVSNALKFTPVDGKVNVRIKLMGEYDENLSRESNFKKVLVKSGTEFIE------ 720

Query: 718 SLSTLEYTKVDAIQRRLASKSSDSQKLKEEPIAS-------------SDV--SSSDGKD- 761
                  TK  AI   L +   D  K   E +               +D+  ++SD K  
Sbjct: 721 -------TKAKAI---LGAPKKDDPKTSTESVVQIKENLNSNTSSSSNDIISTTSDEKKY 770

Query: 762 --ESEAXXXXXXXKRXXXXXXXXXXXXXXXXXXYDDAILHAQLRKVPSCGNGEDSGDSLG 819
             + +                            YDDA+ + Q +K P     ED   +LG
Sbjct: 771 DEKEDEGEEDNSDNDNDDTSMETQSIVSTSTSSYDDAVFNNQFKKTPELYEDEDG--NLG 828

Query: 820 RKLEISKTWVIAIEVEDTGPGIEPALHESVFEPFVQGDQTLSRQYGGTGLGLSICRQLAK 879
            +L   KTWVIAIEV+DTGPGI+P+L +SVFEPFVQGDQTLSRQYGGTGLGLSICRQLA 
Sbjct: 829 IELTNPKTWVIAIEVQDTGPGIDPSLQKSVFEPFVQGDQTLSRQYGGTGLGLSICRQLAN 888

Query: 880 MMKGTMKLESKVGVGSKFTFTVPLTQTREVSFDDVENPFEDEFNAHS 926
           MM GTM+L+S+VGVGS FTFTVPL QTRE+  ++ ++PFEDEFN  S
Sbjct: 889 MMNGTMELKSEVGVGSTFTFTVPLMQTRELELNEDDHPFEDEFNPAS 935

 Score =  221 bits (563), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 103/163 (63%), Positives = 129/163 (79%), Gaps = 1/163 (0%)

Query: 979  DRPFLQXXXXXXXXXXXXXVKSLERPFKILVAEDNNVNQEVVKRMLNLEGLSDIDLACDG 1038
            DRPFLQ             V    + FKILVAEDN+VNQEV+KRMLNLEG+ +I+LA DG
Sbjct: 1019 DRPFLQSTGTATSTRTIQTVPDAGKKFKILVAEDNHVNQEVIKRMLNLEGVENIELARDG 1078

Query: 1039 QEAFDKVKALQEANDHYRIIFMDVQMPRVDGLLSTKMIRQELRYSHPIVALTAFADDSNI 1098
            Q+AF++VKA+ E  +H+ +IFMDVQMP+VDGLLSTKMIR +L Y++PIVALTAFADDSNI
Sbjct: 1079 QDAFNEVKAMVEQGEHFDMIFMDVQMPKVDGLLSTKMIRNDLHYTYPIVALTAFADDSNI 1138

Query: 1099 KVCLDSGMNGFLSKPIKRPKLKSVLSEFCPDFVEK-RNSNKAK 1140
            K CL++GMNGFLSKPIKRPK+K++L E+CP++  K    NK+K
Sbjct: 1139 KECLEAGMNGFLSKPIKRPKVKTILEEYCPNWQMKVAEDNKSK 1181

>KNAG0L02110 Chr12 (376096..379698) [3603 bp, 1200 aa] {ON}
           Anc_5.700 YIL147C
          Length = 1200

 Score =  975 bits (2520), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 513/952 (53%), Positives = 636/952 (66%), Gaps = 34/952 (3%)

Query: 12  KPPFKVGIRTQXXXXXXXXXXXXXXXXXXTTGVYFTANYKSLRADRLHVAAQLKSSQIDQ 71
           KPP++VGIR Q                  TTGVYFT+NYK+LR+DRL++AAQLKSSQIDQ
Sbjct: 11  KPPYRVGIRAQLTMLVSIVAIISLVILAVTTGVYFTSNYKNLRSDRLYIAAQLKSSQIDQ 70

Query: 72  NLNYLYYQCYWLSTRDTLQDSLIRYRAGNTTKENWSEAEIVLEKFLGSSDLFSVARIYDS 131
           NLNYLYYQCYW+++RDTLQ  L  Y AGN +  NW +++ VLEKFLGSS+LFSVAR+YDS
Sbjct: 71  NLNYLYYQCYWVASRDTLQTGLANYVAGNKSDANWMDSQSVLEKFLGSSNLFSVARVYDS 130

Query: 132 TFKTVLNATNNGSGNLVPEHVLTNLFPLSTDDPLASSLQTSGILTDPVLNDTVYVMSMSL 191
           +F TVLN TNN +G+L+PE VLT L PLST+ PL SSL+T+GI+T+PV N + Y+MSMSL
Sbjct: 131 SFTTVLNTTNNSTGDLIPEDVLTQLLPLSTNVPLPSSLETNGIVTNPVKNGSSYLMSMSL 190

Query: 192 PIFASPSIMLTNSEISGYITVVMSAESLKIVFNDTTALDKSDVAILSAEYSNQSLPVSYH 251
           PIFA+PSI+LT+S + GY+TVVMSAE L  VFNDTTAL++S VAI+SA Y+N +   +Y 
Sbjct: 191 PIFANPSIILTDSRVYGYVTVVMSAEGLLSVFNDTTALERSYVAIVSAVYTNATKLDAYR 250

Query: 252 FVFPPHGVGADIIDYSFTIENGSFIQSAFDDRKSGSVKRTSFFYGKDVAVGYSPCLFKQV 311
           FVFPP G  + I++ +F + N +F+ SA    K G++K T  FY   +AVGYSP      
Sbjct: 251 FVFPPFGSTSSILNETFPLNNNTFLSSALRQGKGGALKSTRLFYRLKLAVGYSPSTSNLA 310

Query: 312 QWVAVISQPENVFLSPSTRLTNIIIGTALGIAVFMCLVTFPLAHWAVKPIVRLQKATEII 371
            WVA+++Q E+VF+SP+T+L  II GT +GI VF  L+TFPLAHWAVKPIVRLQKATE+I
Sbjct: 311 NWVAIVAQAESVFISPATKLAKIIAGTVVGIGVFAMLITFPLAHWAVKPIVRLQKATELI 370

Query: 372 TARRGLRSYNQSAPASRTNS----------FRKRP-STSSSIGSVFRTITDRPHERDNGH 420
           T  RGLR    ++  SR NS          F   P ST++   +        P ++D   
Sbjct: 371 TESRGLRPTTPTS-GSRANSILRDKSSLISFPLHPVSTNNINNNNSNEKAQPPSDQDTNT 429

Query: 421 SNFELHHRTSNSVDSQEARMELEISGALPDTNPTTPTSYTNDQHSYKSDNFVNSTNLIDA 480
           +N       SN  +      +   SG        +  S   ++ S  S ++  + NLI A
Sbjct: 430 NNSSSSIAVSNIREEHSPHADGVFSGI-----SLSNVSDRLERLSNTSKHYTTAVNLIQA 484

Query: 481 RVPVYGRLFSDELSELTDTFNTMTDELDRHYALLEDRVRARTKQLXXXXXXXXXXXXXKT 540
           RVP Y  LF DELS+LT+TFNTMTD LD+HYALLE+RVRARTKQL             KT
Sbjct: 485 RVPSYRALFKDELSDLTETFNTMTDALDQHYALLEERVRARTKQLEAAKIEAETANEAKT 544

Query: 541 VFIANISHELRTPLNGILGMTAISMAEKDMQKVQNSLKLIFRSGXXXXXXXXXXXXFSKN 600
           VFIANISHELRTPLNGILGMTAISM E D+ K++NSLKLIFRSG            FSKN
Sbjct: 545 VFIANISHELRTPLNGILGMTAISMEETDIDKIRNSLKLIFRSGELLLHILTELLTFSKN 604

Query: 601 VLQRTKLEERNFAIMDVALQVKSIFGKLAKDQHVNLSIILSPNVIRTMILWGDSNRIIQI 660
           VL+RTKLE+RNF I DVALQ+KSIFGK+AKDQHV LSIILSPN+IR+M+L+GDSNRIIQI
Sbjct: 605 VLKRTKLEKRNFCITDVALQIKSIFGKVAKDQHVRLSIILSPNMIRSMVLYGDSNRIIQI 664

Query: 661 VMNLVSNALKFSPVDGKVGVRIKLLGEYDGKKSKDSNYNDVFIKPGTEIPDASASKSSLS 720
           VMNLVSNALKF+PVDGKV VR+K+LG YD   S+  N+N V++KPGTEI D++ S +   
Sbjct: 665 VMNLVSNALKFTPVDGKVDVRMKVLGLYDEALSEKYNHNKVYVKPGTEITDSTPSLN--- 721

Query: 721 TLEYTKVDAIQRRLASKSSDSQKLKEEPIASSDVSSSDGKDESEAXXXXXXXKRXXXXXX 780
                        + S+     K   +  + ++ SS    D +                 
Sbjct: 722 -------------VKSEGQGKDKFTSDTASKNNTSSDTAYDATPTTDRVAQESDEDNMYE 768

Query: 781 XXXXXXXXXXXXYDDAILHAQLRKVPSCGNGEDSGDSLGRKLEISKTWVIAIEVEDTGPG 840
                       YDDAI ++Q +K  +  + ED    +G +LE  KTWVI+ EVED+GPG
Sbjct: 769 DNESMISSTTSSYDDAIFNSQFKKTTNLYD-EDDESEMGVELETPKTWVISFEVEDSGPG 827

Query: 841 IEPALHESVFEPFVQGDQTLSRQYGGTGLGLSICRQLAKMMKGTMKLESKVGVGSKFTFT 900
           I+  L ESVFEPFVQGDQTLSRQYGGTGLGLSICRQLA MMKG M LESKVGVGSKFTFT
Sbjct: 828 IDKGLQESVFEPFVQGDQTLSRQYGGTGLGLSICRQLAGMMKGKMLLESKVGVGSKFTFT 887

Query: 901 VPLTQTREVSFDDVENPFEDEFNAHSXXXXXXXXXXXXXSGGSKSRPSVNTS 952
           +PLTQTRE++F +VE+PFEDEFNA S                 KSR S+ T+
Sbjct: 888 LPLTQTREINFANVEDPFEDEFNAKSKKNRKVKFRMARSLNSRKSRSSIVTA 939

 Score =  206 bits (525), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 94/125 (75%), Positives = 107/125 (85%)

Query: 1005 FKILVAEDNNVNQEVVKRMLNLEGLSDIDLACDGQEAFDKVKALQEANDHYRIIFMDVQM 1064
            +KILVAEDN+VNQEV+KRML LEG+ DIDLACDGQ+AFDKVK LQ+    Y +IFMDVQM
Sbjct: 1065 YKILVAEDNHVNQEVIKRMLQLEGVKDIDLACDGQDAFDKVKQLQDKGSRYNLIFMDVQM 1124

Query: 1065 PRVDGLLSTKMIRQELRYSHPIVALTAFADDSNIKVCLDSGMNGFLSKPIKRPKLKSVLS 1124
            P+VDGL STKMIR +L    PIVALTAFADDSNIK CLD+GM+GFLSKPIKR KLK++L 
Sbjct: 1125 PKVDGLTSTKMIRHDLHCDFPIVALTAFADDSNIKECLDAGMDGFLSKPIKRTKLKTILK 1184

Query: 1125 EFCPD 1129
            EFC D
Sbjct: 1185 EFCSD 1189

>Kpol_1043.68 s1043 (141962..145090) [3129 bp, 1042 aa] {ON}
            (141962..145090) [3129 nt, 1043 aa]
          Length = 1042

 Score =  966 bits (2498), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 517/1123 (46%), Positives = 691/1123 (61%), Gaps = 99/1123 (8%)

Query: 12   KPPFKVGIRTQXXXXXXXXXXXXXXXXXXTTGVYFTANYKSLRADRLHVAAQLKSSQIDQ 71
            K P+KV +RTQ                  +TGVYFT NY+ LR  +L++AA+LKSSQIDQ
Sbjct: 11   KAPYKVKLRTQLTTLVCFVAIISLLILAISTGVYFTKNYRDLRLQQLYIAARLKSSQIDQ 70

Query: 72   NLNYLYYQCYWLSTRDTLQDSLIRYRAGNTTKENWSEAEIVLEKFLGSSDLFSVARIYDS 131
             +N LYYQC WL+ RD ++ +L  Y AGN + ENW+    VL  FL SS +F    +YDS
Sbjct: 71   TINLLYYQCVWLTRRDEIESALTDYTAGNRSAENWASTSDVLSTFLESSVVFLTTTLYDS 130

Query: 132  TFKTVLNATNNGSGNLVPEHVLTNLFPLSTDDPLASSLQTSGILTDPVLNDTVYVMSMSL 191
             F  +LN TNN + + +P+ VL++L PLS  D L S L T+G+LTDPVLND+ Y+MSMSL
Sbjct: 131  QFNLILNETNNETNDYIPDDVLSHLLPLSGTDSLPSYLGTTGLLTDPVLNDSTYLMSMSL 190

Query: 192  PIFASPSIMLTNSEISGYITVVMSAESLKIVFNDTTALDKSDVAILSAEYSNQSLPVSYH 251
            PI A+PS+ L++S + GY+TVVMSAE+++ V NDTTAL+KS VA++S+  +N +    YH
Sbjct: 191  PIIANPSVTLSDSRVFGYLTVVMSAETIRAVVNDTTALEKSIVAVISSTNTNGTSGQEYH 250

Query: 252  FVFPPHGVGADIIDYSFTIENGSFIQSAFDDRKSGSVKRTSFFYGKDVAVGYSPCLFKQV 311
            FVFPPHG   DI++ ++ +EN +F+  AF   + GS+ ++   Y K VA+GY PC F   
Sbjct: 251  FVFPPHGASDDIVNTAYPVENSTFLSDAFSSPEGGSINKSKSLYSKAVAIGYWPCSFGLA 310

Query: 312  QWVAVISQPENVFLSPSTRLTNIIIGTALGIAVFMCLVTFPLAHWAVKPIVRLQKATEII 371
             WV  +SQPE+VF+S S +LT II GT + I VF+C++TFPL+ W+V+PIVRLQKATE+I
Sbjct: 311  NWVGTVSQPEHVFMSSSIKLTKIIAGTVIAITVFVCVITFPLSRWSVQPIVRLQKATEVI 370

Query: 372  TARRGLRSYNQSAPASRTNSFRKRPSTSSSIGSVFRTITDRPHERDNGH--SNFELHHRT 429
            + R G   +  ++ +S  ++F     +                 +D  H  S++ L+   
Sbjct: 371  SKRDGNEVHRSNSSSSSRSTFSSNRRS-----------------KDGRHNSSSYNLY--- 410

Query: 430  SNSVDSQEARMELEISGALPDTNPTTPTSYTNDQHSYKSDNFVNSTNLIDARVPVYGRLF 489
                  ++     EI  A   T   +  + T D  S  S   V   NL D +VP   R  
Sbjct: 411  ------EDVEKYTEIGKANKSTESLSKENIT-DYSSSNSSAIVMRKNLADFQVPASRRFV 463

Query: 490  SDELSELTDTFNTMTDELDRHYALLEDRVRARTKQLXXXXXXXXXXXXXKTVFIANISHE 549
             DELSELT+T+  MTD LD H  LLE RV+ RTKQL             KTVFIAN++HE
Sbjct: 464  KDELSELTETYKLMTDALDEHSQLLEYRVKERTKQLEAAKIEAESANEAKTVFIANVTHE 523

Query: 550  LRTPLNGILGMTAISMAEKDMQKVQNSLKLIFRSGXXXXXXXXXXXXFSKNVLQRTKLEE 609
            LRTPLNGILGMTAI+M E DM+++Q+SLKLI+RSG            FSKNVL++TKLE+
Sbjct: 524  LRTPLNGILGMTAIAMEETDMERIQSSLKLIYRSGELLLHILTELLTFSKNVLKQTKLEK 583

Query: 610  RNFAIMDVALQVKSIFGKLAKDQHVNLSIILSPNVIRTMILWGDSNRIIQIVMNLVSNAL 669
             +F ++D+ALQ++SIFGK++KDQHV LSI + PN +R+M+LWGD NRI+Q++MNLVSNAL
Sbjct: 584  THFCVIDLALQIESIFGKISKDQHVKLSIFILPNKLRSMVLWGDQNRILQVIMNLVSNAL 643

Query: 670  KFSPVDGKVGVRIKLLGEYDGKKSKDSNYNDVFIKPGTEIPDASASK-SSLSTLEYTK-V 727
            KF+PVDGK+ V IKLLGEYD  +S   NY DV++K   EI +++  K   L TL  +K  
Sbjct: 644  KFTPVDGKITVNIKLLGEYDKDRSAAENYKDVYMK---EIRNSNGDKIKPLMTLISSKDT 700

Query: 728  DAIQRRLASKS--SDSQKLKEEPIASSDVSSSDGKDESEAXXXXXXXKRXXXXXXXXXXX 785
             ++   +++KS  SD+++     I S+   +     ++                      
Sbjct: 701  MSVADNISNKSVASDTERSTNNTIYSNKFKNGSNFQDT---------------------- 738

Query: 786  XXXXXXXYDDAILHAQLRKVPSCGNGEDSGDSLGRKLEISKTWVIAIEVEDTGPGIEPAL 845
                    DDAI                     G  L+  + WVI++EVEDTGPGIEP+L
Sbjct: 739  --------DDAI---------------------GVPLDKKRKWVISVEVEDTGPGIEPSL 769

Query: 846  HESVFEPFVQGDQTLSRQYGGTGLGLSICRQLAKMMKGTMKLESKVGVGSKFTFTVPLTQ 905
             +SVFEPFVQGDQTLSRQYGGTGLGLSICRQLA +M GTMKLES+VGVGSKF FTVPL Q
Sbjct: 770  QKSVFEPFVQGDQTLSRQYGGTGLGLSICRQLANLMHGTMKLESEVGVGSKFIFTVPLLQ 829

Query: 906  TREVSFDDVENPFEDEFNAHSXXXXXXXXXXXXXSGGSKSRPSVNTSLNSGTDSTAEKMA 965
            TRE+ F+  E  FEDEFN +S                +     VN   NSG +    K  
Sbjct: 830  TREIEFNGNELVFEDEFNINSKKNREVKFQEI-----TDEVDQVNIEGNSGVEVEPGKCT 884

Query: 966  LXXXXXXXXXXXXDRPFLQXXXXXXXXXXXXXVKSLERPFKILVAEDNNVNQEVVKRMLN 1025
                         +                  +K   + FK+L+ EDN VNQ VV RML 
Sbjct: 885  -------EPKKSTESESQAVVPSKSSQEMGNSIKYDVKNFKLLIVEDNKVNQLVVIRMLK 937

Query: 1026 LEGLSDIDLACDGQEAFDKVKALQEANDHYRIIFMDVQMPRVDGLLSTKMIRQELRYSHP 1085
            LEG+ +  +ACDGQEA +K+K +Q   ++Y ++ MD+QMP+VDG+ +TK+IRQEL+Y  P
Sbjct: 938  LEGIENFTIACDGQEAVEKIKEIQSRGEYYGLVLMDIQMPKVDGITATKIIRQELKYDKP 997

Query: 1086 IVALTAFADDSNIKVCLDSGMNGFLSKPIKRPKLKSVLSEFCP 1128
            IVALTAFADDSNI+ C  SGM+GFL+KPIKR +LK +L+EFCP
Sbjct: 998  IVALTAFADDSNIQACYKSGMDGFLAKPIKREQLKGILTEFCP 1040

>Smik_9.22 Chr9 complement(47449..51141) [3693 bp, 1230 aa] {ON}
           YIL147C (REAL)
          Length = 1230

 Score =  957 bits (2475), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 521/963 (54%), Positives = 653/963 (67%), Gaps = 65/963 (6%)

Query: 8   RSKLKPPFKVGIRTQXXXXXXXXXXXXXXXXXXTTGVYFTANYKSLRADRLHVAAQLKSS 67
           +S+  PPF++GIR Q                  TTGVYFT+NYK+LR+DRL++AAQLKSS
Sbjct: 8   KSEFTPPFRIGIRAQLTALVSIVALVSLIILAVTTGVYFTSNYKNLRSDRLYIAAQLKSS 67

Query: 68  QIDQNLNYLYYQCYWLSTRDTLQDSLIRYRAGNTTKENWSEAEIVLEKFLGSSDLFSVAR 127
           QIDQ LNYLYYQ Y+L++RD LQ SL  + AGN + +NW ++  V++KFL SS+LF VA+
Sbjct: 68  QIDQTLNYLYYQAYYLASRDALQSSLTSFVAGNKSADNWVDSLSVVQKFLSSSNLFYVAK 127

Query: 128 IYDSTFKTVLNATNNGSGNLVPEHVLTNLFPLSTDDPLASSLQTSGILTDPVLNDTVYVM 187
           +YDS+F TVLNATNNG+G+L+PE VL +LFPLSTD PL SSL+T+GILTDPV+N+T Y+M
Sbjct: 128 VYDSSFTTVLNATNNGTGDLIPEDVLDSLFPLSTDTPLPSSLETTGILTDPVVNNTDYLM 187

Query: 188 SMSLPIFASPSIMLTNSEISGYITVVMSAESLKIVFNDTTALDKSDVAILSAEYSNQSLP 247
           SMSLPIFA+PSI+LT+S + GYIT++MSAE LK VFNDTTAL+KS+VAI+SA Y+NQ   
Sbjct: 188 SMSLPIFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEKSNVAIISALYNNQGKA 247

Query: 248 VSYHFVFPPHGVGADIIDYSFTIENGSFIQSAFDDRKSGSVKRTSFFYGKDVAVGYSPCL 307
             YHF+FPP+G  + +    F+I+N +FI SAF + K GS+K+T+ F  K++A+GYSPC 
Sbjct: 248 SGYHFIFPPYGTASTLTQSVFSIKNNTFISSAFRNGKGGSLKQTNSFGIKNLALGYSPCS 307

Query: 308 FKQVQWVAVISQPENVFLSPSTRLTNIIIGTALGIAVFMCLVTFPLAHWAVKPIVRLQKA 367
           F+ V WVAV+SQPE+VFLSP+T+L  II GT + I VF+ L+T PLAHWAV+PIVRLQKA
Sbjct: 308 FQLVNWVAVVSQPESVFLSPATKLAKIITGTVIAIGVFVILLTLPLAHWAVQPIVRLQKA 367

Query: 368 TEIITARRGLRSYNQSAP--ASRTNSFRKRPSTSSSIGSVFRTITDRPHERDNGHSN--- 422
           TE+IT  RGLR    S P   SR +SF++        GS F T+     + + G S    
Sbjct: 368 TELITEGRGLRP---STPRTVSRASSFKR------GFGSGF-TVPSSLLQFNTGESGSTI 417

Query: 423 ---------------FELHHRTSNSVD-SQEARMELEISGALPDTNP------------- 453
                          F       ++++   E  +  E    +P+ N              
Sbjct: 418 SASGHGGSGHGSGAAFSTESSMKSAINLGNEKLLPSEDEKKIPNNNTDAKVSMDGSLNHD 477

Query: 454 -TTPTSYTN---DQHSYKSDNFVNSTNLIDARVPVYGRLFSDELSELTDTFNTMTDELDR 509
              P S  N   D+ S +S     S NL +AR+P Y RLFSDELS+LT+TFNTMTD LD+
Sbjct: 478 LLAPNSLRNNDTDRSSNRSHILTTSANLTEARLPDYRRLFSDELSDLTETFNTMTDALDQ 537

Query: 510 HYALLEDRVRARTKQLXXXXXXXXXXXXXKTVFIANISHELRTPLNGILGMTAISMAEKD 569
           HYALLEDRVRARTKQL             KTVFIANISHELRTPLNGILGMTAISM E D
Sbjct: 538 HYALLEDRVRARTKQLEAAKIEAEAANEAKTVFIANISHELRTPLNGILGMTAISMEETD 597

Query: 570 MQKVQNSLKLIFRSGXXXXXXXXXXXXFSKNVLQRTKLEERNFAIMDVALQVKSIFGKLA 629
           + K++NSLKLIFRSG            FSKNVLQRTKLE+R+F I DVALQ+KSIFGK+A
Sbjct: 598 VNKIRNSLKLIFRSGELLLHILTELLTFSKNVLQRTKLEKRDFCITDVALQIKSIFGKVA 657

Query: 630 KDQHVNLSIILSPNVIRTMILWGDSNRIIQIVMNLVSNALKFSPVDGKVGVRIKLLGEYD 689
           KDQ V LSI L PN+IRTM+LWGDSNRIIQIVMNLVSNALKF+PVDG V VR+KLLGEYD
Sbjct: 658 KDQRVRLSISLFPNLIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVDVRMKLLGEYD 717

Query: 690 GKKSKDSNYNDVFIKPGTEIPDASASKSS----LSTLEYTKVDAIQRRLASKSSDSQKLK 745
              S+   + +V +K GTEI + S   +     +S+     VD      +  S+    + 
Sbjct: 718 KDLSEKKQFKEVHVKRGTEITEYSEETNKCDIPISSNHRKHVDLESTTTSITSNRDTSII 777

Query: 746 EEPIASSDVSSSDG--KDESEAXXXXXXXKRXXXXXXXXXXXXXXXXXXYDDAILHAQLR 803
           +E I   + ++++   K  ++A                           YDDAI ++Q  
Sbjct: 778 QEEITKRNTAANENIYKRMNDAEKLSSDDV---------SSIVSTTTSSYDDAIFNSQFN 828

Query: 804 KVPSCGNGEDSGDSLGRKLEISKTWVIAIEVEDTGPGIEPALHESVFEPFVQGDQTLSRQ 863
           K P  G+ ED G +LG+ +E  KTWVI+IEVEDTGPGI+P+L ESVF PFVQGDQTLSRQ
Sbjct: 829 KAP--GSDEDEGGNLGKPIENPKTWVISIEVEDTGPGIDPSLQESVFHPFVQGDQTLSRQ 886

Query: 864 YGGTGLGLSICRQLAKMMKGTMKLESKVGVGSKFTFTVPLTQTREVSFDDVENPFEDEFN 923
           YGGTGLGLSICRQLA MM GTM+LESKVGVGSKFTFT+PL QT+E+SF +++ PFEDEFN
Sbjct: 887 YGGTGLGLSICRQLANMMNGTMRLESKVGVGSKFTFTLPLPQTKEISFANMDFPFEDEFN 946

Query: 924 AHS 926
             S
Sbjct: 947 PES 949

 Score =  215 bits (548), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 102/159 (64%), Positives = 122/159 (76%), Gaps = 3/159 (1%)

Query: 979  DRPFLQXXXXXXXXXXXXXVKSLER---PFKILVAEDNNVNQEVVKRMLNLEGLSDIDLA 1035
            DRPFLQ             ++  ++     KILV EDN+VNQEV+KRMLNLEG+ +I+LA
Sbjct: 1060 DRPFLQSTGTATSSRNVPTIQDNDKNDTSIKILVVEDNHVNQEVIKRMLNLEGIENIELA 1119

Query: 1036 CDGQEAFDKVKALQEANDHYRIIFMDVQMPRVDGLLSTKMIRQELRYSHPIVALTAFADD 1095
            CDGQEAFDKVK L     +Y +IFMDVQMP+VDGLLSTKMIR++L Y  PIVALTAFADD
Sbjct: 1120 CDGQEAFDKVKELTSKGGNYNMIFMDVQMPKVDGLLSTKMIRRDLGYKSPIVALTAFADD 1179

Query: 1096 SNIKVCLDSGMNGFLSKPIKRPKLKSVLSEFCPDFVEKR 1134
            SNIK CL+SGMNGFLSKPIKRPKLK++L+EFC  +  K+
Sbjct: 1180 SNIKECLESGMNGFLSKPIKRPKLKTILTEFCAAYQGKK 1218

>YIL147C Chr9 complement(69791..73453) [3663 bp, 1220 aa] {ON}
           SLN1Histidine kinase osmosensor that regulates a MAP
           kinase cascade; transmembrane protein with an
           intracellular kinase domain that signals to Ypd1p and
           Ssk1p, thereby forming a phosphorelay system similar to
           bacterial two-component regulators
          Length = 1220

 Score =  953 bits (2463), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 518/953 (54%), Positives = 650/953 (68%), Gaps = 49/953 (5%)

Query: 10  KLKPPFKVGIRTQXXXXXXXXXXXXXXXXXXTTGVYFTANYKSLRADRLHVAAQLKSSQI 69
           +L PPF++GIRTQ                  TTGVYFT+NYK+LR+DRL++AAQLKSSQI
Sbjct: 10  ELTPPFRIGIRTQLTALVSIVALGSLIILAVTTGVYFTSNYKNLRSDRLYIAAQLKSSQI 69

Query: 70  DQNLNYLYYQCYWLSTRDTLQDSLIRYRAGNTTKENWSEAEIVLEKFLGSSDLFSVARIY 129
           DQ LNYLYYQ Y+L++RD LQ SL  Y AGN + +NW ++  V++KFL SS+LF VA++Y
Sbjct: 70  DQTLNYLYYQAYYLASRDALQSSLTSYVAGNKSADNWVDSLSVIQKFLSSSNLFYVAKVY 129

Query: 130 DSTFKTVLNATNNGSGNLVPEHVLTNLFPLSTDDPLASSLQTSGILTDPVLNDTVYVMSM 189
           DS+F  VLNATNNG+G+L+PE VL +LFPLSTD PL SSL+T GILTDPVLN T Y+MSM
Sbjct: 130 DSSFNAVLNATNNGTGDLIPEDVLDSLFPLSTDTPLPSSLETIGILTDPVLNSTDYLMSM 189

Query: 190 SLPIFASPSIMLTNSEISGYITVVMSAESLKIVFNDTTALDKSDVAILSAEYSNQSLPVS 249
           SLPIFA+PSI+LT+S + GYIT++MSAE LK VFNDTTAL+ S +AI+SA Y++Q     
Sbjct: 190 SLPIFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEHSTIAIISAVYNSQGKASG 249

Query: 250 YHFVFPPHGVGADIIDYSFTIENGSFIQSAFDDRKSGSVKRTSFFYGKDVAVGYSPCLFK 309
           YHFVFPP+G  +D+    F+I+N +FI SAF + K GS+K+T+    ++ A+GYSPC F 
Sbjct: 250 YHFVFPPYGSRSDLPQKVFSIKNDTFISSAFRNGKGGSLKQTNILSTRNTALGYSPCSFN 309

Query: 310 QVQWVAVISQPENVFLSPSTRLTNIIIGTALGIAVFMCLVTFPLAHWAVKPIVRLQKATE 369
            V WVA++SQPE+VFLSP+T+L  II GT + I VF+ L+T PLAHWAV+PIVRLQKATE
Sbjct: 310 LVNWVAIVSQPESVFLSPATKLAKIITGTVIAIGVFVILLTLPLAHWAVQPIVRLQKATE 369

Query: 370 IITARRGLRSYNQSAP--ASRTNSFRKRPSTSSSIGSVF-----------RTITDRPHER 416
           +IT  RGLR    S P   SR +SF++  S+  ++ S              +++      
Sbjct: 370 LITEGRGLRP---STPRTISRASSFKRGFSSGFAVPSSLLQFNTAEAGSTTSVSGHGGSG 426

Query: 417 DNGHSNFELHHRTSNSVDSQEARM----------------ELEISGALPD--TNPTTPTS 458
               + F  +    ++++    +M                ++ + G+L      P +   
Sbjct: 427 HGSGAAFSANSSMKSAINLGNEKMSPPEEENKIPNNHTDAKISMDGSLNHDLLGPHSLRH 486

Query: 459 YTNDQHSYKSDNFVNSTNLIDARVPVYGRLFSDELSELTDTFNTMTDELDRHYALLEDRV 518
              D+ S +S     S NL +AR+P Y RLFSDELS+LT+TFNTMTD LD+HYALLE+RV
Sbjct: 487 NDTDRSSNRSHILTTSANLTEARLPDYRRLFSDELSDLTETFNTMTDALDQHYALLEERV 546

Query: 519 RARTKQLXXXXXXXXXXXXXKTVFIANISHELRTPLNGILGMTAISMAEKDMQKVQNSLK 578
           RARTKQL             KTVFIANISHELRTPLNGILGMTAISM E D+ K++NSLK
Sbjct: 547 RARTKQLEAAKIEAEAANEAKTVFIANISHELRTPLNGILGMTAISMEETDVNKIRNSLK 606

Query: 579 LIFRSGXXXXXXXXXXXXFSKNVLQRTKLEERNFAIMDVALQVKSIFGKLAKDQHVNLSI 638
           LIFRSG            FSKNVLQRTKLE+R+F I DVALQ+KSIFGK+AKDQ V LSI
Sbjct: 607 LIFRSGELLLHILTELLTFSKNVLQRTKLEKRDFCITDVALQIKSIFGKVAKDQRVRLSI 666

Query: 639 ILSPNVIRTMILWGDSNRIIQIVMNLVSNALKFSPVDGKVGVRIKLLGEYDGKKSKDSNY 698
            L PN+IRTM+LWGDSNRIIQIVMNLVSNALKF+PVDG V VR+KLLGEYD + S+   Y
Sbjct: 667 SLFPNLIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVDVRMKLLGEYDKELSEKKQY 726

Query: 699 NDVFIKPGTEIPD--ASASKSSLSTL-EYTKVDAIQRRLASKSS--DSQKLKEEPIASSD 753
            +V+IK GTE+ +   +  K  L TL  + K   ++    S  S  D+  ++EE    + 
Sbjct: 727 KEVYIKKGTEVTENLETTDKYDLPTLSNHRKSVDLESSATSLGSNRDTSTIQEEITKRNT 786

Query: 754 VSSSDGKDESEAXXXXXXXKRXXXXXXXXXXXXXXXXXXYDDAILHAQLRKVPSCGNGED 813
           V+     +ES          R                  YD+AI ++Q  K P  G+ ++
Sbjct: 787 VA-----NES---IYKKVNDREKASNDDVSSIVSTTTSSYDNAIFNSQFNKAP--GSDDE 836

Query: 814 SGDSLGRKLEISKTWVIAIEVEDTGPGIEPALHESVFEPFVQGDQTLSRQYGGTGLGLSI 873
            G +LGR +E  KTWVI+IEVEDTGPGI+P+L ESVF PFVQGDQTLSRQYGGTGLGLSI
Sbjct: 837 EGGNLGRPIENPKTWVISIEVEDTGPGIDPSLQESVFHPFVQGDQTLSRQYGGTGLGLSI 896

Query: 874 CRQLAKMMKGTMKLESKVGVGSKFTFTVPLTQTREVSFDDVENPFEDEFNAHS 926
           CRQLA MM GTMKLESKVGVGSKFTFT+PL QT+E+SF D+E PFEDEFN  S
Sbjct: 897 CRQLANMMHGTMKLESKVGVGSKFTFTLPLNQTKEISFADMEFPFEDEFNPES 949

 Score =  221 bits (563), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 106/161 (65%), Positives = 125/161 (77%), Gaps = 3/161 (1%)

Query: 979  DRPFLQXXXXXXXXXXXXXVK---SLERPFKILVAEDNNVNQEVVKRMLNLEGLSDIDLA 1035
            DRPFLQ             VK     E   KILV EDN+VNQEV+KRMLNLEG+ +I+LA
Sbjct: 1059 DRPFLQSTGTATSSRNIPTVKDDDKNETSVKILVVEDNHVNQEVIKRMLNLEGIENIELA 1118

Query: 1036 CDGQEAFDKVKALQEANDHYRIIFMDVQMPRVDGLLSTKMIRQELRYSHPIVALTAFADD 1095
            CDGQEAFDKVK L    ++Y +IFMDVQMP+VDGLLSTKMIR++L Y+ PIVALTAFADD
Sbjct: 1119 CDGQEAFDKVKELTSKGENYNMIFMDVQMPKVDGLLSTKMIRRDLGYTSPIVALTAFADD 1178

Query: 1096 SNIKVCLDSGMNGFLSKPIKRPKLKSVLSEFCPDFVEKRNS 1136
            SNIK CL+SGMNGFLSKPIKRPKLK++L+EFC  +  K+N+
Sbjct: 1179 SNIKECLESGMNGFLSKPIKRPKLKTILTEFCAAYQGKKNN 1219

>Suva_9.41 Chr9 complement(64510..68166) [3657 bp, 1219 aa] {ON}
           YIL147C (REAL)
          Length = 1219

 Score =  947 bits (2447), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 517/955 (54%), Positives = 640/955 (67%), Gaps = 49/955 (5%)

Query: 8   RSKLKPPFKVGIRTQXXXXXXXXXXXXXXXXXXTTGVYFTANYKSLRADRLHVAAQLKSS 67
           RS   PPF++ IR Q                  TTGVYFT+NYK+LR+DRL++AAQLKSS
Sbjct: 8   RSVFTPPFRISIRAQLTALVSIVALISLVILAVTTGVYFTSNYKNLRSDRLYIAAQLKSS 67

Query: 68  QIDQNLNYLYYQCYWLSTRDTLQDSLIRYRAGNTTKENWSEAEIVLEKFLGSSDLFSVAR 127
           QIDQ LNYLYYQ Y+L++RD LQ+SL  Y AGN + +NW ++  +++KFL SS+LF VA+
Sbjct: 68  QIDQTLNYLYYQAYYLASRDALQNSLTGYVAGNKSSDNWVDSVSIVQKFLSSSNLFFVAK 127

Query: 128 IYDSTFKTVLNATNNGSGNLVPEHVLTNLFPLSTDDPLASSLQTSGILTDPVLNDTVYVM 187
           +YDS+F TVLNATNNG+G+L+P+ +   LFPLSTD  L SSL+T+GILTDP+LN T Y+M
Sbjct: 128 VYDSSFTTVLNATNNGTGDLIPKDISDELFPLSTDMALPSSLETTGILTDPILNSTDYLM 187

Query: 188 SMSLPIFASPSIMLTNSEISGYITVVMSAESLKIVFNDTTALDKSDVAILSAEYSNQSLP 247
           SMSLPIFA+PSI+LT+S + GYIT++MSAE LK VFNDTTAL+KS+VAI+SA Y+NQS  
Sbjct: 188 SMSLPIFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEKSNVAIISAVYNNQSKA 247

Query: 248 VSYHFVFPPHGVGADIIDYSFTIENGSFIQSAFDDRKSGSVKRTSFFYGKDVAVGYSPCL 307
            +YHFVFPP+G  + I    F I+N +FI SAF + K GS+K+T+ F  K++A+GYSPC 
Sbjct: 248 YAYHFVFPPYGTSSSITKTIFPIKNNTFISSAFKNGKGGSLKKTNSFGIKNLALGYSPCS 307

Query: 308 FKQVQWVAVISQPENVFLSPSTRLTNIIIGTALGIAVFMCLVTFPLAHWAVKPIVRLQKA 367
           F+ V WVAV+SQPE+VFLSPST+L  II GT + I VF+ L+T PLAHWAV+PIVRLQKA
Sbjct: 308 FQLVNWVAVVSQPESVFLSPSTKLAKIITGTVIAIGVFVILLTLPLAHWAVQPIVRLQKA 367

Query: 368 TEIITARRGLRSYNQSAP--ASRTNSFRKRPSTSSSIGSVFRTITDRPHERDNGHSNFEL 425
           TE+IT  RGLR    S P   SRT+SF++  S+  ++ S                S    
Sbjct: 368 TELITEGRGLRP---STPRTVSRTSSFKRGFSSGFAVPSSLLQFNSGEAGSTTSASGHGC 424

Query: 426 HHRTSNSVDSQEARMELEISGALPDTNP-----TTPTSYTNDQ--------HSYKSDN-- 470
             R S +V S ++ M+  ++      +P      TP  + N +        H   + N  
Sbjct: 425 SGRGSAAVMSTDSSMKSAMNIGNEKLSPLEEEKRTPNDHNNAKISMDGSLNHDLLAPNAL 484

Query: 471 --------------FVNSTNLIDARVPVYGRLFSDELSELTDTFNTMTDELDRHYALLED 516
                            S NL +AR+P Y RLFSDELS+LT+TFNTMTD LD+HYALLED
Sbjct: 485 RHSDNDRSSSRSHILTTSANLTEARLPDYRRLFSDELSDLTETFNTMTDALDQHYALLED 544

Query: 517 RVRARTKQLXXXXXXXXXXXXXKTVFIANISHELRTPLNGILGMTAISMAEKDMQKVQNS 576
           RVRARTKQL             KTVFIANISHELRTPLNGILGMTAISM E D+ K++NS
Sbjct: 545 RVRARTKQLEAAKIEAEAANEAKTVFIANISHELRTPLNGILGMTAISMEETDVNKIRNS 604

Query: 577 LKLIFRSGXXXXXXXXXXXXFSKNVLQRTKLEERNFAIMDVALQVKSIFGKLAKDQHVNL 636
           LKLIFRSG            FSKNVLQRTKLE+R+F I DVALQ+KSIFGK+AKDQ V L
Sbjct: 605 LKLIFRSGELLLHILTELLTFSKNVLQRTKLEKRDFCITDVALQIKSIFGKVAKDQRVRL 664

Query: 637 SIILSPNVIRTMILWGDSNRIIQIVMNLVSNALKFSPVDGKVGVRIKLLGEYDGKKSKDS 696
           SI L PN IRTM+LWGDSNRIIQIVMNLVSNALKF+PVDG V VR+KLLGEYD + S+  
Sbjct: 665 SISLFPNFIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVEVRMKLLGEYDKELSEKK 724

Query: 697 NYNDVFIKPGTEIPDASASKSSLSTLEYTKVDAIQRRLASKSSDSQKLKEEPIASSDVSS 756
            + +V ++ GTEI +   +          K DA +     KS DS+       ++ D S+
Sbjct: 725 QFKEVHVRKGTEIIEDIGN--------INKHDAKKSENFKKSMDSESTTTSMTSNRDTST 776

Query: 757 -----SDGKDESEAXXXXXXXKRXXXXXXXXXXXXXXXXXXYDDAILHAQLRKVPSCGNG 811
                +     +          R                  YDDAI ++Q  K  + G+ 
Sbjct: 777 IQEEITKRNTAANENIYKKTRDREKSSNDDISSIVSTSTSSYDDAIFNSQFNK--ALGSD 834

Query: 812 EDSGDSLGRKLEISKTWVIAIEVEDTGPGIEPALHESVFEPFVQGDQTLSRQYGGTGLGL 871
           +D G  LG+ +E  KTW I+IEVEDTGPGI+P+L ESVF PFVQGDQTLSRQYGGTGLGL
Sbjct: 835 DDEGGDLGKPIENPKTWAISIEVEDTGPGIDPSLQESVFHPFVQGDQTLSRQYGGTGLGL 894

Query: 872 SICRQLAKMMKGTMKLESKVGVGSKFTFTVPLTQTREVSFDDVENPFEDEFNAHS 926
           SICRQLA MM GTMKLESKVGVGSKFTFT+PL QT+E+SF ++  PFEDEFN  S
Sbjct: 895 SICRQLANMMHGTMKLESKVGVGSKFTFTLPLHQTKEISFANMNFPFEDEFNPES 949

 Score =  213 bits (543), Expect = 9e-56,   Method: Compositional matrix adjust.
 Identities = 102/159 (64%), Positives = 122/159 (76%), Gaps = 3/159 (1%)

Query: 979  DRPFLQXXXXXXXXXXXXXVKSLERP---FKILVAEDNNVNQEVVKRMLNLEGLSDIDLA 1035
            DRPFLQ             V + ++     KILV EDN+VNQEV+KRMLNLEG+ +I+LA
Sbjct: 1060 DRPFLQSTGTATSNRNIPTVSNSDKSDSSIKILVVEDNHVNQEVIKRMLNLEGIENIELA 1119

Query: 1036 CDGQEAFDKVKALQEANDHYRIIFMDVQMPRVDGLLSTKMIRQELRYSHPIVALTAFADD 1095
            CDGQ+AFDKVK L    + Y +IFMDVQMP+VDGLLSTKMIR++L Y+ PIVALTAFADD
Sbjct: 1120 CDGQDAFDKVKELTSRGESYNMIFMDVQMPKVDGLLSTKMIRRDLGYTSPIVALTAFADD 1179

Query: 1096 SNIKVCLDSGMNGFLSKPIKRPKLKSVLSEFCPDFVEKR 1134
            SNIK CL+SGMNGFLSKPIKRPKLK++L EFC  +  K+
Sbjct: 1180 SNIKECLESGMNGFLSKPIKRPKLKTILIEFCAAYQGKK 1218

>TPHA0E00250 Chr5 complement(34875..38081) [3207 bp, 1068 aa] {ON}
            Anc_5.700 YIL147C
          Length = 1068

 Score =  935 bits (2416), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 519/1136 (45%), Positives = 685/1136 (60%), Gaps = 90/1136 (7%)

Query: 4    IGHLRSKLKPPFKVGIRTQXXXXXXXXXXXXXXXXXXTTGVYFTANYKSLRADRLHVAAQ 63
            + +LR    PP+ + +R Q                  +TGVYFT NYKSLRA++L +AAQ
Sbjct: 3    LKNLRLATSPPYPMNLRAQLITLCCIVSIISLLILSISTGVYFTNNYKSLRAEQLFIAAQ 62

Query: 64   LKSSQIDQNLNYLYYQCYWLSTRDTLQDSLIRYRAGNTTKENWSEAEIVLEKFLGSSDLF 123
            LKSSQ+DQ+LNYLYYQ  W    D L D+LIRY +GN T ENW E+   +  FL SS +F
Sbjct: 63   LKSSQLDQSLNYLYYQSIWFRDNDVLTDALIRYFSGNKTTENWVESISSVSAFLTSSSIF 122

Query: 124  SVARIYDSTFKTVLNATNNGSGNLVPEHVLTNLFPLSTDDPLASSLQTSGILTDPVLNDT 183
            S A IYD+ F  + N +NNG+G  +P+ ++  L PLS+D+ L +S+ T G LTDPVLN +
Sbjct: 123  SRATIYDTNFMEIYNVSNNGTGAHIPDDIIRQLTPLSSDERLPASIGTIGFLTDPVLNTS 182

Query: 184  VYVMSMSLPIFASPSIMLTNSEISGYITVVMSAESLKIVFNDTTALDKSDVAILSAEYSN 243
             Y+MS+SLPIF +PSI+L++S + GY+T++  A S+  VFNDTTAL+ S+VAI+SA+Y N
Sbjct: 183  NYLMSLSLPIFGNPSIILSDSRVYGYVTIITGASSIVAVFNDTTALENSNVAIISAKYRN 242

Query: 244  QSLPV-SYHFVFPPHGVGADIIDYSFTIENGSFIQSAFDDRKSGSVKRTSFFYGKDVAVG 302
             +     YHFVFPP+G  A +ID  + + N SF+  AF +  +GSV  T+FFY   VAVG
Sbjct: 243  STTYADGYHFVFPPYGSDASVIDIFYPLSNNSFLFDAFTEDTTGSVSSTTFFYSSLVAVG 302

Query: 303  YSPCLFKQVQWVAVISQPENVFLSPSTRLTNIIIGTALGIAVFMCLVTFPLAHWAVKPIV 362
            YS C F    WVAV+SQPE+VF S + +LT II GT +GIA  +C VTF ++++ VKPI+
Sbjct: 303  YSTCTFSLANWVAVVSQPESVFTSSTVKLTKIISGTVVGIAAVVCFVTFIMSYYIVKPII 362

Query: 363  RLQKATEIITARRGLRSY--NQSAPASRTNSFRKRPSTSSSIG-SVFRTITDRPHERDNG 419
            +L++ATE+I+  RGLR Y  N S   S+ N+     ST ++I  S     T+   +    
Sbjct: 363  KLKQATELISRGRGLRPYYENLSDRTSQDNT-----STRTTIDLSDLDGYTNEKEKSLPT 417

Query: 420  HSNFELHHRTSNSVDSQEARMELEISGALPDTNPTTPTSYTNDQHSYKSDNFVNSTNLID 479
             +  E     SN           +I G    +   +PTS           NF+ + +   
Sbjct: 418  CTEDERSKSLSNIASKSIFTTLRKILGFSSRSGMLSPTS----------TNFIVNNDTKT 467

Query: 480  ARVPVYGRLFSDELSELTDTFNTMTDELDRHYALLEDRVRARTKQLXXXXXXXXXXXXXK 539
             RVPV+    +DEL+EL +TFN M D LD H  LLE+RV+ARTK+L             K
Sbjct: 468  VRVPVHSTYITDELTELKETFNIMADSLDEHSNLLEERVKARTKELEAAKIVAEATNEAK 527

Query: 540  TVFIANISHELRTPLNGILGMTAISMAEKDMQKVQNSLKLIFRSGXXXXXXXXXXXXFSK 599
            TVFIANISHELRTPLNGILGMTAI++ E D +K+Q SLKLI+RSG            FSK
Sbjct: 528  TVFIANISHELRTPLNGILGMTAIALEEDDNEKLQGSLKLIYRSGELLLHILTELLTFSK 587

Query: 600  NVLQRTKLEERNFAIMDVALQVKSIFGKLAKDQHVNLSIILSPNVIRTMILWGDSNRIIQ 659
            NVLQ+TKLE+ +F I D+ALQ+KSIFGK+AKDQ VN SI++SPN+IRTM+ +GDSNRIIQ
Sbjct: 588  NVLQKTKLEKIHFCIHDIALQIKSIFGKIAKDQGVNFSILISPNLIRTMVFFGDSNRIIQ 647

Query: 660  IVMNLVSNALKFSPVDGKVGVRIKLLGEYDGKKSKDSNYNDVFIKPGTEIP---DASASK 716
            ++MNLVSNALKF+P+DG V VRIKLLGEYD +KS  +NY+ V+IK GT      DA  ++
Sbjct: 648  VIMNLVSNALKFTPIDGNVDVRIKLLGEYDEEKSSLNNYDKVYIKEGTSFTGDNDAIPTE 707

Query: 717  SSLSTLEYTKVDAIQRRLASKSSDSQKLKEEPIASSDVSSSDGKDESEAXXXXXXXKRXX 776
                 + +    +      SK+ ++  +K E I S D + SD  +E+             
Sbjct: 708  PISDKISFAGGSSSIHDYCSKTDENDNIKTE-IKSDDSTISDYSEEN------------- 753

Query: 777  XXXXXXXXXXXXXXXXYDDAILHAQLRKVPSCGNGEDSGDSLGRKLEISKTWVIAIEVED 836
                                I+ +         N     + LG  +   K WVI+++VED
Sbjct: 754  --------------------IMGSYYE------NKNPGQELLGVPIPKPKKWVISVDVED 787

Query: 837  TGPGIEPALHESVFEPFVQGDQTLSRQYGGTGLGLSICRQLAKMMKGTMKLESKVGVGSK 896
            TGPGI P L +SVFEPFVQGDQTLSRQYGGTGLGLSICRQLA +M GTM+L+S  G+GSK
Sbjct: 788  TGPGISPTLQKSVFEPFVQGDQTLSRQYGGTGLGLSICRQLASIMHGTMELDSTTGLGSK 847

Query: 897  FTFTVPLTQTREVSFDDVENPFEDEFNAHSXXXXXXXXXXXXX------SGGSKSRPSVN 950
            FTFTVPL Q R++ F + E  FEDEFN +S                   S  ++     N
Sbjct: 848  FTFTVPLLQERKIIFSETEKAFEDEFNFNSKKNRKVNFKTDKVTSRGIPSKAAEKNDDAN 907

Query: 951  TSLNSGTDSTAEKMALXXXXXXXXXXXXDRPFLQXXXXXXXXXXXXXVKSLERPFKILVA 1010
            T+  +  ++ A+   L            D                      +  FK+L+ 
Sbjct: 908  TNGQTTLNAEAKSKTLKPTHITISEDNID----------------------QHDFKVLIV 945

Query: 1011 EDNNVNQEVVKRMLNLEGLSDIDLACDGQEAFDKVKALQEANDHYRIIFMDVQMPRVDGL 1070
            EDN VNQEV+KR+L LE +  I+ A DGQEA D VK      D + IIFMD+QMP VDG 
Sbjct: 946  EDNMVNQEVIKRLLKLEKIKTIEYAVDGQEAIDIVKKKISEKDKFDIIFMDIQMPNVDGH 1005

Query: 1071 LSTKMIRQELRYSHPIVALTAFADDSNIKVCLDSGMNGFLSKPIKRPKLKSVLSEF 1126
             +T++IR EL Y +PIVALTAFADDSN K C +SGMN FL+KPIKR +LK ++ EF
Sbjct: 1006 TATRVIRNELNYPYPIVALTAFADDSNKKECENSGMNAFLAKPIKRFELKEIIKEF 1061

>TBLA0E02100 Chr5 (513016..516438) [3423 bp, 1140 aa] {ON} Anc_5.700
            YIL147C
          Length = 1140

 Score =  838 bits (2166), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 490/1149 (42%), Positives = 670/1149 (58%), Gaps = 48/1149 (4%)

Query: 8    RSKLKPPFKVGIRTQXXXXXXXXXXXXXXXXXXTTGVYFTANYKSLRADRLHVAAQLKSS 67
            +  +KPP++  +R Q                   TGVYFT +YK L  +RL++A+QLKSS
Sbjct: 14   KQTVKPPYRFSLRAQLTILVCIVAIISLTTLAIITGVYFTTHYKDLNVNRLYIASQLKSS 73

Query: 68   QIDQNLNYLYYQCYWLSTRDTLQDSLIRYRAGNTTKENWSEAEIVLEKFLGSSDLFSVAR 127
            QIDQ LNYLYYQCYW+++R+T+Q  +     G        E++ VL+KF+G+SDLF    
Sbjct: 74   QIDQTLNYLYYQCYWVASRNTIQTMVFSNHTGMHNASGIIESQSVLDKFVGTSDLFYYTM 133

Query: 128  IYDSTFKTVLNATNNGSGNLVPEHVLTNLFPLS-TDDPLASSLQTSGILTDPVLNDTVYV 186
            IYD   K+++N+TNN SG+ V   +L+ L PLS T+  +   +  +GILTDP+LN T Y+
Sbjct: 134  IYDKNLKSIMNSTNNESGSNVEPSILSRLLPLSSTNTTIPPLINNTGILTDPILNSTKYL 193

Query: 187  MSMSLPI---FASPSIMLTNSEISGYITVVMSAESLKIVFNDTTALDKSDVAILSAEYSN 243
            MSMSLPI   +++ + +   S I GY+TVVMSAESLK VFNDT  L  S  A+LSA Y+N
Sbjct: 194  MSMSLPISGPYSTATKIGNQSNIYGYLTVVMSAESLKSVFNDTAGLSDSTTALLSAIYTN 253

Query: 244  QSLPVSYHFVFPPHGVGADIIDYSFTIENGSFIQSAFDDRKSGSVKRTSFFYGKDVAVGY 303
             +LP  +HFVFPP  +   IID   TI+NG+F   AFD  KSGS K+      K+ A+GY
Sbjct: 254  DTLPRYFHFVFPPFDLDDSIIDERQTIKNGTFQYRAFDKNKSGSKKKVKLVNKKNYAIGY 313

Query: 304  SPCLFKQVQWVAVISQPENVFLSPSTRLTNIIIGTALGIAVFMCLVTFPLAHWAVKPIVR 363
            +P  F   +WVAV++ P++ F S S +LT II GT +GIAVF+ L++ PL++WAV+PIVR
Sbjct: 314  APTNFPLCKWVAVVALPDHQFYSESRKLTKIICGTVVGIAVFVFLISLPLSYWAVQPIVR 373

Query: 364  LQKATEIITARRGLRSYNQSAPASRTNSFRKRPSTSSSIGSVFRTITDRPHERDNGHSNF 423
            LQ+A+E+IT RRGLR+                    S+    + +  D  +E     S  
Sbjct: 374  LQRASELITKRRGLRN------------LNDDSFDDSNDDHTYDSNDDHTYESKLISSTP 421

Query: 424  ELHHRTSNSVDSQEARMELEI-SGALPDTNPTTPTSYTNDQHSYKSD----NFVNSTNLI 478
             L +  SN  D +  R   +  SG L   N  T  +   D +  + +      V+ +   
Sbjct: 422  TLKNSDSNIHDEKSGRTRGDANSGTLNSNNTITNNTNNKDFNRLRRNVSVSTHVSLSEFD 481

Query: 479  DARVPVYGRLFSDELSELTDTFNTMTDELDRHYALLEDRVRARTKQLXXXXXXXXXXXXX 538
            + +VPVY +LF DEL+ELTDTFN M++ LD HYALLE RV  RTKQL             
Sbjct: 482  EIQVPVYRKLFDDELTELTDTFNVMSNALDEHYALLEKRVHQRTKQLEAAKVQAEAANEA 541

Query: 539  KTVFIANISHELRTPLNGILGMTAISMAEKDMQKVQNSLKLIFRSGXXXXXXXXXXXXFS 598
            KTVFIANISHELRTPLNGILGMT+ S+ E D++K+++ LKLIFRSG            FS
Sbjct: 542  KTVFIANISHELRTPLNGILGMTSTSLEENDIKKIKDGLKLIFRSGELLLNILTELLTFS 601

Query: 599  KNVLQRTKLEERNFAIMDVALQVKSIFGKLAKDQHVNLSIILSPN-VIRTMILWGDSNRI 657
            KNVL +TKLE R F I+++  Q+K+IF KL + Q V L I L P   +++++ +GDSNRI
Sbjct: 602  KNVLNKTKLEYREFNIIEITSQIKTIFNKLIQLQEVKLFIRLLPKKFLKSLLFYGDSNRI 661

Query: 658  IQIVMNLVSNALKFSP-VDGKVGVRIKLLGEYDGKKSKDSNYNDVFIKPG----TEIPDA 712
            +Q++MNL+SNA+KF+P V+GKV V + LLGEYD ++SK  NY+ V IKP     TE  + 
Sbjct: 662  LQVLMNLISNAIKFTPTVNGKVEVNMYLLGEYDEEESKTENYSKVCIKPSTQIVTESGEL 721

Query: 713  SASKSSLSTLEYTKVDAIQRRLAS---KSSDSQKLKEEPIASSDVSSSDGKDESEAXXXX 769
              SK      + T          S   +S+ +Q L       S  S ++ +  +      
Sbjct: 722  IKSKIRCKITKSTTNMNTATTNNSARIESNTNQYL-------SPYSHTNTRTHTHPGADS 774

Query: 770  XXXKRXXXXXXXXXXXXXXXXXXYDDAILHAQLRKVPSCGNGEDSGDSLGRKLEISKTWV 829
                                   YD+ + +   R +   G+G+ +      ++E +K WV
Sbjct: 775  RRNSNVSTVNNSSISLDSESSKMYDNLMFN---RLIKREGDGDINDIKALEQIEGNKKWV 831

Query: 830  IAIEVEDTGPGIEPALHESVFEPFVQGDQTLSRQYGGTGLGLSICRQLAKMMKGTMKLES 889
            I  EV D GPGI+  LH+SVF+PFVQGDQTLSRQYGGTGLGLSIC+QL +MMKGT++LES
Sbjct: 832  IRFEVIDNGPGIDQNLHDSVFKPFVQGDQTLSRQYGGTGLGLSICKQLCEMMKGTLELES 891

Query: 890  KVGVGSKFTFTVPLTQTREVSFDDVENPFEDEFNAHSXXXXXXXXXX-XXXSGGSKSRPS 948
            ++G GSKF +T+PL Q      D+ +N  +   N +S              +  S++   
Sbjct: 892  ELGKGSKFIYTIPLLQVGGTKKDNDDNEEDHNDNTNSSVDIDIIEDTPVSITSSSQTHSD 951

Query: 949  VNTSLNSGTDSTAEKMALXXXXXXXXXXXXDRPFLQXXXXXXXXXXXXXV-------KSL 1001
            +N+  ++ T+      +             D+  LQ             +       K +
Sbjct: 952  LNSLQSNSTNEVGLDDSFSEAENDSTVASLDKSVLQKTRMDAQKVEANEIDDIDHCNKGI 1011

Query: 1002 ERPFKILVAEDNNVNQEVVKRMLNLEGLSDIDLACDGQEAFDKVKALQEANDHYRIIFMD 1061
                K+LVAEDN VNQEV+KRML LE +SDI+LA DG EAF+KVK    +   Y IIFMD
Sbjct: 1012 PSKLKVLVAEDNLVNQEVIKRMLKLENISDIELAFDGIEAFEKVKKNLLSYKKYDIIFMD 1071

Query: 1062 VQMPRVDGLLSTKMIRQELRYSHPIVALTAFADDSNIKVCLDSGMNGFLSKPIKRPKLKS 1121
            +QMP++DGL ST  IRQEL+Y   IVALTAFAD+SNIK C D+GM+GF+ KPIKR  L +
Sbjct: 1072 IQMPKMDGLESTTKIRQELKYEGKIVALTAFADESNIKECRDAGMDGFIEKPIKRVALHT 1131

Query: 1122 VLSEFCPDF 1130
            +L EF  D 
Sbjct: 1132 LLEEFQQDL 1140

>KLTH0E01100g Chr5 complement(106377..109910) [3534 bp, 1177 aa]
           {ON} similar to uniprot|P39928 Saccharomyces cerevisiae
           YIL147C SLN1 Histidine kinase osmosensor that regulates
           a MAP kinase cascade; transmembrane protein with an
           intracellular kinase domain that signals to Ypd1p and
           Ssk1p, thereby forming a phosphorelay system similar to
           bacterial two-component regulators
          Length = 1177

 Score =  808 bits (2086), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 439/766 (57%), Positives = 535/766 (69%), Gaps = 19/766 (2%)

Query: 5   GHLRSKLKPPFKVGIRTQXXXXXXXXXXXXXXXXXXTTGVYFTANYKSLRADRLHVAAQL 64
            + + KLKPPF + IRTQ                   TGVYFT+++KS+RA+RL+VA+QL
Sbjct: 11  AYAKRKLKPPFLISIRTQLTALVCLVALLSLIILAVITGVYFTSSFKSMRAERLYVASQL 70

Query: 65  KSSQIDQNLNYLYYQCYWLSTRDTLQDSLIRYRAGNTTKENWSEAEIVLEKFLGSSDLFS 124
           K+SQIDQNL YLYYQCY+LSTRD LQ++L +Y AGNTT ENW++A   L+KFLGSS+LFS
Sbjct: 71  KASQIDQNLYYLYYQCYYLSTRDVLQNALTQYLAGNTTTENWADAVTTLDKFLGSSNLFS 130

Query: 125 VARIYDSTFKTVLNATNNGSGNLVPEHVLTNLFPLSTDDPLASSLQTSGILTDPVLNDTV 184
           +AR+YDS+F+ VLNA+NN SGNLVPE VLT LFPLST+  L SSL+  G+LTDPVLNDT 
Sbjct: 131 LARVYDSSFQDVLNASNNASGNLVPESVLTQLFPLSTNVSLPSSLEVKGMLTDPVLNDTG 190

Query: 185 YVMSMSLPIFASPSIMLTNSEISGYITVVMSAESLKIVFNDTTALDKSDVAILSAEYSNQ 244
           Y+MSMSLPIFA+PSI+L+ S++ GYITVV+SAE LK VFNDTTAL+ S V ++S  Y N+
Sbjct: 191 YLMSMSLPIFANPSIILSTSKVYGYITVVISAEGLKTVFNDTTALEDSSVILVSTVYDNR 250

Query: 245 SLPVSYHFVFPPHGVGADIIDYSFTIENGSFIQSAFDDRKSGSVKRTSFFYGKDVAVGYS 304
            L   YH VFPP+G+ +DIID  +TI N SF+  AF   K GS+K T F Y K VA+GYS
Sbjct: 251 EL-AGYHLVFPPYGMPSDIIDKRYTIGNDSFLMDAFKQSKGGSIKSTHFLYSKAVAIGYS 309

Query: 305 PCLFKQVQWVAVISQPENVFLSPSTRLTNIIIGTALGIAVFMCLVTFPLAHWAVKPIVRL 364
           PC    VQWVA+I+QPE+ FL PSTRL  II+GT + IAV  C VTFPL+HWAV+PIVRL
Sbjct: 310 PCSSDLVQWVAIITQPESKFLYPSTRLARIIVGTCVAIAVVTCAVTFPLSHWAVQPIVRL 369

Query: 365 QKATEIITARRGLRSYNQSAPASRTNSFRKRPSTSSSIGSVFRTITDRPH---ERDNGHS 421
           QKATEIITA RGLRS N S   S      KR ST+ S  S     + R      R + H 
Sbjct: 370 QKATEIITAGRGLRSDNGSTLYSH-----KRSSTAESFSSALHPASIRRSGSVARSSKHK 424

Query: 422 NF-ELHHRTSNSVDSQEAR---MELEISGALPDTNPTTPTSYTNDQHSYKSDNFVNSTNL 477
              E    T N  D +E +   +E     AL   +  TP S  ++Q S +S+ ++ STNL
Sbjct: 425 YIPESAKGTLNKNDFEEIQPDGIENNEDAALQKVHSPTPGSLFSEQRSARSERYITSTNL 484

Query: 478 IDARVPVYGRLFSDELSELTDTFNTMTDELDRHYALLEDRVRARTKQLXXXXXXXXXXXX 537
           I+ARVP Y RLFSDELSELT+TFNTMTDELDRHYALLEDRVRART+QL            
Sbjct: 485 IEARVPTYNRLFSDELSELTETFNTMTDELDRHYALLEDRVRARTRQLEAAKIEAEGANE 544

Query: 538 XKTVFIANISHELRTPLNGILGMTAISMAEKDMQKVQNSLKLIFRSGXXXXXXXXXXXXF 597
            KTVFIANISHELRTPLNGILGMTAI+MAE DMQKV++SLKLIFRSG            F
Sbjct: 545 AKTVFIANISHELRTPLNGILGMTAIAMAENDMQKVKSSLKLIFRSGELLLHIMTELLTF 604

Query: 598 SKNVLQRTKLEERNFAIMDVALQVKSIFGKLAKDQHVNLSIILSPNVIRTMILWGDSNRI 657
           SKNVL+RTKLEER+F + ++ALQV+SIFGKLAKDQHVNL+I + PNV+RTM+LWGDSNRI
Sbjct: 605 SKNVLKRTKLEERDFTVHEIALQVESIFGKLAKDQHVNLTISIIPNVLRTMVLWGDSNRI 664

Query: 658 IQIVMNLVSNALKFSPVDGKVGVRIKLLGEYDGKKSKDSNYNDVFIKPGTEIPDASASKS 717
           +QIVMNLVSNALKF+PVDG+V V+  LLGEYD  K+ +  ++   + P  E      S+ 
Sbjct: 665 VQIVMNLVSNALKFTPVDGRVNVKFTLLGEYDESKASNGCFDRAAVVPIQE------SEK 718

Query: 718 SLSTLEYTKVDAIQRRLASKSSDSQKLKEEPIASSDVSSSDGKDES 763
             STL  T+   I+    S SS +      P  S   + S  +  S
Sbjct: 719 ESSTLGPTEKGGIKDVTESASSSNATWPPSPSTSETSNGSKAETTS 764

 Score =  402 bits (1033), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 207/349 (59%), Positives = 244/349 (69%), Gaps = 14/349 (4%)

Query: 793  YDDAILHAQLRKVPSCGNGEDSGDSLGRKLEISKTWVIAIEVEDTGPGIEPALHESVFEP 852
            YDDAI H++LRK    GN  ++ D  GR LE  +   IA+EV+DTGPGIEPAL ESVFEP
Sbjct: 837  YDDAIFHSRLRK----GNSGENED--GRPLEHPRRLAIAMEVQDTGPGIEPALQESVFEP 890

Query: 853  FVQGDQTLSRQYGGTGLGLSICRQLAKMMKGTMKLESKVGVGSKFTFTVPLTQTREVSFD 912
            FVQGDQTLSRQYGGTGLGLSICRQLA MM G+M L+SKVGVGSKFTFTVPLTQT+E+ F+
Sbjct: 891  FVQGDQTLSRQYGGTGLGLSICRQLAAMMNGSMSLDSKVGVGSKFTFTVPLTQTKELCFE 950

Query: 913  DVENPFEDEFNAHSXXXXXXXXXXXXXSGGSKSRPSVNTSLNS-GTDSTAEKMALXXXXX 971
            + ENPFEDEFN  S             +   KS  S +   +S GT + +E         
Sbjct: 951  EDENPFEDEFNPDSKKNRKVKFKVSKNNKRKKSHSSSSGQNSSVGTPTVSES------EV 1004

Query: 972  XXXXXXXDRPFLQXXXXXXXXXXXXXVKSLERPFKILVAEDNNVNQEVVKRMLNLEGLSD 1031
                   DRPFLQ               S+    K+LVAEDNNVNQEV+KRMLNLEGL D
Sbjct: 1005 SVGSVRVDRPFLQSTGTALSTRSVTTT-SVANKCKVLVAEDNNVNQEVIKRMLNLEGLDD 1063

Query: 1032 IDLACDGQEAFDKVKALQEANDHYRIIFMDVQMPRVDGLLSTKMIRQELRYSHPIVALTA 1091
            +DLACDGQ+AFDKVKA  EA   Y +IFMDVQMPRVDGL +T+MIR EL Y+HPIVALTA
Sbjct: 1064 VDLACDGQDAFDKVKARNEAGKFYDLIFMDVQMPRVDGLSATRMIRNELSYTHPIVALTA 1123

Query: 1092 FADDSNIKVCLDSGMNGFLSKPIKRPKLKSVLSEFCPDFVEKRNSNKAK 1140
            +ADD NIK C+D+GMNGFL+KPI+RPK+K +LSE+CP + +     K K
Sbjct: 1124 YADDRNIKECIDAGMNGFLAKPIRRPKIKEILSEYCPTYFKADGEKKGK 1172

>NDAI0F00310 Chr6 complement(66930..70709) [3780 bp, 1259 aa] {ON}
           Anc_5.700 YIL147C
          Length = 1259

 Score =  518 bits (1335), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 274/480 (57%), Positives = 327/480 (68%), Gaps = 26/480 (5%)

Query: 463 QHSYKSDNFVNSTNLIDARVPVYGRLFSDELSELTDTFNTMTDELDRHYALLEDRVRART 522
           + S KS +   S NLI+ARVP Y RLFSDELS+LTDTFNTMTD LD+HYALLEDRVRART
Sbjct: 512 EFSTKSGHLTTSANLIEARVPDYRRLFSDELSDLTDTFNTMTDALDQHYALLEDRVRART 571

Query: 523 KQLXXXXXXXXXXXXXKTVFIANISHELRTPLNGILGMTAISMAEKDMQKVQNSLKLIFR 582
           KQL             KTVFIANISHELRTPLNGILGMTAISM E D+ K+++SLKLIFR
Sbjct: 572 KQLEAAKIEAERANEAKTVFIANISHELRTPLNGILGMTAISMEETDISKIRSSLKLIFR 631

Query: 583 SGXXXXXXXXXXXXFSKNVLQRTKLEERNFAIMDVALQVKSIFGKLAKDQHVNLSIILSP 642
           SG            FSKNVL+RT LE+R+F I DVALQ+KSIFGK+AKDQ V LSI L+P
Sbjct: 632 SGELLLHILTELLTFSKNVLKRTTLEKRDFCITDVALQIKSIFGKVAKDQRVKLSITLTP 691

Query: 643 NVIRTMILWGDSNRIIQIVMNLVSNALKFSPVDGKVGVRIKLLGEYDGKKSKDSNYNDVF 702
           N IRTM+L+GDSNRIIQIVMNLVSNALKF+PVDGKV V++KL+GEYD   S  +N+ +V+
Sbjct: 692 NTIRTMVLYGDSNRIIQIVMNLVSNALKFTPVDGKVNVKVKLIGEYDEALSAKNNFKEVY 751

Query: 703 IKPGTEI----------------PDASASKSSLSTLEYTKVDAIQRRLASKSSDSQKLKE 746
           +K GTE+                P +  + SS +T      ++       KS+D   L +
Sbjct: 752 VKQGTELLGCSNPIEKTNESIPSPKSENNNSSSTTSGKDTTNSETSFEDEKSADD--LDD 809

Query: 747 EPIASSDVSSSDGKDESEAXXXXXXXKRXXXXXXXXXXXXXXXXXXYDDAILHAQLRKVP 806
           E IA+ D        E+E                            YDDAI ++Q +K P
Sbjct: 810 EKIATKDA-------ENENTDDTENLDEQTDSVCDNISLVSTSTSSYDDAIFNSQFKKSP 862

Query: 807 SCGNGEDSGDSLGRKLEISKTWVIAIEVEDTGPGIEPALHESVFEPFVQGDQTLSRQYGG 866
              + +++ D+ G  +E  KTWVI I VEDTGPGI+  L ESVF+PFVQGDQTLSRQYGG
Sbjct: 863 GLYDDDENNDA-GVLIEDPKTWVIQISVEDTGPGIDKTLQESVFQPFVQGDQTLSRQYGG 921

Query: 867 TGLGLSICRQLAKMMKGTMKLESKVGVGSKFTFTVPLTQTREVSFDDVENPFEDEFNAHS 926
           TGLGLSICRQLA MM GTMKL+S+VGVGS FTFTVPL QTRE++FDD+E+PFEDEFN  S
Sbjct: 922 TGLGLSICRQLANMMHGTMKLKSEVGVGSTFTFTVPLKQTREINFDDMEHPFEDEFNPES 981

 Score =  488 bits (1257), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 235/392 (59%), Positives = 300/392 (76%), Gaps = 2/392 (0%)

Query: 11  LKPPFKVGIRTQXXXXXXXXXXXXXXXXXXTTGVYFTANYKSLRADRLHVAAQLKSSQID 70
           LKPPF++GIR Q                  TTGVYFTANYK+LR+DRL++AAQLKSSQID
Sbjct: 9   LKPPFRIGIRAQLTALVSIVACVSLMILAITTGVYFTANYKNLRSDRLYIAAQLKSSQID 68

Query: 71  QNLNYLYYQCYWLSTRDTLQDSLIRYRAGNTTKENWSEAEIVLEKFLGSSDLFSVARIYD 130
           Q LNYLYYQCY++S+RDTLQ +L  Y AGN + ENW+++  +L+KFL SS+LFSVA++YD
Sbjct: 69  QTLNYLYYQCYYVSSRDTLQYALTNYVAGNKSNENWADSASILQKFLSSSNLFSVAKVYD 128

Query: 131 STFKTVLNATNNGSGNLVPEHVLTNLFPLSTDDPLASSLQTSGILTDPVLNDTVYVMSMS 190
           ++F TVLN TNNG+G+ +P+ +L  L PLST+ PL+SSL+T+GILTDPVLN + Y+MSMS
Sbjct: 129 ASFTTVLNVTNNGTGDQIPDSILAKLLPLSTNIPLSSSLETTGILTDPVLNSSTYLMSMS 188

Query: 191 LPIFASPSIMLTNSEISGYITVVMSAESLKIVFNDTTALDKSDVAILSAEYSNQSLPVSY 250
           LPIFA+PS++L  S + GY+TVVMSAE L+ VFNDTTAL+KS+VAI+SA Y+N S   +Y
Sbjct: 189 LPIFANPSVILAESRVYGYLTVVMSAEGLRTVFNDTTALEKSNVAIVSAVYNNVSALTAY 248

Query: 251 HFVFPPHGVGADIIDYSFTIENGSFIQSAFDDRKSGSVKRTSFFYGKDVAVGYSPCLFKQ 310
            FVF P G  + II+ ++ + NGSF+ SA  + K GS+K T FFY K+VA+GYSPC F  
Sbjct: 249 RFVFAPMGAPSYIINSTYRLTNGSFLSSALREGKGGSLKSTKFFYSKNVAIGYSPCTFSF 308

Query: 311 VQWVAVISQPENVFLSPSTRLTNIIIGTALGIAVFMCLVTFPLAHWAVKPIVRLQKATEI 370
           V WVAV+SQ E+VFLSPST+L  II GT + I VF+ ++TFPLAHWAVKPIVRLQKATE+
Sbjct: 309 VNWVAVVSQAESVFLSPSTKLAKIIAGTVVAIGVFVFIMTFPLAHWAVKPIVRLQKATEL 368

Query: 371 ITARRGLRSYN-QSAPASRTNSFRKRPSTSSS 401
           I+  RGL+S N  S   SR NS  K PS ++S
Sbjct: 369 ISEGRGLKSTNPDSRSVSRNNSL-KLPSRNTS 399

 Score =  226 bits (577), Expect = 7e-60,   Method: Compositional matrix adjust.
 Identities = 108/158 (68%), Positives = 123/158 (77%), Gaps = 6/158 (3%)

Query: 979  DRPFLQXXXXXXXXXXXXXVKSL---ERP---FKILVAEDNNVNQEVVKRMLNLEGLSDI 1032
            DRPFLQ             +      E P    KILVAEDN+VNQEV+KRMLNLEG++ I
Sbjct: 1097 DRPFLQSTGTATSSRNVPVLSESNKDEDPAQNIKILVAEDNHVNQEVIKRMLNLEGVNKI 1156

Query: 1033 DLACDGQEAFDKVKALQEANDHYRIIFMDVQMPRVDGLLSTKMIRQELRYSHPIVALTAF 1092
            DLACDGQEAFDKVK L E ND Y IIFMDVQMP+VDGLLSTKMIR++L Y HPIVALTAF
Sbjct: 1157 DLACDGQEAFDKVKTLSEQNDSYNIIFMDVQMPKVDGLLSTKMIRKDLHYDHPIVALTAF 1216

Query: 1093 ADDSNIKVCLDSGMNGFLSKPIKRPKLKSVLSEFCPDF 1130
            ADDSNIK CL+SGMNGFLSKPIKRPKL++++ E+CP +
Sbjct: 1217 ADDSNIKECLESGMNGFLSKPIKRPKLRTIIKEYCPGW 1254

>TBLA0I01680 Chr9 (372270..375914) [3645 bp, 1214 aa] {ON} Anc_5.700
           YIL147C
          Length = 1214

 Score =  501 bits (1289), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 266/455 (58%), Positives = 318/455 (69%), Gaps = 13/455 (2%)

Query: 475 TNLIDARVPVYGRLFSDELSELTDTFNTMTDELDRHYALLEDRVRARTKQLXXXXXXXXX 534
           + +++ +VPVY RLF DELSELTDTFNTM+D LD+HYALLE+RVRARTKQL         
Sbjct: 472 STILETKVPVYRRLFLDELSELTDTFNTMSDALDQHYALLEERVRARTKQLEAAKIEAEA 531

Query: 535 XXXXKTVFIANISHELRTPLNGILGMTAISMAEKDMQKVQNSLKLIFRSGXXXXXXXXXX 594
               KTVFIANISHELRTPLNGILGMTAISM E D+  +++SLKLIFRSG          
Sbjct: 532 ANEAKTVFIANISHELRTPLNGILGMTAISMEEDDIDNIKSSLKLIFRSGELLLHILTEL 591

Query: 595 XXFSKNVLQRTKLEERNFAIMDVALQVKSIFGKLAKDQHVNLSIILSPNVIRTMILWGDS 654
             FSKNVLQRTKLEER+F I DVALQ+KSIFGK+AKDQHV LSI L PN IRT++LWGDS
Sbjct: 592 LTFSKNVLQRTKLEERDFCITDVALQIKSIFGKVAKDQHVKLSIYLIPNEIRTLVLWGDS 651

Query: 655 NRIIQIVMNLVSNALKFSPVDGKVGVRIKLLGEYDGKKSKDSNYNDVFIKPGTEIPDASA 714
           NRIIQIVMNLVSNALKF+P+DGKV VR+ LLGEYD +KSK ++Y +VF+K GTE P+ + 
Sbjct: 652 NRIIQIVMNLVSNALKFTPIDGKVSVRMSLLGEYDKEKSKAADYKEVFVKTGTE-PEENY 710

Query: 715 SKSSLSTLEYTKVDAIQRRLASKSSDSQKLKEEPIASSDVSSSDGKDESEAXXXXXXXKR 774
           SK  L  L   K+ A +   +++S D+++   E I   +   S+    S          R
Sbjct: 711 SK-ILQKLNTEKLIATR---SARSCDNEERHNELIGEKNDIISNNHQSSNTTFDISIHNR 766

Query: 775 XXXXXXXXXXXXXXXXXXYDDAILHAQLRKVPSCGNGEDSGDSLGRKLEISKTWVIAIEV 834
                             YD+ + + Q +K+   G  +   + LG +++  KTWVI IEV
Sbjct: 767 ---TRDDTLSLLSTSTSSYDETVFNDQFKKI--TGLQDHDEERLGVEIKEPKTWVICIEV 821

Query: 835 EDTGPGIEPALHESVFEPFVQGDQTLSRQYGGTGLGLSICRQLAKMMKGTMKLESKVGVG 894
           EDTGPGI PAL ESVFEPFVQGDQ LSRQYGGTGLGLSICRQLA MM GTM LESKVG G
Sbjct: 822 EDTGPGIHPALQESVFEPFVQGDQALSRQYGGTGLGLSICRQLATMMNGTMVLESKVGSG 881

Query: 895 SKFTFTVPLTQTREVSF---DDVENPFEDEFNAHS 926
           SKFTFTVPLTQTRE+     +D+   F+DEFN +S
Sbjct: 882 SKFTFTVPLTQTREIVIGEDEDINEFFDDEFNIYS 916

 Score =  191 bits (486), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 90/138 (65%), Positives = 112/138 (81%), Gaps = 5/138 (3%)

Query: 1008 LVAEDNNVNQEVVKRMLNLEGLSDIDLACDGQEAFDKVKALQ-----EANDHYRIIFMDV 1062
            LV EDN+VNQEV+KRML LE LS+IDLACDG+EA+ KVK +      +  ++Y +IFMDV
Sbjct: 1073 LVTEDNHVNQEVIKRMLKLEKLSNIDLACDGEEAYTKVKEITSISNPKKKNYYDLIFMDV 1132

Query: 1063 QMPRVDGLLSTKMIRQELRYSHPIVALTAFADDSNIKVCLDSGMNGFLSKPIKRPKLKSV 1122
            QMPR+DGL STK+IR EL+Y+ PIVALTAFAD+SNIK CLD GM+GFLSKPIKRPKLK +
Sbjct: 1133 QMPRMDGLESTKLIRSELKYTKPIVALTAFADESNIKECLDVGMDGFLSKPIKRPKLKDI 1192

Query: 1123 LSEFCPDFVEKRNSNKAK 1140
            L+EFCP +  + N++  K
Sbjct: 1193 LNEFCPGYHLQNNTDTNK 1210

>CAGL0H06567g Chr8 (645707..649216) [3510 bp, 1169 aa] {ON} similar to
            uniprot|P39928 Saccharomyces cerevisiae YIL147c SLN1
          Length = 1169

 Score =  226 bits (577), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 104/162 (64%), Positives = 129/162 (79%)

Query: 979  DRPFLQXXXXXXXXXXXXXVKSLERPFKILVAEDNNVNQEVVKRMLNLEGLSDIDLACDG 1038
            DRPFLQ             +  +   FKILVAEDN+VNQEV+KRMLNLEG+++IDLACDG
Sbjct: 994  DRPFLQSTGTATSSRNVPTMADVTMRFKILVAEDNHVNQEVIKRMLNLEGINNIDLACDG 1053

Query: 1039 QEAFDKVKALQEANDHYRIIFMDVQMPRVDGLLSTKMIRQELRYSHPIVALTAFADDSNI 1098
            Q+AFDKV++L E ND Y +IFMD+QMP+VDGLLSTKMIR++L Y   IVALTAFADDSNI
Sbjct: 1054 QDAFDKVQSLVEQNDSYDMIFMDIQMPKVDGLLSTKMIRRDLNYKGSIVALTAFADDSNI 1113

Query: 1099 KVCLDSGMNGFLSKPIKRPKLKSVLSEFCPDFVEKRNSNKAK 1140
            K C+++GMNGFLSKPIKRPKLK +L E+CP+++E + S + K
Sbjct: 1114 KECIEAGMNGFLSKPIKRPKLKMILEEYCPNWIEMKKSKENK 1155

 Score =  189 bits (480), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 89/117 (76%), Positives = 96/117 (82%), Gaps = 2/117 (1%)

Query: 793 YDDAILHAQLRKVPSCGNGEDSGDSLGRKLEISKTWVIAIEVEDTGPGIEPALHESVFEP 852
           YD+A+ + Q +K P     EDS D LG +L   KTWV AIEVEDTGPGI+P LHESVFEP
Sbjct: 769 YDNALFNTQFKKTPDLY--EDSNDGLGTELADQKTWVFAIEVEDTGPGIDPKLHESVFEP 826

Query: 853 FVQGDQTLSRQYGGTGLGLSICRQLAKMMKGTMKLESKVGVGSKFTFTVPLTQTREV 909
           FVQGDQTLSRQYGGTGLGLSICRQLA MM GTMKLESKVGVGSKFTFTVPL QTR +
Sbjct: 827 FVQGDQTLSRQYGGTGLGLSICRQLATMMHGTMKLESKVGVGSKFTFTVPLKQTRVI 883

>ADL388W Chr4 (30355..31803) [1449 bp, 482 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YHR206W (SKN7) and YJR147W
            (HMS2)
          Length = 482

 Score = 69.3 bits (168), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 41/132 (31%), Positives = 69/132 (52%), Gaps = 7/132 (5%)

Query: 1000 SLERPFKILVAEDNNVNQEVVKRMLNLEGLSDIDLACDGQEAFDKVKALQEANDHYRIIF 1059
            SL   F +L+ ED++V  ++  + L   G S +++  DG  A + V+  Q     Y ++ 
Sbjct: 313  SLRPGFHVLLVEDDSVCIQLCSKFLRKYGCS-VEVVTDGLSAIETVEKFQ-----YDLVL 366

Query: 1060 MDVQMPRVDGLLSTKMIRQELRYSHPIVALTAFADDSNIKVCLDSGMNGFLSKPIKRPKL 1119
            MD+ MP +DG  +T +IR       PI+A+T   +D ++   L  GMN  L+KP  +  L
Sbjct: 367  MDIVMPNLDGATATSVIR-SFDNQTPIIAMTGNIEDQDLVTYLQHGMNDILAKPFTKDDL 425

Query: 1120 KSVLSEFCPDFV 1131
             S+L  +  D +
Sbjct: 426  HSMLVRYLKDRI 437

>Ecym_7474 Chr7 (967242..968732) [1491 bp, 496 aa] {ON} similar to
            Ashbya gossypii ADL388W
          Length = 496

 Score = 69.3 bits (168), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 45/141 (31%), Positives = 76/141 (53%), Gaps = 10/141 (7%)

Query: 1003 RP-FKILVAEDNNVNQEVVKRMLNLEGLSDIDLACDGQEAFDKVKALQEANDHYRIIFMD 1061
            RP F +L+ ED++V  ++  + L   G S +++  DG  A + V+  Q     Y ++ MD
Sbjct: 326  RPGFCVLLVEDDSVCIQLCSKFLRKYGCS-VEVVTDGLSAIETVEKFQ-----YDLVLMD 379

Query: 1062 VQMPRVDGLLSTKMIRQELRYSHPIVALTAFADDSNIKVCLDSGMNGFLSKPIKRPKLKS 1121
            + MP +DG  +T +IR       PI+A+T   +D ++   L  GMN  L+KP  +  L S
Sbjct: 380  IVMPNLDGATATSVIR-SFDNQTPIIAMTGNIEDQDLVTYLQHGMNDILAKPFTKDDLHS 438

Query: 1122 VLSEFCPDFV--EKRNSNKAK 1140
            +L  +  D V   ++NS+ A+
Sbjct: 439  MLIRYLKDRVPLAEQNSSTAQ 459

>KNAG0M00180 Chr13 complement(22500..24347) [1848 bp, 615 aa] {ON}
            Anc_4.385 YJR147W
          Length = 615

 Score = 67.0 bits (162), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 39/129 (30%), Positives = 66/129 (51%), Gaps = 7/129 (5%)

Query: 1001 LERPFKILVAEDNNVNQEVVKRMLNLEGLSDIDLACDGQEAFDKVKALQEANDHYRIIFM 1060
            L + F +L+ ED+ ++ ++  + L   G + + +  DG  A   ++     N  Y ++ M
Sbjct: 399  LRKGFHVLLVEDDAISIQLCSKFLRKYGCT-VQVVTDGLSAITTLE-----NSRYDLVLM 452

Query: 1061 DVQMPRVDGLLSTKMIRQELRYSHPIVALTAFADDSNIKVCLDSGMNGFLSKPIKRPKLK 1120
            D+ MP +DG  +T +IR       PI+A+T   DD ++   L  GMN  L+KP  R  L 
Sbjct: 453  DIVMPNLDGATATSIIR-SFDNQTPIIAMTGNIDDGDLITYLQHGMNDILAKPFTRDDLH 511

Query: 1121 SVLSEFCPD 1129
            S+L  +  D
Sbjct: 512  SMLIRYLKD 520

>KAFR0B06990 Chr2 (1455520..1457157) [1638 bp, 545 aa] {ON} Anc_4.385
            YJR147W
          Length = 545

 Score = 66.6 bits (161), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 38/131 (29%), Positives = 68/131 (51%), Gaps = 7/131 (5%)

Query: 1001 LERPFKILVAEDNNVNQEVVKRMLNLEGLSDIDLACDGQEAFDKVKALQEANDHYRIIFM 1060
            L + F +L+ ED+ ++ ++  + L   G + +++  DG  A   ++  +     Y ++ M
Sbjct: 349  LRKGFHVLLVEDDAISIQLCSKFLRKYGCT-VEVVTDGLSAISTLEKFR-----YDLVLM 402

Query: 1061 DVQMPRVDGLLSTKMIRQELRYSHPIVALTAFADDSNIKVCLDSGMNGFLSKPIKRPKLK 1120
            D+ MP +DG  +T +IR       PI+A+T   +D ++   L  GMN  L+KP  R  L 
Sbjct: 403  DIVMPNLDGATATSIIR-SFDNQTPIIAMTGNIEDQDLITYLQHGMNDILAKPFTRDDLH 461

Query: 1121 SVLSEFCPDFV 1131
            S+L  +  D V
Sbjct: 462  SMLIRYLKDRV 472

>NCAS0A06450 Chr1 (1273459..1275288) [1830 bp, 609 aa] {ON} Anc_4.385
          Length = 609

 Score = 66.2 bits (160), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 40/144 (27%), Positives = 74/144 (51%), Gaps = 8/144 (5%)

Query: 998  VKSLERP-FKILVAEDNNVNQEVVKRMLNLEGLSDIDLACDGQEAFDKVKALQEANDHYR 1056
             +++ RP F +L+ ED+ V+  +  + L   G + +++  DG  A   ++  +     Y 
Sbjct: 373  AQAVLRPGFHVLLVEDDAVSIRLCSKFLRKYGCT-VEVVTDGLSAISTLEKFR-----YD 426

Query: 1057 IIFMDVQMPRVDGLLSTKMIRQELRYSHPIVALTAFADDSNIKVCLDSGMNGFLSKPIKR 1116
            ++ MD+ MP +DG  +T +IR       PI+A+T   +D ++   L  GMN  L+KP  +
Sbjct: 427  LVLMDIVMPNLDGATATSIIR-NFDNQTPIIAMTGNIEDQDLITYLQHGMNDILAKPFTK 485

Query: 1117 PKLKSVLSEFCPDFVEKRNSNKAK 1140
              L S+L  +  D +  R+  K +
Sbjct: 486  DDLHSMLIRYLKDRIPLRDQQKVQ 509

>KLLA0A10219g Chr1 (896931..898358) [1428 bp, 475 aa] {ON} similar to
            uniprot|Q75BF2 Ashbya gossypii ADL388W ADL388Wp and some
            similarites with YHR206W uniprot|P38889 Saccharomyces
            cerevisiae
          Length = 475

 Score = 64.7 bits (156), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 73/140 (52%), Gaps = 12/140 (8%)

Query: 1003 RP-FKILVAEDNNVNQEVVKRMLNLEGLSDIDLACDGQEAFDKVKALQEANDHYRIIFMD 1061
            RP F +L+ ED++V  ++  + L   G S +++  DG  A   ++        + ++ MD
Sbjct: 326  RPGFHVLLVEDDSVCIQLCSKFLRKYGCS-VEVVTDGLSAISTLEK-----QRFDLVLMD 379

Query: 1062 VQMPRVDGLLSTKMIRQELRYSHPIVALTAFADDSNIKVCLDSGMNGFLSKPIKRPKLKS 1121
            + MP +DG  +T ++R       PI+A+T   DD ++   L  GMN  L+KP  +  L S
Sbjct: 380  IVMPNLDGATATSIVR-SFDNETPIIAMTGNIDDQDLVTYLQHGMNDILAKPFTKDDLHS 438

Query: 1122 VLSEFCPDFV----EKRNSN 1137
            +L  +  D +    +++NSN
Sbjct: 439  MLIRYLKDRIPLSEQRQNSN 458

>SAKL0B12408g Chr2 (1065161..1066558) [1398 bp, 465 aa] {ON} similar
            to uniprot|Q75BF2 Ashbya gossypii ADL388W ADL388Wp and
            weakly similar to YHR206W uniprot|P38889 Saccharomyces
            cerevisiae
          Length = 465

 Score = 64.3 bits (155), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 39/130 (30%), Positives = 69/130 (53%), Gaps = 8/130 (6%)

Query: 1003 RP-FKILVAEDNNVNQEVVKRMLNLEGLSDIDLACDGQEAFDKVKALQEANDHYRIIFMD 1061
            RP F +L+ ED++V  ++  + L   G S +++  DG  A   ++  +     Y ++ MD
Sbjct: 304  RPGFHVLLVEDDSVCIQLCSKFLLKYGCS-VEVVTDGLSAISTLEKFR-----YDLVLMD 357

Query: 1062 VQMPRVDGLLSTKMIRQELRYSHPIVALTAFADDSNIKVCLDSGMNGFLSKPIKRPKLKS 1121
            + MP +DG  +T ++R       PI+A+T   +D ++   L+ GMN  L+KP  +  L S
Sbjct: 358  IVMPNLDGATATSIVRS-FDNQTPIIAMTGNIEDQDLVTYLEHGMNDILAKPFTKDDLHS 416

Query: 1122 VLSEFCPDFV 1131
            +L  +  D V
Sbjct: 417  MLIRYLKDRV 426

>CAGL0F09097g Chr6 (898706..900598) [1893 bp, 630 aa] {ON} similar to
            uniprot|P38889 Saccharomyces cerevisiae YHR206w SKN7
            transcription factor
          Length = 630

 Score = 64.7 bits (156), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 38/139 (27%), Positives = 70/139 (50%), Gaps = 7/139 (5%)

Query: 1001 LERPFKILVAEDNNVNQEVVKRMLNLEGLSDIDLACDGQEAFDKVKALQEANDHYRIIFM 1060
            L + F +L+ ED++V+ ++  + L   G + + +  DG  A   ++  +     Y ++ M
Sbjct: 401  LRKGFHVLLVEDDSVSIQLCSKFLRKYGCT-VQVVTDGLSAISNLEKFR-----YDLVLM 454

Query: 1061 DVQMPRVDGLLSTKMIRQELRYSHPIVALTAFADDSNIKVCLDSGMNGFLSKPIKRPKLK 1120
            D+ MP +DG  +T ++R       PI+A+T   +D ++   L  GMN  L+KP  R  L 
Sbjct: 455  DIVMPNLDGATATSIVR-SFDNQTPIIAMTGNIEDQDLITYLQHGMNDILAKPFTRNDLH 513

Query: 1121 SVLSEFCPDFVEKRNSNKA 1139
            S+L     D +   + N+ 
Sbjct: 514  SILIRHLKDRIPLCDQNRG 532

>TDEL0D00320 Chr4 complement(53243..54886) [1644 bp, 547 aa] {ON}
            Anc_4.385 YJR147W
          Length = 547

 Score = 63.9 bits (154), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 37/131 (28%), Positives = 69/131 (52%), Gaps = 7/131 (5%)

Query: 1001 LERPFKILVAEDNNVNQEVVKRMLNLEGLSDIDLACDGQEAFDKVKALQEANDHYRIIFM 1060
            L+  F +L+ ED+ V  ++  + L   G + +++  DG  A   ++  +     Y ++ M
Sbjct: 330  LKEGFHVLLVEDDAVCIQLCSKFLRKYGCT-VEVVTDGLSAISTLEKFR-----YDLVLM 383

Query: 1061 DVQMPRVDGLLSTKMIRQELRYSHPIVALTAFADDSNIKVCLDSGMNGFLSKPIKRPKLK 1120
            D+ MP +DG  +T ++R    ++ PI+A+T   +D ++   L  GMN  L+KP  +  L 
Sbjct: 384  DIVMPNLDGATATSIVRSFDNHT-PIIAMTGNIEDQDLITYLQHGMNDILAKPFTKDDLH 442

Query: 1121 SVLSEFCPDFV 1131
            S+L  +  D V
Sbjct: 443  SMLIRYLKDRV 453

>TBLA0A10700 Chr1 (2646036..2647799) [1764 bp, 587 aa] {ON} Anc_4.385
            YJR147W
          Length = 587

 Score = 63.5 bits (153), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 38/131 (29%), Positives = 68/131 (51%), Gaps = 7/131 (5%)

Query: 1001 LERPFKILVAEDNNVNQEVVKRMLNLEGLSDIDLACDGQEAFDKVKALQEANDHYRIIFM 1060
            L + F +L+ ED+ V  ++  + L   G + + +  DG  A   ++     N  + ++ M
Sbjct: 412  LRKGFHVLLVEDDEVCIQLCSKFLRKYGCT-VRVVTDGLTAISVLE-----NHRFDLVLM 465

Query: 1061 DVQMPRVDGLLSTKMIRQELRYSHPIVALTAFADDSNIKVCLDSGMNGFLSKPIKRPKLK 1120
            D+ MP +DG  +T ++R    Y+ PI+A+T   +D ++   L  GMN  L+KP  +  L 
Sbjct: 466  DIVMPNLDGATATSIVRNFDNYT-PIIAMTGNIEDQDLITYLQHGMNDILAKPFTKRDLH 524

Query: 1121 SVLSEFCPDFV 1131
            S+L  +  D V
Sbjct: 525  SMLVRYLRDKV 535

>ZYRO0G00484g Chr7 complement(35793..37736) [1944 bp, 647 aa] {ON}
            similar to uniprot|P38889 Saccharomyces cerevisiae
            YHR206W
          Length = 647

 Score = 63.2 bits (152), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 37/131 (28%), Positives = 66/131 (50%), Gaps = 7/131 (5%)

Query: 1001 LERPFKILVAEDNNVNQEVVKRMLNLEGLSDIDLACDGQEAFDKVKALQEANDHYRIIFM 1060
            L   F +L+ ED+ V  ++  + L   G + +++  DG  A   ++  +     Y ++ M
Sbjct: 372  LREGFHVLLVEDDAVCIQLCSKFLRKYGCT-VEVVTDGLAAISTLEKFR-----YDLVLM 425

Query: 1061 DVQMPRVDGLLSTKMIRQELRYSHPIVALTAFADDSNIKVCLDSGMNGFLSKPIKRPKLK 1120
            D+ MP +DG  +T ++R       PI+A+T   +D ++   L  GMN  L+KP  +  L 
Sbjct: 426  DIVMPNLDGATATSIVR-SFDIHTPIIAMTGNIEDQDLITYLQHGMNDILAKPFTKDDLH 484

Query: 1121 SVLSEFCPDFV 1131
            S+L  +  D V
Sbjct: 485  SMLIRYLRDRV 495

>Kpol_265.2 s265 (9842..11491) [1650 bp, 549 aa] {ON} (9842..11491)
            [1650 nt, 550 aa]
          Length = 549

 Score = 62.4 bits (150), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 37/131 (28%), Positives = 68/131 (51%), Gaps = 7/131 (5%)

Query: 1001 LERPFKILVAEDNNVNQEVVKRMLNLEGLSDIDLACDGQEAFDKVKALQEANDHYRIIFM 1060
            L++ F +L+ ED++V+ ++  + L   G + + +  DG  A   ++  +     + ++ M
Sbjct: 378  LKKGFHVLLVEDDDVSIQLCSKFLRKYGCT-VQVVTDGLAAISILEKFR-----FDLVLM 431

Query: 1061 DVQMPRVDGLLSTKMIRQELRYSHPIVALTAFADDSNIKVCLDSGMNGFLSKPIKRPKLK 1120
            D+ MP +DG  +T +IR       PI+A+T   +  ++   L  GMN  L+KP  R  L 
Sbjct: 432  DIVMPNLDGATATSIIRN-FDNRTPIIAMTGSIEHQDLITYLQHGMNDILAKPFTRKDLY 490

Query: 1121 SVLSEFCPDFV 1131
            S+L  +  D V
Sbjct: 491  SILIRYLKDRV 501

>Smik_8.296 Chr8 (487452..489329) [1878 bp, 625 aa] {ON} YHR206W
            (REAL)
          Length = 625

 Score = 62.4 bits (150), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 36/132 (27%), Positives = 67/132 (50%), Gaps = 7/132 (5%)

Query: 1000 SLERPFKILVAEDNNVNQEVVKRMLNLEGLSDIDLACDGQEAFDKVKALQEANDHYRIIF 1059
            +L + F +L+ ED+ V+ ++  + L   G + + +  DG  A   ++  +     Y ++ 
Sbjct: 374  TLRKGFHVLLVEDDAVSIQLCSKFLRKYGCT-VQVVTDGLSAISTLEKFR-----YDLVL 427

Query: 1060 MDVQMPRVDGLLSTKMIRQELRYSHPIVALTAFADDSNIKVCLDSGMNGFLSKPIKRPKL 1119
            MD+ MP +DG  +T ++R       PI+A+T    + ++   L  GMN  L+KP  R  L
Sbjct: 428  MDIVMPNLDGATATSIVR-SFDNETPIIAMTGNIMNQDLITYLQHGMNDILAKPFTRDDL 486

Query: 1120 KSVLSEFCPDFV 1131
             S+L  +  D +
Sbjct: 487  HSILIRYLKDRI 498

>Suva_15.412 Chr15 (719438..721291) [1854 bp, 617 aa] {ON} YHR206W
            (REAL)
          Length = 617

 Score = 62.4 bits (150), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 36/132 (27%), Positives = 67/132 (50%), Gaps = 7/132 (5%)

Query: 1000 SLERPFKILVAEDNNVNQEVVKRMLNLEGLSDIDLACDGQEAFDKVKALQEANDHYRIIF 1059
            +L + F +L+ ED+ V+ ++  + L   G + + +  DG  A   ++  +     Y ++ 
Sbjct: 373  TLRKGFHVLLVEDDAVSIQLCSKFLRKYGCT-VQVVTDGLSAISTLEKFR-----YDLVL 426

Query: 1060 MDVQMPRVDGLLSTKMIRQELRYSHPIVALTAFADDSNIKVCLDSGMNGFLSKPIKRPKL 1119
            MD+ MP +DG  +T ++R       PI+A+T    + ++   L  GMN  L+KP  R  L
Sbjct: 427  MDIVMPNLDGATATSIVR-SFDNETPIIAMTGNIMNQDLITYLQHGMNDILAKPFTRDDL 485

Query: 1120 KSVLSEFCPDFV 1131
             S+L  +  D +
Sbjct: 486  HSILIRYLKDRI 497

>Skud_8.273 Chr8 (481627..483498) [1872 bp, 623 aa] {ON} YHR206W
            (REAL)
          Length = 623

 Score = 62.4 bits (150), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 36/132 (27%), Positives = 67/132 (50%), Gaps = 7/132 (5%)

Query: 1000 SLERPFKILVAEDNNVNQEVVKRMLNLEGLSDIDLACDGQEAFDKVKALQEANDHYRIIF 1059
            +L + F +L+ ED+ V+ ++  + L   G + + +  DG  A   ++  +     Y ++ 
Sbjct: 374  TLRKGFHVLLVEDDVVSIQLCSKFLRKYGCT-VQVVTDGLSAISTLEKFR-----YDLVL 427

Query: 1060 MDVQMPRVDGLLSTKMIRQELRYSHPIVALTAFADDSNIKVCLDSGMNGFLSKPIKRPKL 1119
            MD+ MP +DG  +T ++R       PI+A+T    + ++   L  GMN  L+KP  R  L
Sbjct: 428  MDIVMPNLDGATATSIVR-SFDNETPIIAMTGNIMNQDLITYLQHGMNDILAKPFTRDDL 486

Query: 1120 KSVLSEFCPDFV 1131
             S+L  +  D +
Sbjct: 487  HSILIRYLKDRI 498

>NDAI0D03430 Chr4 (809977..811770) [1794 bp, 597 aa] {ON} Anc_4.385
          Length = 597

 Score = 62.0 bits (149), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 36/126 (28%), Positives = 66/126 (52%), Gaps = 7/126 (5%)

Query: 998  VKSLERPFKILVAEDNNVNQEVVKRMLNLEGLSDIDLACDGQEAFDKVKALQEANDHYRI 1057
             + L + + +L+ ED+ V+ ++  + L   G + +++  DG  A   ++A +     Y +
Sbjct: 417  TEELRKGYHVLLVEDDAVSIQLCSKFLRKSGCT-VEVVTDGLAAISILEAFR-----YDL 470

Query: 1058 IFMDVQMPRVDGLLSTKMIRQELRYSHPIVALTAFADDSNIKVCLDSGMNGFLSKPIKRP 1117
            + MD+ MP +DG  +T +IR       PI+A+T   +D ++   L  GM   L+KP  R 
Sbjct: 471  VLMDIVMPNLDGATATSIIR-NFDKETPIIAMTGNIEDQDLITYLQHGMTDILAKPFTRD 529

Query: 1118 KLKSVL 1123
             L S+L
Sbjct: 530  DLLSML 535

>YHR206W Chr8 (512732..514600) [1869 bp, 622 aa] {ON}  SKN7Nuclear
            response regulator and transcription factor; physically
            interacts with the Tup1-Cyc8 complex and recruits Tup1p
            to its targets; part of a branched two-component
            signaling system; required for optimal induction of
            heat-shock genes in response to oxidative stress;
            involved in osmoregulation
          Length = 622

 Score = 62.0 bits (149), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 36/132 (27%), Positives = 67/132 (50%), Gaps = 7/132 (5%)

Query: 1000 SLERPFKILVAEDNNVNQEVVKRMLNLEGLSDIDLACDGQEAFDKVKALQEANDHYRIIF 1059
            +L + F +L+ ED+ V+ ++  + L   G + + +  DG  A   ++  +     Y ++ 
Sbjct: 372  TLRKGFHVLLVEDDAVSIQLCSKFLRKYGCT-VQVVSDGLSAISTLEKYR-----YDLVL 425

Query: 1060 MDVQMPRVDGLLSTKMIRQELRYSHPIVALTAFADDSNIKVCLDSGMNGFLSKPIKRPKL 1119
            MD+ MP +DG  +T ++R       PI+A+T    + ++   L  GMN  L+KP  R  L
Sbjct: 426  MDIVMPNLDGATATSIVR-SFDNETPIIAMTGNIMNQDLITYLQHGMNDILAKPFTRDDL 484

Query: 1120 KSVLSEFCPDFV 1131
             S+L  +  D +
Sbjct: 485  HSILIRYLKDRI 496

>KLTH0D17182g Chr4 complement(1424948..1426342) [1395 bp, 464 aa] {ON}
            similar to uniprot|P38889 Saccharomyces cerevisiae
            YHR206W
          Length = 464

 Score = 60.8 bits (146), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 35/125 (28%), Positives = 66/125 (52%), Gaps = 8/125 (6%)

Query: 1003 RP-FKILVAEDNNVNQEVVKRMLNLEGLSDIDLACDGQEAFDKVKALQEANDHYRIIFMD 1061
            RP F +L+ ED+++  ++  + L   G + +++  DG  A   ++  +     Y ++ MD
Sbjct: 302  RPGFHVLLVEDDSICIQLCSKFLMKYGCT-VEVVTDGLSAISTLEKFR-----YDLVLMD 355

Query: 1062 VQMPRVDGLLSTKMIRQELRYSHPIVALTAFADDSNIKVCLDSGMNGFLSKPIKRPKLKS 1121
            + MP +DG  +T ++R       PI+A+T   +D ++   L  GMN  L+KP  +  L S
Sbjct: 356  IVMPNLDGATATSIVR-SFDNQTPIIAMTGNIEDQDLVTYLQHGMNDILAKPFTKDDLHS 414

Query: 1122 VLSEF 1126
            +L  +
Sbjct: 415  MLIRY 419

>TPHA0C00150 Chr3 complement(15029..16561) [1533 bp, 510 aa] {ON}
            Anc_4.385 YJR147W
          Length = 510

 Score = 60.1 bits (144), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 37/132 (28%), Positives = 66/132 (50%), Gaps = 9/132 (6%)

Query: 1001 LERPFKILVAEDNNVNQEVVKRMLNLEGLSDIDLACDGQEAFDKVKALQEANDH-YRIIF 1059
            L++ F +L+ ED+ V+ ++  + L       I   C  Q   D + A+     + + ++ 
Sbjct: 346  LKKGFNVLLVEDDEVSIQLCSKFL-------IKYGCTVQVVTDGLAAISTLEKYRFDLVL 398

Query: 1060 MDVQMPRVDGLLSTKMIRQELRYSHPIVALTAFADDSNIKVCLDSGMNGFLSKPIKRPKL 1119
            MD+ MP +DG  +T +IR       PI+A+T   +  ++   L  GMN  L+KP  R  L
Sbjct: 399  MDIVMPNLDGATATSIIRN-FDNETPIIAMTGSIEHQDLITYLQHGMNDILAKPFTRRDL 457

Query: 1120 KSVLSEFCPDFV 1131
             S+L+ +  + V
Sbjct: 458  YSMLTRYLKNRV 469

>CAGL0D02882g Chr4 complement(300025..302028) [2004 bp, 667 aa] {ON}
            similar to uniprot|Q07084 Saccharomyces cerevisiae
            YLR006c SSK1 two-component signal transducer
          Length = 667

 Score = 58.5 bits (140), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 47/149 (31%), Positives = 70/149 (46%), Gaps = 33/149 (22%)

Query: 1005 FKILVAEDNNVNQEVVKRMLNLEGLSDIDLACDGQEAFDKVKALQEANDHYRIIFMDVQM 1064
              +L+ EDN +NQ ++   L    +S   +A +G+EA DK K   E N H  +IFMD+Q+
Sbjct: 463  INVLIVEDNVINQAILGSFLRKNKIS-YKIAKNGKEAVDKWK---EGNLH--LIFMDLQL 516

Query: 1065 PRVDGLLSTKMIR----------QELRYSHP-----------------IVALTAFADDSN 1097
            P + G+ + K IR          Q  R S P                 IVALTA     +
Sbjct: 517  PVLSGIEAAKKIRELEKERGIANQSERVSTPGSLSSINMNGSTNSPVIIVALTASNSQED 576

Query: 1098 IKVCLDSGMNGFLSKPIKRPKLKSVLSEF 1126
             +  L SG N +L+KP+    L   ++E+
Sbjct: 577  KREALISGCNDYLTKPVNLLWLSKKITEW 605

>Kwal_47.16770 s47 (103208..104593) [1386 bp, 461 aa] {ON} YHR206W
            (SKN7) - transcription factor involved in oxidative
            stress response [contig 376] FULL
          Length = 461

 Score = 57.8 bits (138), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 33/125 (26%), Positives = 66/125 (52%), Gaps = 8/125 (6%)

Query: 1003 RP-FKILVAEDNNVNQEVVKRMLNLEGLSDIDLACDGQEAFDKVKALQEANDHYRIIFMD 1061
            RP F +L+ ED+++  ++  + L ++    +++  DG  A   ++  +     + ++ MD
Sbjct: 299  RPGFHVLLVEDDSICIQLCSKFL-MKYACTVEVVTDGLSAISTLEKFR-----FDLVLMD 352

Query: 1062 VQMPRVDGLLSTKMIRQELRYSHPIVALTAFADDSNIKVCLDSGMNGFLSKPIKRPKLKS 1121
            + MP +DG  +T ++R       PI+A+T   +D ++   L  GMN  L+KP  +  L S
Sbjct: 353  IVMPNLDGATATSIVR-SFDNQTPIIAMTGNIEDQDLVTYLQHGMNDILAKPFTKDDLHS 411

Query: 1122 VLSEF 1126
            +L  +
Sbjct: 412  MLIRY 416

>KAFR0J00700 Chr10 (127858..129720) [1863 bp, 620 aa] {ON} Anc_5.230
            YLR006C
          Length = 620

 Score = 56.2 bits (134), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 41/125 (32%), Positives = 66/125 (52%), Gaps = 11/125 (8%)

Query: 1007 ILVAEDNNVNQEVVKRMLNLEGLSDIDLACDGQEAFDKVKALQEANDHYRIIFMDVQMPR 1066
            +L+ EDN +NQ ++   L    +S   +A +G+EA +  K     N    +IFMD+Q+P 
Sbjct: 477  VLIVEDNVINQAILGGFLRKHKIS-YKVAKNGKEAVEMWK-----NGGLHLIFMDLQLPV 530

Query: 1067 VDGLLSTKMIR---QELRYSHP--IVALTAFADDSNIKVCLDSGMNGFLSKPIKRPKLKS 1121
            + G+ + K IR   +E     P  IVALTA     + +  L SG N +L+KP+    L  
Sbjct: 531  LSGIDAAKQIRDFEKERPSCAPVIIVALTASNSAEDKRNALVSGCNDYLTKPVNLHWLSK 590

Query: 1122 VLSEF 1126
             ++E+
Sbjct: 591  KITEW 595

>Suva_10.84 Chr10 complement(167272..169359) [2088 bp, 695 aa] {ON}
            YLR006C (REAL)
          Length = 695

 Score = 54.7 bits (130), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 45/147 (30%), Positives = 69/147 (46%), Gaps = 33/147 (22%)

Query: 1007 ILVAEDNNVNQEVVKRMLNLEGLSDIDLACDGQEAFDKVKALQEANDHYRIIFMDVQMPR 1066
            +L+ EDN +NQ ++   L    +S   LA +GQEA   V   +E   H  +IFMD+Q+P 
Sbjct: 488  VLIVEDNVINQAILGSFLRKHKIS-YKLAKNGQEA---VNIWKEGGLH--LIFMDLQLPV 541

Query: 1067 VDGLLSTKMIR-----------QELRYSHP----------------IVALTAFADDSNIK 1099
            + G+ + K IR           + L  S+P                IVALTA     + +
Sbjct: 542  LSGIEAAKQIRDFEKQNGIGIQKSLNNSYPNHEKLPCKKFSQAPVIIVALTASNSQMDKR 601

Query: 1100 VCLDSGMNGFLSKPIKRPKLKSVLSEF 1126
              L SG N +L+KP+    L   ++E+
Sbjct: 602  KALVSGCNDYLTKPVNLHWLSKKITEW 628

>Ecym_5077 Chr5 (166792..169179) [2388 bp, 795 aa] {ON} similar to
            Ashbya gossypii ADR343C
          Length = 795

 Score = 54.7 bits (130), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 42/148 (28%), Positives = 71/148 (47%), Gaps = 34/148 (22%)

Query: 1007 ILVAEDNNVNQEVVKRMLNLEGLSDIDLACDGQEAFDKVKALQEANDHYRIIFMDVQMPR 1066
            +L+ EDN +NQ ++   L    +S  ++A +G EA +K +   +   H  +I MD+Q+P 
Sbjct: 551  VLIVEDNIINQAILVSFLKRHRIS-YEIAKNGAEAVEKWR---QGGIH--LILMDLQLPL 604

Query: 1067 VDGLLSTKMIR----------------------------QELRYSHPIVALTAFADDSNI 1098
            + GL +TK IR                             + R    IVALTAF+  ++ 
Sbjct: 605  LSGLEATKQIRDMEKLNGINKFHKSDLKPGRDTSLDLDRSKFRSPVIIVALTAFSSHADR 664

Query: 1099 KVCLDSGMNGFLSKPIKRPKLKSVLSEF 1126
            +  L +G N +L+KP+    L S ++E+
Sbjct: 665  REALVAGCNDYLTKPVNLDWLSSKITEW 692

>KNAG0B05140 Chr2 (985361..987307) [1947 bp, 648 aa] {ON} Anc_5.230
            YLR006C
          Length = 648

 Score = 53.9 bits (128), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 67/127 (52%), Gaps = 13/127 (10%)

Query: 1007 ILVAEDNNVNQEVVKRMLNLEGLSDIDLACDGQEAFDKVKALQEANDHYRIIFMDVQMPR 1066
            +L+ EDN +NQ ++   L    +S   +A +G+EA D  K   E   H  +IFMD+Q+P 
Sbjct: 519  VLIVEDNVINQAILGSFLRKHKIS-YKVAKNGKEAVDIWK---EGGLH--LIFMDLQLPV 572

Query: 1067 VDGLLSTKMIR-----QELRYSHP--IVALTAFADDSNIKVCLDSGMNGFLSKPIKRPKL 1119
            + G+ + K IR     +    + P  IVALTA     + +  L SG N +L+KP+    L
Sbjct: 573  LSGIDAAKQIRDCEKKRTASQNAPVIIVALTASNSIEDKRKALISGCNDYLTKPVNLHWL 632

Query: 1120 KSVLSEF 1126
               ++E+
Sbjct: 633  SKKITEW 639

>YLR006C Chr12 complement(161755..163893) [2139 bp, 712 aa] {ON}
            SSK1Cytoplasmic response regulator; part of a
            two-component signal transducer that mediates osmosensing
            via a phosphorelay mechanism; required for mitophagy;
            dephosphorylated form is degraded by the
            ubiquitin-proteasome system; potential Cdc28p substrate
          Length = 712

 Score = 53.9 bits (128), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 45/147 (30%), Positives = 68/147 (46%), Gaps = 33/147 (22%)

Query: 1007 ILVAEDNNVNQEVVKRMLNLEGLSDIDLACDGQEAFDKVKALQEANDHYRIIFMDVQMPR 1066
            +L+ EDN +NQ ++   L    +S   LA +GQEA   V   +E   H  +IFMD+Q+P 
Sbjct: 506  VLIVEDNVINQAILGSFLRKHKIS-YKLAKNGQEA---VNIWKEGGLH--LIFMDLQLPV 559

Query: 1067 VDGLLSTKMIR-----------QELRYSHP----------------IVALTAFADDSNIK 1099
            + G+ + K IR           + L  SH                 IVALTA     + +
Sbjct: 560  LSGIEAAKQIRDFEKQNGIGIQKSLNNSHSNLEKGTSKRFSQAPVIIVALTASNSQMDKR 619

Query: 1100 VCLDSGMNGFLSKPIKRPKLKSVLSEF 1126
              L SG N +L+KP+    L   ++E+
Sbjct: 620  KALLSGCNDYLTKPVNLHWLSKKITEW 646

>Skud_12.72 Chr12 complement(153012..155120) [2109 bp, 702 aa] {ON}
            YLR006C (REAL)
          Length = 702

 Score = 52.4 bits (124), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 45/147 (30%), Positives = 68/147 (46%), Gaps = 33/147 (22%)

Query: 1007 ILVAEDNNVNQEVVKRMLNLEGLSDIDLACDGQEAFDKVKALQEANDHYRIIFMDVQMPR 1066
            +L+ EDN +NQ ++   L    +S   LA +GQEA   V   +E   H  +IFMD+Q+P 
Sbjct: 495  VLIVEDNVINQAILGSFLRKHKIS-YKLAKNGQEA---VNIWKEGGLH--LIFMDLQLPV 548

Query: 1067 VDGLLSTKMIR-----------QELRYSHP----------------IVALTAFADDSNIK 1099
            + G+ + K IR           + L  SH                 IVALTA     + +
Sbjct: 549  LSGIEAAKQIRDFEKQNGIGIQKGLNNSHSNFDKGTSKKFSQAPVIIVALTASNSQMDKR 608

Query: 1100 VCLDSGMNGFLSKPIKRPKLKSVLSEF 1126
              L SG N +L+KP+    L   ++E+
Sbjct: 609  KALLSGCNDYLTKPVNLHWLSKKITEW 635

>ZYRO0A11154g Chr1 (893793..896123) [2331 bp, 776 aa] {ON} similar to
            uniprot|Q07084 Saccharomyces cerevisiae YLR006C SSK1
            Cytoplasmic response regulator part of a two- component
            signal transducer that mediates osmosensing via a
            phosphorelay mechanism dephosphorylated form is degraded
            by the ubiquitin-proteasome system potential Cdc28p
            substrate
          Length = 776

 Score = 52.0 bits (123), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 44/147 (29%), Positives = 67/147 (45%), Gaps = 34/147 (23%)

Query: 1007 ILVAEDNNVNQEVVKRMLNLEGLSDIDLACDGQEAFDKVKALQEANDHYRIIFMDVQMPR 1066
            +L+ EDN +NQ ++   L    +    +A +GQEA D     +E   H  +IFMD+Q+P 
Sbjct: 567  VLIVEDNVINQTILSSFLRKHKIF-YKVAKNGQEAID---VWREGGIH--LIFMDLQLPV 620

Query: 1067 VDGLLSTKMIRQELRYSHPI---------------------------VALTAFADDSNIK 1099
            + G+ + K IR EL   H I                           VA TA    S+ K
Sbjct: 621  LSGIDAAKKIR-ELEREHGIGIQKSRKTPHIESNKINKDQINAPVIIVAFTASKSQSDKK 679

Query: 1100 VCLDSGMNGFLSKPIKRPKLKSVLSEF 1126
              L SG N +L+KP+    L + ++E+
Sbjct: 680  EALISGCNDYLTKPVNLHWLSNKINEW 706

>Smik_12.68 Chr12 complement(148821..150959) [2139 bp, 712 aa] {ON}
            YLR006C (REAL)
          Length = 712

 Score = 51.6 bits (122), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 44/147 (29%), Positives = 67/147 (45%), Gaps = 33/147 (22%)

Query: 1007 ILVAEDNNVNQEVVKRMLNLEGLSDIDLACDGQEAFDKVKALQEANDHYRIIFMDVQMPR 1066
            +L+ EDN +NQ ++   L    +S   LA +GQEA   V   +E   H  +IFMD+Q+P 
Sbjct: 505  VLIVEDNVINQAILGSFLRKHKIS-YKLAKNGQEA---VNIWKEGGLH--LIFMDLQLPV 558

Query: 1067 VDGLLSTKMIRQ------------------------ELRYSHP---IVALTAFADDSNIK 1099
            + G+ + K IR                           R+S     IVALTA     + +
Sbjct: 559  LSGIEAAKQIRDFEKQNGIGIQKTPNNSHYNFEKSASKRFSQAPVIIVALTASNSQMDKR 618

Query: 1100 VCLDSGMNGFLSKPIKRPKLKSVLSEF 1126
              L SG N +L+KP+    L   ++E+
Sbjct: 619  KALLSGCNDYLTKPVNLHWLSKKITEW 645

>TDEL0E03980 Chr5 (741644..743836) [2193 bp, 730 aa] {ON} Anc_5.230
            YLR006C
          Length = 730

 Score = 51.6 bits (122), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 66/140 (47%), Gaps = 26/140 (18%)

Query: 1007 ILVAEDNNVNQEVVKRMLNLEGLSDIDLACDGQEAFDKVKALQEANDHYRIIFMDVQMPR 1066
            +L+ EDN +NQ +++  L    +S   +A +GQEA D+ K          +IFMD+Q+P 
Sbjct: 503  VLIVEDNVINQAILRSFLKKHKIS-YKVAKNGQEAVDRWK-----EGGIDLIFMDLQLPV 556

Query: 1067 VDGLLSTKMIRQ------------------ELRYSHP--IVALTAFADDSNIKVCLDSGM 1106
              G+ + K IR                   + R   P  IVA TA    ++ +  L SG 
Sbjct: 557  FSGMDAAKKIRDLEKLNASSETLPDSKEGDKKRSKAPVIIVAFTASNTRADKREALLSGC 616

Query: 1107 NGFLSKPIKRPKLKSVLSEF 1126
            N +L+KP+    L   ++E+
Sbjct: 617  NDYLTKPVNLHWLSKKINEW 636

>KLLA0E09505g Chr5 (840647..842554) [1908 bp, 635 aa] {ON} weakly
            similar to uniprot|Q07084 Saccharomyces cerevisiae
            YLR006C SSK1 Cytoplasmic response regulator part of a
            two-component signal transducer that mediates osmosensing
            via a phosphorelay mechanism dephosphorylated form is
            degraded by the ubiquitin-proteasome system potential
            Cdc28p substrate
          Length = 635

 Score = 50.8 bits (120), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 44/72 (61%), Gaps = 6/72 (8%)

Query: 1007 ILVAEDNNVNQEVVKRMLNLEGLSDIDLACDGQEAFDKVKALQEANDHYRIIFMDVQMPR 1066
            +L+ EDN +NQ ++   L   G+S   +A DG EA +K K   E + H  +I MD+Q+P 
Sbjct: 396  VLIVEDNAINQAILALFLRKNGIS-YKVAKDGVEAIEKWK---EGDSH--LILMDLQLPL 449

Query: 1067 VDGLLSTKMIRQ 1078
            + GL +TK IR+
Sbjct: 450  LSGLEATKKIRE 461

>NCAS0D02900 Chr4 complement(551013..553301) [2289 bp, 762 aa] {ON}
            Anc_5.230 YLR006C
          Length = 762

 Score = 50.8 bits (120), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 41/139 (29%), Positives = 68/139 (48%), Gaps = 25/139 (17%)

Query: 1007 ILVAEDNNVNQEVVKRMLNLEGLSDIDLACDGQEAFDKVKALQEANDHYRIIFMDVQMPR 1066
            +L+ EDN +NQ ++   L    +S   +A +G+EA D  K   E   H  +IFMD+Q+P 
Sbjct: 547  VLIVEDNVINQAILGSFLRKHKIS-YKVAKNGKEAVDIWK---EGGLH--LIFMDLQLPV 600

Query: 1067 VDGLLSTKMIR-----------------QELRYSHP--IVALTAFADDSNIKVCLDSGMN 1107
            + G+ + + IR                 ++ +   P  IVALTA     + +  L SG N
Sbjct: 601  LSGIEAARQIRAFEKENGIGIQEHSNSLKKNKTKAPVIIVALTASNSQDDKRNALISGCN 660

Query: 1108 GFLSKPIKRPKLKSVLSEF 1126
             +L+KP+    L   ++E+
Sbjct: 661  DYLTKPVNLHWLSKKITEW 679

>ADR343C Chr4 complement(1311984..1314233) [2250 bp, 749 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YLR006C
            (SSK1)
          Length = 749

 Score = 50.4 bits (119), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 40/150 (26%), Positives = 70/150 (46%), Gaps = 34/150 (22%)

Query: 1005 FKILVAEDNNVNQEVVKRMLNLEGLSDIDLACDGQEAFDKVKALQEANDHYRIIFMDVQM 1064
              +L+ EDN +NQ ++   L    +S  ++A +G EA +K +          +I MD+Q+
Sbjct: 509  INVLIVEDNIINQAILSSFLRKHKIS-YEIAKNGVEAVEKWR-----KGGIHLILMDLQL 562

Query: 1065 PRVDGLLSTKMIR-------------------QE-------LRYSHP--IVALTAFADDS 1096
            P + G+ + K IR                   QE        ++  P  IVALTAF+  +
Sbjct: 563  PLLSGIDAAKQIRNLERASGICAFQKHCEARSQETYSELNRAKFRAPVIIVALTAFSSHA 622

Query: 1097 NIKVCLDSGMNGFLSKPIKRPKLKSVLSEF 1126
            +    L +G N +L+KP+    L + ++E+
Sbjct: 623  DRNEALVAGCNDYLTKPVNLDWLSNKITEW 652

>Kpol_1004.4 s1004 complement(9754..11898) [2145 bp, 714 aa] {ON}
            complement(9754..11898) [2145 nt, 715 aa]
          Length = 714

 Score = 48.9 bits (115), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 42/150 (28%), Positives = 69/150 (46%), Gaps = 36/150 (24%)

Query: 1007 ILVAEDNNVNQEVVKRMLNLEGLSDIDLACDGQEAFDKVKALQEANDHYRIIFMDVQMPR 1066
            +L+ EDN +NQ ++   L    +S   +A +G+EA DK K   E   H  +IFMD+Q+P 
Sbjct: 513  VLIVEDNVINQTILASFLRKHKIS-YKVAKNGREAVDKWK---EGGLH--LIFMDLQLPV 566

Query: 1067 VDGLLSTKMIRQELRY----------------------------SHP--IVALTAFADDS 1096
            + G+ + K IR+  ++                              P  IVA TA    +
Sbjct: 567  LSGIDAAKEIREYEKHKGIGIQKASSTTSTTNLEDTKKIDKNSTGAPVIIVAFTASNSLT 626

Query: 1097 NIKVCLDSGMNGFLSKPIKRPKLKSVLSEF 1126
            + +  L SG N +L+KP+    L   ++E+
Sbjct: 627  DKREALISGCNDYLTKPVNLHWLSKKITEW 656

>NDAI0I02000 Chr9 complement(464492..467164) [2673 bp, 890 aa] {ON}
            Anc_5.230 YLR006C
          Length = 890

 Score = 47.0 bits (110), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 42/145 (28%), Positives = 66/145 (45%), Gaps = 29/145 (20%)

Query: 1005 FKILVAEDNNVNQEVVKRMLNLEGLSDIDLACDGQEAFDKVKALQEANDHYRIIFMDVQM 1064
              +L+ EDN +NQ ++   L    +S   +A +G+EA D  K   E   H  +IFMD+Q+
Sbjct: 670  INVLIVEDNVINQAILGSFLRKHKIS-YKVAKNGKEAVDIWK---EGGLH--LIFMDLQL 723

Query: 1065 PRVDGLLSTKMIR----------QELRYSHPI-------------VALTAFADDSNIKVC 1101
            P + G+ + + IR          QE      I             VALTA     + +  
Sbjct: 724  PVLSGIEAARQIRDFEKEKGIGIQENNLKQKIIPASNINQAPVIIVALTASNSLDDKRKA 783

Query: 1102 LDSGMNGFLSKPIKRPKLKSVLSEF 1126
            L SG N +L+KP+    L   ++E+
Sbjct: 784  LLSGCNDYLTKPVNLHWLSKKITEW 808

>Kwal_33.15288 s33 complement(1045147..1046910) [1764 bp, 587 aa] {ON}
            YLR006C (SSK1) - Two-component signal transducer that
            with Sln1p regulates osmosensing MAP kinase
            cascade(suppressor of sensor kinase) [contig 94] FULL
          Length = 587

 Score = 46.6 bits (109), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 47/171 (27%), Positives = 73/171 (42%), Gaps = 30/171 (17%)

Query: 979  DRPFLQXXXXXXXXXXXXXVKSLERPFKILVAEDNNVNQEVVKRMLNLEGLSDIDLACDG 1038
            D PFL+              K   +   +LV EDN +NQ ++   L    +S   +A +G
Sbjct: 394  DSPFLRSAMETFTTESITRDKVFPK-ISVLVVEDNMINQTILSSFLRKHKIS-YKVAKNG 451

Query: 1039 QEAFDKVKALQEANDHYRIIFMDVQMPRVDGLLSTKMIRQ-----ELRYSHP-------- 1085
             EA D+ K   E   H  +I MD++MP + G+ + K IR+      +    P        
Sbjct: 452  IEAVDRWK---EGGMH--LILMDLEMPLLSGIDAAKEIRRLEKLNGIGSGKPSTGEHAPA 506

Query: 1086 ----------IVALTAFADDSNIKVCLDSGMNGFLSKPIKRPKLKSVLSEF 1126
                      IVALTA    S+    L +G N +L+KP+    L   ++E+
Sbjct: 507  KRSTSKAPVIIVALTASNSQSDKTEALLAGCNDYLTKPVNLDWLTRKITEW 557

>KLTH0B02684g Chr2 (207260..209047) [1788 bp, 595 aa] {ON} some
            similarities with uniprot|Q07084 Saccharomyces cerevisiae
            YLR006C SSK1 Cytoplasmic response regulator part of a
            two-component signal transducer that mediates osmosensing
            via a phosphorelay mechanism dephosphorylated form is
            degraded by the ubiquitin-proteasome system potential
            Cdc28p substrate
          Length = 595

 Score = 45.4 bits (106), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 42/144 (29%), Positives = 67/144 (46%), Gaps = 28/144 (19%)

Query: 1005 FKILVAEDNNVNQEVVKRMLNLEGLSDIDLACDGQEAFDKVKALQEANDHYRIIFMDVQM 1064
              +LV EDN +NQ ++   L    +    +A +G EA D+ K   E   H  +I MD++M
Sbjct: 406  ISVLVVEDNMINQAILSSFLRKHKIH-YKVAKNGVEAVDRWK---EGGMH--LILMDLEM 459

Query: 1065 PRVDGLLSTKMIRQ-----------------ELR---YSHP--IVALTAFADDSNIKVCL 1102
            P + G+ + K IR+                 EL+      P  IVALTA    ++    L
Sbjct: 460  PLLSGIDAAKEIRKLEKQNGIGTGDPLGKHAELKGLTCKAPVIIVALTASNSQTDKTEAL 519

Query: 1103 DSGMNGFLSKPIKRPKLKSVLSEF 1126
             +G N +L+KP+    L   ++E+
Sbjct: 520  LAGCNDYLTKPVNLDWLTRKITEW 543

>TPHA0N00850 Chr14 complement(189011..191023) [2013 bp, 670 aa] {ON}
            Anc_5.230 YLR006C
          Length = 670

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 40/148 (27%), Positives = 69/148 (46%), Gaps = 34/148 (22%)

Query: 1007 ILVAEDNNVNQEVVKRMLNLEGLSDIDLACDGQEAFDKVKALQEANDHYRIIFMDVQMPR 1066
            +L+ EDN +NQ ++   L    +S   +A +G+EA +K K   E   H  +IFMD+Q+P 
Sbjct: 473  VLIVEDNVINQTILASFLRKHKIS-YRIAKNGREAVEKWK---EGGIH--LIFMDLQLPV 526

Query: 1067 VDGLLSTKMIRQ-----ELRYSHP-----------------------IVALTAFADDSNI 1098
            + G+ + K IR+      +   +P                       +VA TA    ++ 
Sbjct: 527  MSGIDAAKEIRECEKLKGIGIRNPMASSSSLSIVESVEKPVLGAPVIMVAFTASNSLTDK 586

Query: 1099 KVCLDSGMNGFLSKPIKRPKLKSVLSEF 1126
            +  L SG N +L+KP+    L   ++E+
Sbjct: 587  REALVSGCNDYLTKPVNLHWLSKKITEW 614

>TBLA0D03170 Chr4 complement(771345..773642) [2298 bp, 765 aa] {ON}
            Anc_5.230 YLR006C
          Length = 765

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 42/150 (28%), Positives = 66/150 (44%), Gaps = 36/150 (24%)

Query: 1007 ILVAEDNNVNQEVVKRMLNLEGLSDIDLACDGQEAFDKVKALQEANDHYRIIFMDVQMPR 1066
            IL+ EDN +NQ ++   L    +    +A +G+EA DK K   E   H  +IFMD+Q+P 
Sbjct: 567  ILIVEDNVINQTILGSFLRKNKIF-YKVAKNGREAVDKWK---EGGIH--LIFMDLQLPV 620

Query: 1067 VDGLLSTKMIRQELR----------------------------YSHP--IVALTAFADDS 1096
            + G  + K IRQ  +                               P  IVA TA    +
Sbjct: 621  LSGTDAAKEIRQYEKKIGIGIQKKQSSSSDLSLSESFLNTKSSACAPVIIVAFTASNSLA 680

Query: 1097 NIKVCLDSGMNGFLSKPIKRPKLKSVLSEF 1126
            + +  L +G N +L+KP+    L   ++E+
Sbjct: 681  DKRAALIAGCNDYLTKPVNLHWLSKKITEW 710

>SAKL0G12100g Chr7 (1029250..1031466) [2217 bp, 738 aa] {ON} weakly
            similar to uniprot|Q07084 Saccharomyces cerevisiae
            YLR006C SSK1 Cytoplasmic response regulator part of a
            two-component signal transducer that mediates osmosensing
            via a phosphorelay mechanism dephosphorylated form is
            degraded by the ubiquitin-proteasome system potential
            Cdc28p substrate
          Length = 738

 Score = 41.6 bits (96), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 40/73 (54%), Gaps = 6/73 (8%)

Query: 1005 FKILVAEDNNVNQEVVKRMLNLEGLSDIDLACDGQEAFDKVKALQEANDHYRIIFMDVQM 1064
              +L+ EDN +NQ ++   L    +S   +A +G+EA DK K          +I +D+Q+
Sbjct: 462  INVLIVEDNVINQAILGSFLRKHKIS-YKVAKNGREAVDKWKQ-----GGIHLILLDLQL 515

Query: 1065 PRVDGLLSTKMIR 1077
            P + G+ +TK IR
Sbjct: 516  PILSGIEATKEIR 528

>TPHA0F02430 Chr6 complement(535865..538261) [2397 bp, 798 aa] {ON}
            Anc_6.31 YMR001C
          Length = 798

 Score = 37.0 bits (84), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 28/50 (56%)

Query: 1070 LLSTKMIRQELRYSHPIVALTAFADDSNIKVCLDSGMNGFLSKPIKRPKL 1119
            LLS   I Q LRYSH +  +  F D+ N+ + L+   NG L   +K+ K+
Sbjct: 137  LLSEIQIHQNLRYSHIVKFMDCFEDELNVYILLELCPNGSLMDLLKKRKI 186

>KLLA0E04533g Chr5 (408415..409680) [1266 bp, 421 aa] {ON} similar
           to uniprot|P40530 Saccharomyces cerevisiae YIL042C
           Hypothetical ORF
          Length = 421

 Score = 36.2 bits (82), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 20/81 (24%), Positives = 37/81 (45%), Gaps = 15/81 (18%)

Query: 830 IAIEVEDTGPGIEPALHESVFEPFV------QGDQTLS---------RQYGGTGLGLSIC 874
           + I + D G GI+P + + VF+         + D  +S         +   G G GL +C
Sbjct: 325 LEIRIRDFGGGIDPQVEDRVFDYSFSTTVKEEKDSGMSDYVLPGQEVQNVAGMGFGLPMC 384

Query: 875 RQLAKMMKGTMKLESKVGVGS 895
           +   ++  GT+ ++S  G G+
Sbjct: 385 KAYLELFNGTLDIQSLWGWGT 405

>TBLA0B01550 Chr2 (340204..341388) [1185 bp, 394 aa] {ON} Anc_7.222
           YIL042C
          Length = 394

 Score = 35.8 bits (81), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 37/81 (45%), Gaps = 15/81 (18%)

Query: 830 IAIEVEDTGPGIEPALHESVFE-------------PFVQGDQTLSR--QYGGTGLGLSIC 874
           ++I V D G GI P     + +             P  Q +Q  +   +  G G GL +C
Sbjct: 301 LSIRVRDHGGGIPPEREPFILDYAYTSEVNKHEGDPATQVNQVNADVPRVAGLGFGLPLC 360

Query: 875 RQLAKMMKGTMKLESKVGVGS 895
           R  A++  G++ ++S  G+G+
Sbjct: 361 RMYAELFGGSLSIQSLWGLGT 381

>SAKL0F08184g Chr6 (623521..624759) [1239 bp, 412 aa] {ON} similar
           to uniprot|P40530 Saccharomyces cerevisiae YIL042C
           Hypothetical ORF
          Length = 412

 Score = 35.0 bits (79), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 20/81 (24%), Positives = 35/81 (43%), Gaps = 15/81 (18%)

Query: 830 IAIEVEDTGPGIEPALHESVFEPFVQGDQTLSRQYG---------------GTGLGLSIC 874
           + I + D G GI P + + +FE      Q  ++  G               G G GL +C
Sbjct: 317 LEIRIRDFGGGIPPEVEDRMFEYSYSTVQANTKDTGMSAYVIPGEEVNNVSGMGFGLPMC 376

Query: 875 RQLAKMMKGTMKLESKVGVGS 895
           +   +M  G++ ++S  G G+
Sbjct: 377 KAYLEMFDGSLDIQSLYGWGT 397

>ZYRO0D16544g Chr4 (1373180..1374448) [1269 bp, 422 aa] {ON} similar
           to uniprot|P40530 Saccharomyces cerevisiae YIL042C
           Hypothetical ORF
          Length = 422

 Score = 35.0 bits (79), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 20/82 (24%), Positives = 36/82 (43%), Gaps = 17/82 (20%)

Query: 830 IAIEVEDTGPGIEPALHESVF----------------EPFVQGDQTLSRQYGGTGLGLSI 873
           + I + D G GI PA+ E +F                E ++   + ++    G G GL +
Sbjct: 328 LQIRIRDFGGGIPPAVEEKMFDYSYSTVAEKKNDTGAEAYILPGENVN-NVSGMGFGLPM 386

Query: 874 CRQLAKMMKGTMKLESKVGVGS 895
           C+   +M  G + ++S  G G+
Sbjct: 387 CKAYMEMFDGRLDIQSLWGWGT 408

>Kwal_47.18151 s47 (709368..710612) [1245 bp, 414 aa] {ON} YIL042C -
           Hypothetical ORF [contig 197] FULL
          Length = 414

 Score = 34.7 bits (78), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 20/81 (24%), Positives = 35/81 (43%), Gaps = 15/81 (18%)

Query: 830 IAIEVEDTGPGIEPALHESVFEPFVQGDQTLSRQYG---------------GTGLGLSIC 874
           + I + D G GI P + + +F+       T ++  G               G G GL +C
Sbjct: 319 LKIRIRDFGGGIPPVVEDRMFDYSYSTVNTDAKDSGMSAYVIPGADVCNVSGMGFGLPMC 378

Query: 875 RQLAKMMKGTMKLESKVGVGS 895
           +   +M  GT+ ++S  G G+
Sbjct: 379 KAYMEMFNGTLDIQSLWGWGT 399

>TBLA0E04980 Chr5 (1275927..1278302) [2376 bp, 791 aa] {ON} Anc_4.385
            YJR147W
          Length = 791

 Score = 34.7 bits (78), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 30/133 (22%), Positives = 61/133 (45%), Gaps = 17/133 (12%)

Query: 1002 ERPFKILVAEDNNVNQEVVKRMLNLEGLSDIDLACDGQEAFDKVKALQEANDHYRIIFMD 1061
            ++ F IL+ + + +  E  K +L    ++ +D+  D  +  +K+      N  Y ++ +D
Sbjct: 489  DKGFHILIIDADPMFIERCKTVLEQYRIT-VDIMQDWPKTKEKI-----LNKCYDLVIID 542

Query: 1062 -----VQMPRVDGLLSTKMIRQELRYSHPIVALTAFADDSNIKVCLDSGMNGFLSKPIKR 1116
                 + +P ++ +LS+      ++Y  PI+ +T+  +D  +   L  G+N  L KP   
Sbjct: 543  AHVKFLNVPILESMLSS------IQYHPPIILMTSSLNDQQLIFYLQHGINSILEKPFHS 596

Query: 1117 PKLKSVLSEFCPD 1129
             KL   L     D
Sbjct: 597  HKLLKFLVNLLKD 609

>Kwal_56.22476 s56 complement(145039..147132) [2094 bp, 697 aa] {ON}
            YMR001C (CDC5) - protein kinase which functions at the
            G(sub)2/M boundary [contig 185] FULL
          Length = 697

 Score = 32.0 bits (71), Expect = 10.0,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 29/50 (58%)

Query: 1070 LLSTKMIRQELRYSHPIVALTAFADDSNIKVCLDSGMNGFLSKPIKRPKL 1119
            LLS   I + +R+++ +  +  F DD+N+ + L+   NG L   +KR K+
Sbjct: 123  LLSEIQIHKSMRHTNIVQFVDCFEDDTNVYILLEICPNGSLMDLLKRRKM 172

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.131    0.369 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 106,097,040
Number of extensions: 4377118
Number of successful extensions: 15873
Number of sequences better than 10.0: 105
Number of HSP's gapped: 16262
Number of HSP's successfully gapped: 129
Length of query: 1140
Length of database: 53,481,399
Length adjustment: 121
Effective length of query: 1019
Effective length of database: 39,606,813
Effective search space: 40359342447
Effective search space used: 40359342447
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 71 (32.0 bits)